NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome Family F077316

Metagenome Family F077316

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F077316
Family Type Metagenome
Number of Sequences 117
Average Sequence Length 57 residues
Representative Sequence MKKQSKGINKRLESWINNRLFKTLNPKDWEIESILYIYNNEKDSNIRGRSEQGKHSSRRN
Number of Associated Samples 80
Number of Associated Scaffolds 117

Quality Assessment
Transcriptomic Evidence No
Most common taxonomic group Viruses
% of genes with valid RBS motifs 81.20 %
% of genes near scaffold ends (potentially truncated) 38.46 %
% of genes from short scaffolds (< 2000 bps) 67.52 %
Associated GOLD sequencing projects 65
AlphaFold2 3D model prediction No

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Predicted Viral (43.590 % of family members)
NCBI Taxonomy ID 10239 (predicted)
Taxonomy All Organisms → Viruses → Predicted Viral

Most Common Ecosystem
GOLD Ecosystem Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine
(30.769 % of family members)
Environment Ontology (ENVO) Unclassified
(82.051 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Saline → Water (saline)
(87.179 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 45.00%    β-sheet: 0.00%    Coil/Unstructured: 55.00%
Feature Viewer
Powered by Feature Viewer

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 117 Family Scaffolds
PF05766NinG 56.41
PF00145DNA_methylase 11.11
PF01844HNH 6.84
PF08299Bac_DnaA_C 2.56
PF14090HTH_39 1.71
PF02954HTH_8 1.71
PF08291Peptidase_M15_3 0.85
PF05135Phage_connect_1 0.85
PF11367DUF3168 0.85

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 117 Family Scaffolds
COG0270DNA-cytosine methylaseReplication, recombination and repair [L] 11.11
COG0593Chromosomal replication initiation ATPase DnaAReplication, recombination and repair [L] 2.56

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms64.96 %
UnclassifiedrootN/A35.04 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300000115|DelMOSum2011_c10022735All Organisms → Viruses → Predicted Viral2930Open in IMG/M
3300000116|DelMOSpr2010_c10043870All Organisms → Viruses → Predicted Viral1998Open in IMG/M
3300002483|JGI25132J35274_1009500All Organisms → Viruses → Predicted Viral2400Open in IMG/M
3300002483|JGI25132J35274_1022499All Organisms → Viruses → Predicted Viral1478Open in IMG/M
3300002483|JGI25132J35274_1107719All Organisms → Viruses563Open in IMG/M
3300002930|Water_102107All Organisms → Viruses → Predicted Viral3516Open in IMG/M
3300005433|Ga0066830_10112141Not Available583Open in IMG/M
3300005590|Ga0070727_10073303All Organisms → Viruses → Predicted Viral2001Open in IMG/M
3300005600|Ga0070726_10146682Not Available1219Open in IMG/M
3300006029|Ga0075466_1008440All Organisms → Viruses → Predicted Viral3569Open in IMG/M
3300006029|Ga0075466_1008633All Organisms → Viruses → Predicted Viral3527Open in IMG/M
3300006029|Ga0075466_1071558All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Mediterranean phage uvDeep-CGR2-KM19-C269980Open in IMG/M
3300006467|Ga0099972_10668315Not Available1442Open in IMG/M
3300006467|Ga0099972_12059342Not Available745Open in IMG/M
3300006735|Ga0098038_1228126Not Available594Open in IMG/M
3300006750|Ga0098058_1027471All Organisms → Viruses → Predicted Viral1655Open in IMG/M
3300006752|Ga0098048_1048439All Organisms → Viruses → Predicted Viral1340Open in IMG/M
3300006752|Ga0098048_1066207All Organisms → Viruses1118Open in IMG/M
3300006752|Ga0098048_1153631All Organisms → cellular organisms → Bacteria686Open in IMG/M
3300006752|Ga0098048_1201357All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Mediterranean phage uvDeep-CGR2-KM19-C269587Open in IMG/M
3300006793|Ga0098055_1098044Not Available1146Open in IMG/M
3300006793|Ga0098055_1226563Not Available706Open in IMG/M
3300006802|Ga0070749_10141618All Organisms → Viruses1403Open in IMG/M
3300006802|Ga0070749_10200604All Organisms → Viruses → Predicted Viral1143Open in IMG/M
3300006802|Ga0070749_10283473Not Available932Open in IMG/M
3300006810|Ga0070754_10088895All Organisms → Viruses → Predicted Viral1544Open in IMG/M
3300006868|Ga0075481_10295113All Organisms → Viruses566Open in IMG/M
3300006874|Ga0075475_10038177All Organisms → Viruses → Predicted Viral2301Open in IMG/M
3300006916|Ga0070750_10111161All Organisms → Viruses → Predicted Viral1263Open in IMG/M
3300006916|Ga0070750_10181681All Organisms → cellular organisms → Bacteria939Open in IMG/M
3300006916|Ga0070750_10208470Not Available862Open in IMG/M
3300006919|Ga0070746_10031839All Organisms → Viruses → Predicted Viral2834Open in IMG/M
3300006920|Ga0070748_1179248All Organisms → Viruses780Open in IMG/M
3300006922|Ga0098045_1024213All Organisms → Viruses → Predicted Viral1601Open in IMG/M
3300006922|Ga0098045_1038345Not Available1215Open in IMG/M
3300006922|Ga0098045_1082624All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria767Open in IMG/M
3300006922|Ga0098045_1161462Not Available512Open in IMG/M
3300006923|Ga0098053_1106669Not Available564Open in IMG/M
3300006990|Ga0098046_1027815Not Available1395Open in IMG/M
3300006990|Ga0098046_1120265Not Available575Open in IMG/M
3300007640|Ga0070751_1177839Not Available837Open in IMG/M
3300009435|Ga0115546_1349915All Organisms → Viruses503Open in IMG/M
3300009529|Ga0114919_10750735All Organisms → Viruses663Open in IMG/M
3300010297|Ga0129345_1098761All Organisms → Viruses → Predicted Viral1083Open in IMG/M
3300017706|Ga0181377_1001289All Organisms → cellular organisms → Bacteria8159Open in IMG/M
3300017710|Ga0181403_1081895Not Available671Open in IMG/M
3300017725|Ga0181398_1080548All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Poribacteria → unclassified Candidatus Poribacteria → Candidatus Poribacteria bacterium780Open in IMG/M
3300017726|Ga0181381_1001491All Organisms → cellular organisms → Bacteria6612Open in IMG/M
3300017728|Ga0181419_1015771All Organisms → Viruses → Predicted Viral2160Open in IMG/M
3300017728|Ga0181419_1016328All Organisms → Viruses → Predicted Viral2117Open in IMG/M
3300017741|Ga0181421_1074622Not Available890Open in IMG/M
3300017741|Ga0181421_1074624Not Available890Open in IMG/M
3300017742|Ga0181399_1018657All Organisms → Viruses → Predicted Viral1955Open in IMG/M
3300017755|Ga0181411_1000365All Organisms → cellular organisms → Bacteria16218Open in IMG/M
3300017756|Ga0181382_1084105Not Available876Open in IMG/M
3300017760|Ga0181408_1205222Not Available500Open in IMG/M
3300017762|Ga0181422_1068843All Organisms → Viruses → Predicted Viral1122Open in IMG/M
3300017765|Ga0181413_1122684Not Available788Open in IMG/M
3300017779|Ga0181395_1008671All Organisms → Viruses → Predicted Viral3645Open in IMG/M
3300017779|Ga0181395_1053309Not Available1331Open in IMG/M
3300017781|Ga0181423_1004522Not Available6237Open in IMG/M
3300017781|Ga0181423_1039644All Organisms → Viruses → Predicted Viral1899Open in IMG/M
3300017782|Ga0181380_1020016All Organisms → Viruses → Predicted Viral2500Open in IMG/M
3300017786|Ga0181424_10007888All Organisms → Viruses → Predicted Viral4602Open in IMG/M
3300018416|Ga0181553_10182598All Organisms → Viruses → Predicted Viral1225Open in IMG/M
3300020352|Ga0211505_1066565Not Available872Open in IMG/M
3300021373|Ga0213865_10012700All Organisms → Viruses → Predicted Viral4820Open in IMG/M
3300021389|Ga0213868_10598360Not Available577Open in IMG/M
3300021957|Ga0222717_10030913All Organisms → Viruses → Predicted Viral3543Open in IMG/M
3300021958|Ga0222718_10008096Not Available8126Open in IMG/M
3300021960|Ga0222715_10061990All Organisms → Viruses → Predicted Viral2532Open in IMG/M
3300021964|Ga0222719_10464428Not Available770Open in IMG/M
3300022065|Ga0212024_1073026Not Available609Open in IMG/M
3300022067|Ga0196895_1002059All Organisms → Viruses2090Open in IMG/M
3300022068|Ga0212021_1019601All Organisms → Viruses → Predicted Viral1252Open in IMG/M
3300022069|Ga0212026_1051966Not Available618Open in IMG/M
3300022071|Ga0212028_1003348Not Available2091Open in IMG/M
3300022072|Ga0196889_1004682All Organisms → Viruses → Predicted Viral3226Open in IMG/M
3300022072|Ga0196889_1043447All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Mediterranean phage uvDeep-CGR2-KM19-C269884Open in IMG/M
3300022925|Ga0255773_10057163All Organisms → Viruses → Predicted Viral2278Open in IMG/M
(restricted) 3300024059|Ga0255040_10000057All Organisms → cellular organisms → Bacteria22054Open in IMG/M
3300024433|Ga0209986_10036702All Organisms → Viruses → Predicted Viral3054Open in IMG/M
3300025070|Ga0208667_1005721All Organisms → Viruses → Predicted Viral3308Open in IMG/M
3300025070|Ga0208667_1005824All Organisms → Viruses → Predicted Viral3267Open in IMG/M
3300025070|Ga0208667_1009202All Organisms → Viruses → Predicted Viral2346Open in IMG/M
3300025070|Ga0208667_1016461All Organisms → Viruses → Predicted Viral1524Open in IMG/M
3300025070|Ga0208667_1045505All Organisms → cellular organisms → Bacteria726Open in IMG/M
3300025084|Ga0208298_1012519All Organisms → Viruses → Predicted Viral2038Open in IMG/M
3300025084|Ga0208298_1013541Not Available1934Open in IMG/M
3300025084|Ga0208298_1061250All Organisms → cellular organisms → Bacteria721Open in IMG/M
3300025084|Ga0208298_1092139Not Available555Open in IMG/M
3300025086|Ga0208157_1023642All Organisms → Viruses → Predicted Viral1837Open in IMG/M
3300025108|Ga0208793_1101222All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes808Open in IMG/M
3300025132|Ga0209232_1030424All Organisms → Viruses → Predicted Viral2069Open in IMG/M
3300025151|Ga0209645_1014631All Organisms → cellular organisms → Bacteria3077Open in IMG/M
3300025151|Ga0209645_1025092All Organisms → Viruses → Predicted Viral2237Open in IMG/M
3300025151|Ga0209645_1133080Not Available779Open in IMG/M
3300025543|Ga0208303_1025747All Organisms → Viruses → Predicted Viral1617Open in IMG/M
3300025645|Ga0208643_1030309Not Available1796Open in IMG/M
3300025645|Ga0208643_1092151Not Available844Open in IMG/M
3300025671|Ga0208898_1037389All Organisms → Viruses → Predicted Viral1901Open in IMG/M
3300025759|Ga0208899_1014428All Organisms → Viruses → Predicted Viral4202Open in IMG/M
3300025759|Ga0208899_1028047Not Available2681Open in IMG/M
3300025759|Ga0208899_1030025All Organisms → Viruses → Predicted Viral2559Open in IMG/M
3300025759|Ga0208899_1113393All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Mediterranean phage uvDeep-CGR2-KM19-C269987Open in IMG/M
3300025810|Ga0208543_1014854All Organisms → Viruses → Predicted Viral1985Open in IMG/M
3300025853|Ga0208645_1101965All Organisms → Viruses → Predicted Viral1186Open in IMG/M
3300026136|Ga0208763_1009141All Organisms → Viruses → Predicted Viral1576Open in IMG/M
3300027790|Ga0209273_10114178All Organisms → Viruses → Predicted Viral1183Open in IMG/M
3300027845|Ga0209271_10007947All Organisms → Viruses → Predicted Viral4112Open in IMG/M
3300028920|Ga0272441_11079117Not Available607Open in IMG/M
3300029309|Ga0183683_1016820All Organisms → Viruses → Predicted Viral1607Open in IMG/M
3300032277|Ga0316202_10403741Not Available639Open in IMG/M
3300032373|Ga0316204_10623353Not Available789Open in IMG/M
3300032373|Ga0316204_10973035Not Available600Open in IMG/M
3300034374|Ga0348335_060798All Organisms → cellular organisms → Bacteria1385Open in IMG/M
3300034374|Ga0348335_111567Not Available832Open in IMG/M

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
MarineEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Marine30.77%
AqueousEnvironmental → Aquatic → Marine → Coastal → Unclassified → Aqueous29.06%
SeawaterEnvironmental → Aquatic → Marine → Strait → Unclassified → Seawater17.09%
Marine SedimentEnvironmental → Aquatic → Marine → Coastal → Sediment → Marine Sediment3.42%
Estuarine WaterEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water3.42%
Microbial MatEnvironmental → Aquatic → Marine → Coastal → Sediment → Microbial Mat2.56%
Deep SubsurfaceEnvironmental → Aquatic → Marine → Oceanic → Sediment → Deep Subsurface1.71%
MarineEnvironmental → Aquatic → Marine → Coastal → Sediment → Marine1.71%
SeawaterEnvironmental → Aquatic → Marine → Coastal → Unclassified → Seawater1.71%
Salt MarshEnvironmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh1.71%
MarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Marine1.71%
MarineEnvironmental → Aquatic → Marine → Neritic Zone → Unclassified → Marine1.71%
Freshwater To Marine Saline GradientEnvironmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient0.85%
Estuary WaterEnvironmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuary Water0.85%
Marine SedimentEnvironmental → Aquatic → Marine → Wetlands → Sediment → Marine Sediment0.85%
Pelagic MarineEnvironmental → Aquatic → Marine → Pelagic → Unclassified → Pelagic Marine0.85%

Visualization
Powered by ApexCharts



Associated Samples

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Taxon OIDSample NameHabitat TypeIMG/M Link
3300000115Marine microbial communities from Delaware Coast, sample from Delaware MO Summer July 2011EnvironmentalOpen in IMG/M
3300000116Marine microbial communities from Delaware Coast, sample from Delaware MO Spring March 2010EnvironmentalOpen in IMG/M
3300002483Marine viral communities from the Pacific Ocean - ETNP_6_30EnvironmentalOpen in IMG/M
3300002930Estuary water microbial communities from Pearl Estuary, Zhujiang, ChinaEnvironmentalOpen in IMG/M
3300005433Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201306PF45BEnvironmentalOpen in IMG/M
3300005590Marine sediment microbial communities from the Atlantic coast under amendment with organic carbon and nitrate - tdAd47.2EnvironmentalOpen in IMG/M
3300005600Marine sediment microbial communities from the Atlantic coast under amendment with organic carbon and nitrate - tdAd47.1EnvironmentalOpen in IMG/M
3300006029Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_20_<0.8_DNAEnvironmentalOpen in IMG/M
3300006467Coastal sediment microbial communities from Rhode Island, USA: Combined Assembly of Gp0121717, Gp0123912, Gp0123935EnvironmentalOpen in IMG/M
3300006735Marine viral communities from the Subarctic Pacific Ocean - 5B_ETSP_OMZ_AT15132_CsCl metaGEnvironmentalOpen in IMG/M
3300006750Marine viral communities from the Subarctic Pacific Ocean - 19_ETSP_OMZ_AT15317 metaGEnvironmentalOpen in IMG/M
3300006752Marine viral communities from the Subarctic Pacific Ocean - 13_ETSP_OMZ_AT15268 metaGEnvironmentalOpen in IMG/M
3300006793Marine viral communities from the Subarctic Pacific Ocean - 17_ETSP_OMZ_AT15314 metaGEnvironmentalOpen in IMG/M
3300006802Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18EnvironmentalOpen in IMG/M
3300006810Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Sep_01EnvironmentalOpen in IMG/M
3300006868Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_N_>0.8_DNAEnvironmentalOpen in IMG/M
3300006874Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_D_>0.8_DNAEnvironmentalOpen in IMG/M
3300006916Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_24EnvironmentalOpen in IMG/M
3300006919Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_21EnvironmentalOpen in IMG/M
3300006920Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_12EnvironmentalOpen in IMG/M
3300006922Marine viral communities from the Subarctic Pacific Ocean - 11_ETSP_OMZ_AT15265 metaGEnvironmentalOpen in IMG/M
3300006923Marine viral communities from the Subarctic Pacific Ocean - 15B_ETSP_OMZ_AT15312_CsCl metaGEnvironmentalOpen in IMG/M
3300006990Marine viral communities from the Subarctic Pacific Ocean - 11B_ETSP_OMZ_AT15265_CsCl metaGEnvironmentalOpen in IMG/M
3300007640Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_28EnvironmentalOpen in IMG/M
3300009435Pelagic marine microbial communities from North Sea - COGITO_mtgs_100413EnvironmentalOpen in IMG/M
3300009529Deep subsurface microbial communities from Black Sea to uncover new lineages of life (NeLLi) - Black_00105 metaGEnvironmentalOpen in IMG/M
3300010297Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_20_0.8_DNAEnvironmentalOpen in IMG/M
3300017706Marine viral communities from the Subarctic Pacific Ocean - Lowphox_13 viral metaGEnvironmentalOpen in IMG/M
3300017710Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 26 SPOT_SRF_2011-09-28EnvironmentalOpen in IMG/M
3300017725Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 21 SPOT_SRF_2011-04-29EnvironmentalOpen in IMG/M
3300017726Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 4 SPOT_SRF_2009-09-24EnvironmentalOpen in IMG/M
3300017728Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 42 SPOT_SRF_2013-04-24EnvironmentalOpen in IMG/M
3300017741Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 44 SPOT_SRF_2013-06-19EnvironmentalOpen in IMG/M
3300017742Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 22 SPOT_SRF_2011-05-21EnvironmentalOpen in IMG/M
3300017755Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 34 SPOT_SRF_2012-07-09EnvironmentalOpen in IMG/M
3300017756Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 5 SPOT_SRF_2009-10-22EnvironmentalOpen in IMG/M
3300017760Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 31 SPOT_SRF_2012-02-16EnvironmentalOpen in IMG/M
3300017762Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 45 SPOT_SRF_2013-07-18EnvironmentalOpen in IMG/M
3300017765Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 36 SPOT_SRF_2012-09-28EnvironmentalOpen in IMG/M
3300017779Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 18 SPOT_SRF_2010-12-16EnvironmentalOpen in IMG/M
3300017781Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 46 SPOT_SRF_2013-08-14EnvironmentalOpen in IMG/M
3300017782Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 3 SPOT_SRF_2009-08-19EnvironmentalOpen in IMG/M
3300017786Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 47 SPOT_SRF_2013-09-18EnvironmentalOpen in IMG/M
3300018416Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011502XT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300020352Marine microbial communities from Tara Oceans - TARA_B100000497 (ERX556084-ERR599144)EnvironmentalOpen in IMG/M
3300021373Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO282EnvironmentalOpen in IMG/M
3300021389Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO127EnvironmentalOpen in IMG/M
3300021957Estuarine water microbial communities from San Francisco Bay, California, United States - C33_18DEnvironmentalOpen in IMG/M
3300021958Estuarine water microbial communities from San Francisco Bay, California, United States - C33_27DEnvironmentalOpen in IMG/M
3300021960Estuarine water microbial communities from San Francisco Bay, California, United States - C33_9DEnvironmentalOpen in IMG/M
3300021964Estuarine water microbial communities from San Francisco Bay, California, United States - C33_34DEnvironmentalOpen in IMG/M
3300022065Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_24 (v2)EnvironmentalOpen in IMG/M
3300022067Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_30 (v3)EnvironmentalOpen in IMG/M
3300022068Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_21 (v2)EnvironmentalOpen in IMG/M
3300022069Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_30 (v2)EnvironmentalOpen in IMG/M
3300022071Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Sep_01 (v2)EnvironmentalOpen in IMG/M
3300022072Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_12 (v3)EnvironmentalOpen in IMG/M
3300022925Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011502XT metaGEnvironmentalOpen in IMG/M
3300024059 (restricted)Seawater microbial communities from Strait of Georgia, British Columbia, Canada - BC1_12_2EnvironmentalOpen in IMG/M
3300024433Deep subsurface microbial communities from Black Sea to uncover new lineages of life (NeLLi) - Black_00105 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025070Marine viral communities from the Subarctic Pacific Ocean - 11B_ETSP_OMZ_AT15265_CsCl metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025084Marine viral communities from the Subarctic Pacific Ocean - 14B_ETSP_OMZ_AT15311_CsCl metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025086Marine viral communities from the Subarctic Pacific Ocean - 5_ETSP_OMZ_AT15132 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025108Marine viral communities from the Subarctic Pacific Ocean - 17_ETSP_OMZ_AT15314 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025132Marine viral communities from the Pacific Ocean - ETNP_2_60 (SPAdes)EnvironmentalOpen in IMG/M
3300025151Marine viral communities from the Pacific Ocean - ETNP_6_30 (SPAdes)EnvironmentalOpen in IMG/M
3300025543Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_2 Viral MetaG (SPAdes)EnvironmentalOpen in IMG/M
3300025645Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_12 (SPAdes)EnvironmentalOpen in IMG/M
3300025671Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_4 (SPAdes)EnvironmentalOpen in IMG/M
3300025759Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_24 (SPAdes)EnvironmentalOpen in IMG/M
3300025810Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_30_>0.8_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300025853Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Sep_01 (SPAdes)EnvironmentalOpen in IMG/M
3300026136Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201306PF45B (SPAdes)EnvironmentalOpen in IMG/M
3300027790Marine sediment microbial communities from the Atlantic coast under amendment with organic carbon and nitrate - tdAd47.1 (SPAdes)EnvironmentalOpen in IMG/M
3300027845Marine sediment microbial communities from the Atlantic coast under amendment with organic carbon and nitrate - tdAd00.2 (SPAdes)EnvironmentalOpen in IMG/M
3300028920Marine sediment archaeal communities from Little Sippewissett salt marsh, Falmouth, MA, United States - SSM-Prop-6NEnvironmentalOpen in IMG/M
3300029309Marine viral communities collected during Tara Oceans survey from station TARA_100 - TARA_R100001440EnvironmentalOpen in IMG/M
3300032277Microbial mat bacterial communities from mineral coupon in-situ incubated in ocean water Damariscotta River, Maine, United States - 3-month pyrrhotiteEnvironmentalOpen in IMG/M
3300032373Microbial mat bacterial communities from mineral coupon in-situ incubated in ocean water Damariscotta River, Maine, United States - 6-month pyrrhotite 2EnvironmentalOpen in IMG/M
3300034374Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_31 (v4)EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Protein ID Sample Taxon ID Habitat Sequence
DelMOSum2011_1002273583300000115MarineMKKQSKGINKRLESWINNRLFKTLNPKDWEIESILYIYNNEKDSNIRGRSEQSKHSSRRNS*
DelMOSpr2010_1004387063300000116MarineMKKQSKGINKRLESWINNRLFKTLNPKDWEIEYILYIYNNEKDSNIRGRSEQSKHSSRRNS*
JGI25132J35274_100950043300002483MarineMKKQSKGINKRLESWINNRLFKTLDPKDWEIESILYIYNNEENSNIRGRSEQGKHSSRRNS*
JGI25132J35274_102249913300002483MarineMKKQSKGISKRLESWINNRLFKTLDQDDWIIESILYIYNNEKDSNIRGRSEQGKHSSRRNSKY*
JGI25132J35274_110771923300002483MarineMKKQSKGINKRLESWINNRLFKTLNLKDWEIESILYIYNNEKDSNIRGRSEQSKHSSRRNS*
Water_10210793300002930Estuary WaterMKKQSNDTNKRLMSWINNRLFKTLNPKDWEIESILYIYNNEKDSNIRGRSEQGKHSSRRNS*
Ga0066830_1011214113300005433MarineMKKQSKGISKKLESWINNRLFKTLNSEDWIIESILYIYKDEENSNIRGRSEQGKHSSRRNS*
Ga0070727_1007330323300005590Marine SedimentMKKQSKGISKRLESWINNRLFKTLDPKDWEIESILYIYNNEENSNIRGRSEQSKHSSRRNS*
Ga0070726_1014668243300005600Marine SedimentMKKQSKGISKRLESWINNRLFKTLNPKDWEIESILYIYNNEKDSNIRGRSEQGKHSSRRNS*
Ga0075466_100844093300006029AqueousMKKQSKGISKRLESWINNRLFKTLDPKDWEIESILYIYNNEENSNIRGRSEQSKHFSRRNS*
Ga0075466_100863383300006029AqueousMKKQSKGISKRLESWINNRLFKTLDSKDWEIESILYIYNNEENSNIRGRSEQSKHSSRRNS*
Ga0075466_107155833300006029AqueousMRKQSKGINKKLESWINNRLFKTLDPKDWEIESILYIYNNEENSNIRGRSEQSKHSSRRNS*
Ga0099972_1066831553300006467MarineMKKQSKGINKRLESWINNRLFKTLKPRDWEIESILYIYNNEENSNIRGRSEQSKHSSRRNS*
Ga0099972_1205934233300006467MarineMKKQSKGISKRLESWINNRLFKTLDPKDWEIESILYIYNNEKDSNIRGRSE
Ga0098038_122812623300006735MarineMKKQSKAINKRLESWVNNRLFKTLNPKDWEIESILYIYKDEENSYIRGRSEQGKHSSRRNS*
Ga0098058_102747123300006750MarineMNERLQSWINNRLFKTLNPKDWEIESILYIYNNEKDSNIRGRSEQGKHSSRRNS*
Ga0098048_104843943300006752MarineMKKQSNDTNKRLMSWINNRLFKTLNPKDWEIESILYIYNNEKDSNIRGRSEQG
Ga0098048_106620733300006752MarineMNERLQSWINNRLFKTLNPKDWEIESILYIYNNEKDSNIRGRSEQG
Ga0098048_115363113300006752MarineMKKQSKGISKRLENWINNRLFKTLNPKDWEIESILYIYNNEKDSNIRGR
Ga0098048_120135723300006752MarineMKKQSNDTNKRLMSWINNRLFKTLNPKDWEIESILYIYNNEENSNIRGRSEQGKHSSRRNS*
Ga0098055_109804413300006793MarineIMKKQSKGINKRLESWINNRLFKTLNSEDWIIESILYIYKDEENSNIRGRSEQSKHSSRRNS*
Ga0098055_122656313300006793MarineMKKQSKGISKRLENWINNRLFKTLNPKDWEIESILYIYNNEKDSNIRGRSEQ
Ga0070749_1014161833300006802AqueousMNERLMSWINNRLFKTLNPKDWEIESILYIYKDEENSNIRGRSEQSKHSSRRNS*
Ga0070749_1020060423300006802AqueousMKKQSKGISKRLESWINNRLFKTLDSKDWEIESILYIYNNEENSNIRGRSEQGKHSSRRNS*
Ga0070749_1028347333300006802AqueousMKKQSKIINKRLESWINNRLFKTLDPKDWEIESILYIYNNEENSNIRGR
Ga0070754_1008889543300006810AqueousMKKQSKGINKRLESWINNRLFKTLNSEDWIIESILYIYKDEENSNIRGRSEQSKHSSRRNS*
Ga0075481_1029511323300006868AqueousMNERLMSWINNRLFKTLNPKDWEIESILYIYNNEKDSNIRGRSEQGKHSSRRNS*
Ga0075475_1003817783300006874AqueousMKKQSKGISKRLESWINNRLFKTLNPKDWEIESILYIYNNEKDSNIRGRSEQGKHSSRR
Ga0070750_1011116123300006916AqueousMRKQSKGINKKLESWINNRLFKTLDPKDWEIESILYIYNNEENSNIRGRGEQGKHSSRRNS*
Ga0070750_1018168133300006916AqueousMNKKLKSWINNRLFKTLDPKDWEIESILYIYNNEENSNIRGRSEQSKHSSRRNS*
Ga0070750_1020847013300006916AqueousMKKQSNDTNKRLMSWINNRLFKTLNPKDWEIESILYIYNNEKDSNIRGRS
Ga0070746_1003183973300006919AqueousMKKQSKGISKRLKSWINNRLFKTLDPKDWEIESILYIYNNEKDSNIRGRSEQSKHSSRRNS*
Ga0070748_117924823300006920AqueousMKKQLNDTNKRLESWINNRLFKTLDPKNWEIESILYIYNNEKDSNIRGRSEQSKHSSRRNS*
Ga0098045_102421333300006922MarineMKKQSKGISKRLENWINNRLFKTLNPKDWEIESILYIYNNEKDSNIRGRSEQGKHSSRRN
Ga0098045_103834513300006922MarineMKKQSNAISKRLESWINNRLFKTLDPKDWEIESILYIYNNEENSNIRGRSEQSKHSSRRNS*
Ga0098045_108262413300006922MarineMNKKLKSWINNRLFKTLDPKDWEIESILYIYNNEKDSNIRGRSEQGKHSSRRNS
Ga0098045_116146223300006922MarineIMKKQSKGISKRLESWINNRLFKTLDQDDWIIESILYIYNNEENSNIRGRSEQSKHSSRRNS*
Ga0098053_110666923300006923MarineMKKQSNDTNKRLESWINNRLFKTLNPKDWEIESILYIYNNEKDSNIRGRSEQSKHSSRRNSEH*
Ga0098046_102781523300006990MarineMKKQSKGISKRLESWINNRLFKTLNSKDWEIESILYIYNNEENSNIRGRSEQGKHSSRRNS*
Ga0098046_112026523300006990MarineLMNKKLKSWINNRLFKTLDPKDWEIESILYIYNNEENSNIRGRSEQGKHSSRRNS*
Ga0070751_117783933300007640AqueousMKKQSKGISKRLESWINNRLFKTLNPKDWEIESILYIYNNEKDSNIRGRSEQ
Ga0115546_134991513300009435Pelagic MarineMNKKLESWINNRLFKTLNSKDWEIESILYIYNNEKDSNIRGRSEQSKHSSRRNS
Ga0114919_1075073533300009529Deep SubsurfaceMNKKLESWINNRLFKTLDPKDWEIESILYIYNNEKDSNIRGRSEQGKHSSRRN
Ga0129345_109876133300010297Freshwater To Marine Saline GradientMNKRLQSWINNRLFKTLNPKDWEIESILYIYNNEKNSNIRGRSEQSKHSSRR
Ga0181377_1001289163300017706MarineMKKQSKVISKRLESWINNRLFKTLHKEEWEIETILYIYNNEKDGNIRGRSEQSKHSSRRNSEH
Ga0181403_108189533300017710SeawaterMKKQSNAISKRLESWINNRLFKTLNPKDWEIESILYIYNNEENSNIRGR
Ga0181398_108054813300017725SeawaterMKKQSKGINKRLESWINNRLFKTLHKEEWEIEKILYIYNNEKDGNIRGRSQQSKYSP
Ga0181381_100149133300017726SeawaterMKKQSKGISKRLESWINNRLFKTLNSEDWIIESILYIYKDEKNSNIRGRSEQGKHSSRRN
Ga0181419_101577153300017728SeawaterMKKQSKVISKRLESWINNRLFKTLHKEEWEIETILYIYKNEKDGNIRGRSEQSKHSSRRN
Ga0181419_101632853300017728SeawaterMKKQSKAINKRLESWINNRLFKTLHKEEWEIEKILYIYNNEKDGNIRGRSEQSKHSSRRNSEH
Ga0181421_107462233300017741SeawaterMKKQSKGINKRLESWINNRLFKTLKPKDWEIESILYIYNNEKDSNIRGRSKQGKHSSRRN
Ga0181421_107462433300017741SeawaterMKKQSKGISKRLESWINNRLFKTLNPKDWEIESILYIYNNEKDSNIRGRSKQGKHSSRRN
Ga0181399_101865793300017742SeawaterINKRLESWINNRLFKTLHKEDWEIEEILYIYNNEKNSNIRGRSEQSKHSSRRNSEH
Ga0181411_100036583300017755SeawaterMKKQSKGINKRLESWINNRLFKTLNPKDWEIESILYIYNNEKDSNIRGRSEQGKHSSRRNSKY
Ga0181382_108410533300017756SeawaterMKKQSKGISKRLESWINNRLFKTLDPKDWEIESILYIYNNEKDSNIRRRS
Ga0181408_120522223300017760SeawaterMKKQSNATSKRLESWINNRLFKTLNPKDWEIESILYIYNNEENSNIRGRSEQGKHSSRRNSKY
Ga0181422_106884323300017762SeawaterMKKQSNDTNKRLMSWINNRLFKTLDPKDWEIESILYIYNNEKDSNIRGRSEQSKHSSRRN
Ga0181413_112268433300017765SeawaterMKKQSKGISKRLENWINNRLFKTLNPKDWEIESILYIYNNEKDSNIRGRSEQGKHSSRRNSKY
Ga0181395_100867123300017779SeawaterMNKKLKSWINNRLFKTLNSEDWIIESILYIYNNEKDSNIRGRSEQSKHSSRRNS
Ga0181395_105330953300017779SeawaterMKRQSNAISKRLESWINNRLFKTLNKEDWEIESILYIYNNEKDGNIRGRSK
Ga0181423_1004522103300017781SeawaterMKKQSKGISKRLESWINNRLFKTLDPKDWEIESILYIYNNEKNSNIRGRSEQGKHSSRRN
Ga0181423_103964413300017781SeawaterMKKQSNDTNKRLMSWINNRLFKTLDPKDWEIESILYIYNNEKDSNIRG
Ga0181380_102001653300017782SeawaterMKMQSNAINKRLESWINNRLFKTLNKEDWEIESILYIYNNEKDGNIRGRSEQSKHSSRRNSEH
Ga0181424_10007888103300017786SeawaterMKKQSKGISKRLESWINNRLFKTLDPKDWEIESILYIYNNEKDSNIRG
Ga0181553_1018259853300018416Salt MarshMKKQSKGISKRLESWINNRLFKTLDPKDWEIESILYIYNNEENSNIRGRSEQGKHSSRRN
Ga0211505_106656543300020352MarineMKKQSKGISKKLESWINNRLFKTLNKDEWEIESILYIYNNEKDSNIRGRSEQGKHFSRRNSEH
Ga0213865_1001270093300021373SeawaterMRKQSKGINKKLESWINNRLFKTLDPKDWEIESILYIYNNEENSNIRGRSEQSKHSSRRN
Ga0213868_1059836023300021389SeawaterMKQTASAKLLNWINNRLFKTLNPKDWEIESILYIYNNEKNSNIRGRSEQGKHSSRR
Ga0222717_1003091373300021957Estuarine WaterMKKQSKGISKRLESWINNRLFKTLNPKDWEIESILYIYNNEKDSNIRGRSEQGKHSSRRN
Ga0222718_10008096183300021958Estuarine WaterMKKQSKGINKRLESWINNRLFKTLNPKDWEIESILYIYNNEENSNIRGRSEQGKHSSRRN
Ga0222715_1006199063300021960Estuarine WaterMKKQSKGISKRLESWINNRLFKTLDPKDWEIESILYIYNNEKDSNIRGRSKQSKHSSRRN
Ga0222719_1046442813300021964Estuarine WaterSKRLESWINNRLFKTLDPKDWEIESILYIYNNEKDSNIRGRSEQGKHSSRRNS
Ga0212024_107302633300022065AqueousMKKQSKGISKRLESWINNRLFKTLDSKDWEIESILYIYNNEENSNIRGRSEQGKHSSRRN
Ga0196895_100205963300022067AqueousMNERLMSWINNRLFKTLNPKDWEIESILYIYKDEENSNIRGRSEQSKHSSRRNS
Ga0212021_101960113300022068AqueousMKKQSKGISKRLESWINNRLFKTLDSKDWEIESILYIYNNEENSNIRGRSEQSKHSSRRN
Ga0212026_105196613300022069AqueousEIMKKQSKGINKRLMSWINNRLFKTLNPKDWEIESILYIYNNEKDSNIRGRSEQSKHSSRRNS
Ga0212028_100334823300022071AqueousMKKQSKGINKRLMSWINNRLFKTLNPKDWEIESILYIYNNEKDSNIRGRSEQGKHSSRRN
Ga0196889_100468233300022072AqueousMKKQSKGISKRLESWINNRLFKTLDPKDWEIESILYIYNNEENSNIRGRSEQSKHFSRRN
Ga0196889_104344723300022072AqueousMKKQLNDTNKRLESWINNRLFKTLDPKNWEIESILYIYNNEKDSNIRGRSEQSKHSSRRN
Ga0255773_1005716393300022925Salt MarshMKKQSKGISKRLESWINNQLFKTLDPKDWEIESILYIYNNEENSNIRGRSEQGKHSSRRN
(restricted) Ga0255040_10000057343300024059SeawaterMKKQSKGISKRLESWINNRLFKTLNPKDWEIESILYIYNNEKDSNIRRRSEQGKHSSRRN
Ga0209986_1003670263300024433Deep SubsurfaceMKKQSEGISKRLESWINNRLFKTLDPKDWEIESILYIYNNEKDSNIRGRSEQGKHSSRRN
Ga0208667_100572173300025070MarineMKKQSKGISKRLESWINNRLFKTLDQDDWIIESILYIYNNEENSNIRGRSEQSKHSSRRN
Ga0208667_100582463300025070MarineMKKQSNDTNKRLMSWINNRLFKTLNPKDWEIESILYIYNNEENSNIRGRSEQGKHSSRRN
Ga0208667_100920273300025070MarineMKKQSKGINKRLESWINNRLFKTLNSEDWIIESILYIYKDEENSNIRGRSEQSKHSSRRN
Ga0208667_101646113300025070MarineMNERLQSWINNRLFKTLNPKDWEIESILYIYNNEKDSNIRGRSEQGK
Ga0208667_104550533300025070MarineMKKQSKGINKRLESWINNRLFKTLNPKDWEIESILYIYNNEKDSNIRGRSEQGK
Ga0208298_101251913300025084MarineMNERLQSWINNRLFKTLNPKDWEIESILYIYNNEKDSNIRGRSEQGKH
Ga0208298_101354113300025084MarineMKKQSKGISKRLESWINNRLFKTLNPKDWEIESILYIYNNEKDSNIRGR
Ga0208298_106125013300025084MarineMKKQSNDTNKRLMSWINNRLFKTLNPKDWEIESILYIYNNEKDSNIRGRSEQGKH
Ga0208298_109213923300025084MarineMKKQSKGINKRLESWINNRLFKTLDPKDWEIESILYIYNNEKDSNIRGRSEQGKHSSRRN
Ga0208157_102364263300025086MarineMNKKLKSWINNRLFKTLDPKDWEIESILYIYNNEENSNIRGRSEQGKHSSRRNS
Ga0208793_110122213300025108MarineMKKQSKGISKRLESWINNRLFKTLNPKDWEIESILYIYNNEKDSNIRGRSEQGK
Ga0209232_103042463300025132MarineMKKQSKGISKRLESWINNRLFKTLDPKDWEIESILYIYNNEKDSNIRGRSEQSKHSRRRN
Ga0209645_101463183300025151MarineMKKQSKGISKKLESWINNRLFKTLNSEDWIIESILYIYKDEENSNIRGRSEQGKHSSRRN
Ga0209645_102509273300025151MarineMKKQSKGISKRLESWINNRLFKTLDKDDWIIESILYIYNNEENSNIRGRSEQGKHSSRRN
Ga0209645_113308023300025151MarineMKKQSKGISKRLESWINNRLFKTLDQDDWIIESILYIYNNEKDSNIRGRSEQGKHSSRRNSKY
Ga0208303_102574713300025543AqueousMKKQSKIINKRLESWINNRLFKTLDPKDWEIESILYIYNNEENSNIRGRSEQGKHSSRRN
Ga0208643_103030963300025645AqueousMKKQSNDTNKRLMSWINNRLFKTLNPKDWEIESILYIYNNEKDSNIRGR
Ga0208643_109215123300025645AqueousMKKQSKGINKRLESWINNRLFKTLNPKDWEIESILYIYNNEKDSNIRGRSEQGKHSSRRN
Ga0208898_103738943300025671AqueousMNKRLMSWINNRLFKTLNPKDWEIESILYIYNNEENSNIRGRSEQGKHSSRRNS
Ga0208899_101442863300025759AqueousMKKQSKGISKRLKSWINNRLFKTLDPKDWEIESILYIYNNEKDSNIRGRSEQSKHSSRRN
Ga0208899_102804733300025759AqueousMKKQSKGISKRLESWINNRLFKTLNPKDWEIESILYIYNNEKDSNIRGRSEQSKHSSRRN
Ga0208899_103002513300025759AqueousMKKQSKGISKRLESWINNRLFKTLDSKDWEIESILYIYNNEENSNIRGRSEQ
Ga0208899_111339313300025759AqueousMRKQSKGINKKLESWINNRLFKTLDPKDWEIESILYIYNNEENSNIRRRSEQG
Ga0208543_101485413300025810AqueousMKKQSKGISKRLESWINNRLFKTLDPKDWEIESILYIYNNEENSNIRGR
Ga0208645_110196513300025853AqueousMKKQSNDTNKRLMSWINNRLFKTLNPKDWEIESILYIYNNEKDSNIRGRSEQ
Ga0208763_100914113300026136MarineMRKQSKGINKRLESWINNRLFKTLDPKDWEIESILYIYNNEENSNIRGRSEQGKHS
Ga0209273_1011417833300027790Marine SedimentMKKQSNDTNKRLMSWINNRLFKTLNPKDWEIESILYIYNNEKDSNIRGRSEQGKHSSRRN
Ga0209271_1000794783300027845Marine SedimentMKKQSKGINKRLESWINNRLFKTLNPKDWEIESILYIYNNEKDSNIRGRSEQSKHSSRRN
Ga0272441_1107911713300028920Marine SedimentMKKQSKGISKRLESWINNRLFKTLDPKDWEIESILYIYNNEENSNIRGRSEQSKH
Ga0183683_101682033300029309MarineMKKQSKGISKRLESWINNRLFKTLNSEDWEIESILYIYKDEENSNIRGRSEQSKHSSRRN
Ga0316202_1040374123300032277Microbial MatMKKQSNAINKRLESWINNRLFKTLNKEDWEIESILYIYNNEKDGNIRGRSEQSKHSSRRNSEH
Ga0316204_1062335333300032373Microbial MatRLMSWINNRLFKTLNPKDWEIESILYIYNNEKDSNIRGRSEQGKHSSRRNS
Ga0316204_1097303513300032373Microbial MatMNKRLKNWINNRLFKTLNAEEWEIESILYIYNNEKESNIRGRSQQSLDFSRWD
Ga0348335_060798_1223_13843300034374AqueousMKKQSKGINKRLMSWINNRLFKTLNPKDWEIESILYIYNNEKDSNIRGRSEQSK
Ga0348335_111567_11_1963300034374AqueousMKKQSNDTNKRLMSWINNRLFKTLNPKDWEIESILYIYNNEKDSNIRGRSEQSKHSSRRN

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.