NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome Family F077483

Metagenome Family F077483

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F077483
Family Type Metagenome
Number of Sequences 117
Average Sequence Length 43 residues
Representative Sequence RIFNSIMNGRNVRGNMPAFSDKLNEKEVESLVGFVRKFKG
Number of Associated Samples 96
Number of Associated Scaffolds 117

Quality Assessment
Transcriptomic Evidence No
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 0.85 %
% of genes near scaffold ends (potentially truncated) 95.73 %
% of genes from short scaffolds (< 2000 bps) 95.73 %
Associated GOLD sequencing projects 90
AlphaFold2 3D model prediction Yes
3D model pTM-score0.60

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (99.145 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere
(9.402 % of family members)
Environment Ontology (ENVO) Unclassified
(48.718 % of family members)
Earth Microbiome Project Ontology (EMPO) Host-associated → Plant → Plant rhizosphere
(64.103 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 30.88%    β-sheet: 2.94%    Coil/Unstructured: 66.18%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  		pTM-score: 0.60
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 117 Family Scaffolds
PF08240ADH_N 27.35
PF02769AIRS_C 0.85
PF14124DUF4291 0.85


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms99.15 %
UnclassifiedrootN/A0.85 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2162886011|MRS1b_contig_322926All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes840Open in IMG/M
3300000787|JGI11643J11755_11412411All Organisms → cellular organisms → Bacteria → Acidobacteria748Open in IMG/M
3300000789|JGI1027J11758_11044796All Organisms → cellular organisms → Bacteria → Acidobacteria527Open in IMG/M
3300001116|JGI12627J13344_100516All Organisms → cellular organisms → Bacteria → Acidobacteria6914Open in IMG/M
3300001431|F14TB_107935021All Organisms → cellular organisms → Bacteria → Acidobacteria609Open in IMG/M
3300001978|JGI24747J21853_1042311All Organisms → cellular organisms → Bacteria → Acidobacteria542Open in IMG/M
3300002897|JGI24804J43974_1021080All Organisms → cellular organisms → Bacteria → Acidobacteria517Open in IMG/M
3300004156|Ga0062589_102703148All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium516Open in IMG/M
3300004643|Ga0062591_100884061All Organisms → cellular organisms → Bacteria → Acidobacteria836Open in IMG/M
3300005328|Ga0070676_10659575All Organisms → cellular organisms → Bacteria → Acidobacteria760Open in IMG/M
3300005438|Ga0070701_11054632All Organisms → cellular organisms → Bacteria → Acidobacteria570Open in IMG/M
3300005458|Ga0070681_10620266All Organisms → cellular organisms → Bacteria → Acidobacteria996Open in IMG/M
3300005536|Ga0070697_101969624All Organisms → cellular organisms → Bacteria → Acidobacteria523Open in IMG/M
3300005543|Ga0070672_100556645All Organisms → cellular organisms → Bacteria996Open in IMG/M
3300005545|Ga0070695_101522590All Organisms → cellular organisms → Bacteria → Acidobacteria557Open in IMG/M
3300005546|Ga0070696_100990905All Organisms → cellular organisms → Bacteria → Acidobacteria701Open in IMG/M
3300005547|Ga0070693_101159684All Organisms → cellular organisms → Bacteria592Open in IMG/M
3300005556|Ga0066707_10677062All Organisms → cellular organisms → Bacteria → Acidobacteria649Open in IMG/M
3300005563|Ga0068855_100900850All Organisms → cellular organisms → Bacteria934Open in IMG/M
3300005563|Ga0068855_101997308All Organisms → cellular organisms → Bacteria → Acidobacteria586Open in IMG/M
3300005577|Ga0068857_101213322All Organisms → cellular organisms → Bacteria → Acidobacteria731Open in IMG/M
3300005577|Ga0068857_101326748All Organisms → cellular organisms → Bacteria → Acidobacteria699Open in IMG/M
3300005577|Ga0068857_101953634All Organisms → cellular organisms → Bacteria → Acidobacteria575Open in IMG/M
3300005578|Ga0068854_100381409All Organisms → cellular organisms → Bacteria1162Open in IMG/M
3300005578|Ga0068854_101135053All Organisms → cellular organisms → Bacteria → Acidobacteria698Open in IMG/M
3300005615|Ga0070702_101587658All Organisms → cellular organisms → Bacteria → Acidobacteria541Open in IMG/M
3300005618|Ga0068864_102324261All Organisms → cellular organisms → Bacteria → Acidobacteria542Open in IMG/M
3300005719|Ga0068861_102482433All Organisms → cellular organisms → Bacteria → Acidobacteria522Open in IMG/M
3300005840|Ga0068870_10082529All Organisms → cellular organisms → Bacteria → Acidobacteria1780Open in IMG/M
3300005840|Ga0068870_10153445All Organisms → cellular organisms → Bacteria → Acidobacteria1359Open in IMG/M
3300005840|Ga0068870_11123726All Organisms → cellular organisms → Bacteria → Acidobacteria566Open in IMG/M
3300005841|Ga0068863_100169635All Organisms → cellular organisms → Bacteria → Proteobacteria2093Open in IMG/M
3300005841|Ga0068863_100463062All Organisms → cellular organisms → Bacteria → Acidobacteria1245Open in IMG/M
3300005886|Ga0075286_1030528All Organisms → cellular organisms → Bacteria → Acidobacteria710Open in IMG/M
3300006049|Ga0075417_10492653All Organisms → cellular organisms → Bacteria → Acidobacteria615Open in IMG/M
3300006194|Ga0075427_10026017All Organisms → cellular organisms → Bacteria → Acidobacteria946Open in IMG/M
3300006847|Ga0075431_100777630All Organisms → cellular organisms → Bacteria → Acidobacteria932Open in IMG/M
3300006852|Ga0075433_10244564All Organisms → cellular organisms → Bacteria → Acidobacteria1593Open in IMG/M
3300006871|Ga0075434_102348878All Organisms → cellular organisms → Bacteria → Acidobacteria536Open in IMG/M
3300006894|Ga0079215_10000094All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia15279Open in IMG/M
3300006931|Ga0097620_100366065All Organisms → cellular organisms → Bacteria → Acidobacteria1537Open in IMG/M
3300006969|Ga0075419_10139358All Organisms → cellular organisms → Bacteria1580Open in IMG/M
3300009101|Ga0105247_10524563All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes867Open in IMG/M
3300009148|Ga0105243_10572213All Organisms → cellular organisms → Bacteria → Acidobacteria1083Open in IMG/M
3300009162|Ga0075423_11389725Not Available751Open in IMG/M
3300009174|Ga0105241_10937999All Organisms → cellular organisms → Bacteria → Acidobacteria806Open in IMG/M
3300009174|Ga0105241_10974663All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes792Open in IMG/M
3300009174|Ga0105241_11052654All Organisms → cellular organisms → Bacteria → Acidobacteria764Open in IMG/M
3300009545|Ga0105237_11680405All Organisms → cellular organisms → Bacteria → Acidobacteria642Open in IMG/M
3300009789|Ga0126307_11482896All Organisms → cellular organisms → Bacteria → Acidobacteria550Open in IMG/M
3300009840|Ga0126313_10463876All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes1011Open in IMG/M
3300009840|Ga0126313_11854115All Organisms → cellular organisms → Bacteria → Acidobacteria505Open in IMG/M
3300010036|Ga0126305_10984338All Organisms → cellular organisms → Bacteria → Acidobacteria578Open in IMG/M
3300010040|Ga0126308_10854554All Organisms → cellular organisms → Bacteria → Acidobacteria632Open in IMG/M
3300010045|Ga0126311_10005842All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes6574Open in IMG/M
3300010045|Ga0126311_10096615All Organisms → cellular organisms → Bacteria → Acidobacteria2019Open in IMG/M
3300010046|Ga0126384_10946984All Organisms → cellular organisms → Bacteria → Acidobacteria781Open in IMG/M
3300010046|Ga0126384_11907251All Organisms → cellular organisms → Bacteria → Acidobacteria566Open in IMG/M
3300010166|Ga0126306_10986649All Organisms → cellular organisms → Bacteria → Acidobacteria686Open in IMG/M
3300010358|Ga0126370_12606064All Organisms → cellular organisms → Bacteria → Acidobacteria506Open in IMG/M
3300010359|Ga0126376_10823121All Organisms → cellular organisms → Bacteria → Acidobacteria909Open in IMG/M
3300010362|Ga0126377_11557346All Organisms → cellular organisms → Bacteria → Acidobacteria735Open in IMG/M
3300010373|Ga0134128_10945731All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium953Open in IMG/M
3300010375|Ga0105239_12124421All Organisms → cellular organisms → Bacteria → Acidobacteria653Open in IMG/M
3300010397|Ga0134124_13101835All Organisms → cellular organisms → Bacteria → Acidobacteria508Open in IMG/M
3300010399|Ga0134127_11626611All Organisms → cellular organisms → Bacteria → Acidobacteria720Open in IMG/M
3300010399|Ga0134127_13593703All Organisms → cellular organisms → Bacteria → Acidobacteria508Open in IMG/M
3300010400|Ga0134122_11065381All Organisms → cellular organisms → Bacteria → Acidobacteria798Open in IMG/M
3300010403|Ga0134123_10522959All Organisms → cellular organisms → Bacteria → Acidobacteria1122Open in IMG/M
3300010403|Ga0134123_13135572All Organisms → cellular organisms → Bacteria → Acidobacteria531Open in IMG/M
3300010868|Ga0124844_1260692All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium603Open in IMG/M
3300011119|Ga0105246_11643975All Organisms → cellular organisms → Bacteria → Acidobacteria608Open in IMG/M
3300012951|Ga0164300_10347724All Organisms → cellular organisms → Bacteria795Open in IMG/M
3300012961|Ga0164302_11808053All Organisms → cellular organisms → Bacteria → Acidobacteria516Open in IMG/M
3300012977|Ga0134087_10776014All Organisms → cellular organisms → Bacteria → Acidobacteria516Open in IMG/M
3300013100|Ga0157373_10393406All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes993Open in IMG/M
3300013102|Ga0157371_11023765All Organisms → cellular organisms → Bacteria → Acidobacteria631Open in IMG/M
3300013297|Ga0157378_11253319All Organisms → cellular organisms → Bacteria → Acidobacteria782Open in IMG/M
3300013306|Ga0163162_13198825All Organisms → cellular organisms → Bacteria → Acidobacteria525Open in IMG/M
3300013308|Ga0157375_10498439All Organisms → cellular organisms → Bacteria → Acidobacteria1382Open in IMG/M
3300013308|Ga0157375_11346735All Organisms → cellular organisms → Bacteria → Acidobacteria840Open in IMG/M
3300014487|Ga0182000_10486593All Organisms → cellular organisms → Bacteria → Acidobacteria570Open in IMG/M
3300014745|Ga0157377_11182872All Organisms → cellular organisms → Bacteria → Acidobacteria591Open in IMG/M
3300015371|Ga0132258_11196719All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes1921Open in IMG/M
3300015371|Ga0132258_11384402All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes1777Open in IMG/M
3300015372|Ga0132256_101218350All Organisms → cellular organisms → Bacteria → Acidobacteria866Open in IMG/M
3300015373|Ga0132257_101476925All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes867Open in IMG/M
3300015373|Ga0132257_103511644All Organisms → cellular organisms → Bacteria → Acidobacteria570Open in IMG/M
3300018466|Ga0190268_10832008All Organisms → cellular organisms → Bacteria → Acidobacteria705Open in IMG/M
3300018466|Ga0190268_11837483All Organisms → cellular organisms → Bacteria → Acidobacteria548Open in IMG/M
3300018482|Ga0066669_12304738All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium514Open in IMG/M
3300025885|Ga0207653_10348235All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium578Open in IMG/M
3300025899|Ga0207642_10857721All Organisms → cellular organisms → Bacteria → Acidobacteria580Open in IMG/M
3300025908|Ga0207643_10913667All Organisms → cellular organisms → Bacteria → Acidobacteria569Open in IMG/M
3300025911|Ga0207654_10227508All Organisms → cellular organisms → Bacteria → Acidobacteria1240Open in IMG/M
3300025911|Ga0207654_10989845All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia611Open in IMG/M
3300025924|Ga0207694_11709333All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium529Open in IMG/M
3300025925|Ga0207650_10556615All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes962Open in IMG/M
3300025930|Ga0207701_11209985All Organisms → cellular organisms → Bacteria → Acidobacteria622Open in IMG/M
3300025934|Ga0207686_10700196All Organisms → cellular organisms → Bacteria → Acidobacteria805Open in IMG/M
3300025935|Ga0207709_11086019All Organisms → cellular organisms → Bacteria → Acidobacteria657Open in IMG/M
3300025961|Ga0207712_11134099All Organisms → cellular organisms → Bacteria → Acidobacteria697Open in IMG/M
3300025981|Ga0207640_10313152All Organisms → cellular organisms → Bacteria → Acidobacteria1246Open in IMG/M
3300026035|Ga0207703_11315127All Organisms → cellular organisms → Bacteria → Acidobacteria695Open in IMG/M
3300026035|Ga0207703_11550899All Organisms → cellular organisms → Bacteria → Acidobacteria637Open in IMG/M
3300026089|Ga0207648_10559252All Organisms → cellular organisms → Bacteria → Acidobacteria1051Open in IMG/M
3300026116|Ga0207674_10862553All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes873Open in IMG/M
3300026116|Ga0207674_11714039All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium596Open in IMG/M
3300026142|Ga0207698_12390499All Organisms → cellular organisms → Bacteria → Acidobacteria540Open in IMG/M
3300027880|Ga0209481_10083801All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes1523Open in IMG/M
3300027886|Ga0209486_10828120All Organisms → cellular organisms → Bacteria → Acidobacteria608Open in IMG/M
3300028380|Ga0268265_10461324All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes1189Open in IMG/M
3300031548|Ga0307408_100546663All Organisms → cellular organisms → Bacteria → Acidobacteria1021Open in IMG/M
3300031731|Ga0307405_11869469All Organisms → cellular organisms → Bacteria → Acidobacteria535Open in IMG/M
3300031858|Ga0310892_11047572All Organisms → cellular organisms → Bacteria → Acidobacteria577Open in IMG/M
3300031995|Ga0307409_102311867All Organisms → cellular organisms → Bacteria → Acidobacteria567Open in IMG/M
3300032004|Ga0307414_11250438All Organisms → cellular organisms → Bacteria → Acidobacteria688Open in IMG/M


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere9.40%
Serpentine SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil6.84%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere6.84%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere6.84%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere6.84%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil5.98%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere5.98%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere5.13%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil4.27%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil3.42%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere3.42%
RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere3.42%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere3.42%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere3.42%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil2.56%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil1.71%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil1.71%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil1.71%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere1.71%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere1.71%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere1.71%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil0.85%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil0.85%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Corn, Switchgrass And Miscanthus Rhizosphere0.85%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil0.85%
Rice Paddy SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil0.85%
SoilEnvironmental → Terrestrial → Soil → Loam → Grasslands → Soil0.85%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil0.85%
Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil0.85%
Corn RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere0.85%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Miscanthus Rhizosphere0.85%
Corn, Switchgrass And Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere0.85%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere0.85%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere0.85%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere0.85%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
2162886011Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1Host-AssociatedOpen in IMG/M
3300000787Soil microbial communities from Great Prairies - Iowa, Continuous Corn soilEnvironmentalOpen in IMG/M
3300000789Soil microbial communities from Great Prairies - Iowa, Native Prairie soilEnvironmentalOpen in IMG/M
3300001116Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM2H0_M2EnvironmentalOpen in IMG/M
3300001431Amended soil microbial communities from Kansas Great Prairies, USA - BrdU F1.4TB clc assemlyEnvironmentalOpen in IMG/M
3300001978Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6Host-AssociatedOpen in IMG/M
3300002897Soil microbial communities from Manhattan, Kansas, USA - Sample 500um NexteraEnvironmentalOpen in IMG/M
3300004156Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 1EnvironmentalOpen in IMG/M
3300004643Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 3EnvironmentalOpen in IMG/M
3300005328Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaGHost-AssociatedOpen in IMG/M
3300005438Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaGEnvironmentalOpen in IMG/M
3300005458Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaGEnvironmentalOpen in IMG/M
3300005536Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaGEnvironmentalOpen in IMG/M
3300005543Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaGHost-AssociatedOpen in IMG/M
3300005545Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaGEnvironmentalOpen in IMG/M
3300005546Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaGEnvironmentalOpen in IMG/M
3300005547Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaGEnvironmentalOpen in IMG/M
3300005556Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156EnvironmentalOpen in IMG/M
3300005563Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2Host-AssociatedOpen in IMG/M
3300005577Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2Host-AssociatedOpen in IMG/M
3300005578Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2Host-AssociatedOpen in IMG/M
3300005615Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaGEnvironmentalOpen in IMG/M
3300005618Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2Host-AssociatedOpen in IMG/M
3300005719Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2Host-AssociatedOpen in IMG/M
3300005840Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2Host-AssociatedOpen in IMG/M
3300005841Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2Host-AssociatedOpen in IMG/M
3300005886Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_20C_0N_205EnvironmentalOpen in IMG/M
3300006049Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1Host-AssociatedOpen in IMG/M
3300006194Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1Host-AssociatedOpen in IMG/M
3300006847Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5Host-AssociatedOpen in IMG/M
3300006852Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2Host-AssociatedOpen in IMG/M
3300006871Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3Host-AssociatedOpen in IMG/M
3300006894Agricultural soil microbial communities from Utah to study Nitrogen management - NC ControlEnvironmentalOpen in IMG/M
3300006931Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2)Host-AssociatedOpen in IMG/M
3300006969Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3Host-AssociatedOpen in IMG/M
3300009101Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaGHost-AssociatedOpen in IMG/M
3300009148Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaGHost-AssociatedOpen in IMG/M
3300009162Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2Host-AssociatedOpen in IMG/M
3300009174Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaGHost-AssociatedOpen in IMG/M
3300009545Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaGHost-AssociatedOpen in IMG/M
3300009789Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot28EnvironmentalOpen in IMG/M
3300009840Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot105AEnvironmentalOpen in IMG/M
3300010036Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot26EnvironmentalOpen in IMG/M
3300010040Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot55EnvironmentalOpen in IMG/M
3300010045Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot61EnvironmentalOpen in IMG/M
3300010046Tropical forest soil microbial communities from Panama - MetaG Plot_36EnvironmentalOpen in IMG/M
3300010166Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot27EnvironmentalOpen in IMG/M
3300010358Tropical forest soil microbial communities from Panama - MetaG Plot_3EnvironmentalOpen in IMG/M
3300010359Tropical forest soil microbial communities from Panama - MetaG Plot_15EnvironmentalOpen in IMG/M
3300010362Tropical forest soil microbial communities from Panama - MetaG Plot_22EnvironmentalOpen in IMG/M
3300010373Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4EnvironmentalOpen in IMG/M
3300010375Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaGHost-AssociatedOpen in IMG/M
3300010397Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4EnvironmentalOpen in IMG/M
3300010399Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3EnvironmentalOpen in IMG/M
3300010400Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2EnvironmentalOpen in IMG/M
3300010403Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3EnvironmentalOpen in IMG/M
3300010868Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (PacBio error correction)EnvironmentalOpen in IMG/M
3300011119Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaGHost-AssociatedOpen in IMG/M
3300012951Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_226_MGEnvironmentalOpen in IMG/M
3300012961Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_202_MGEnvironmentalOpen in IMG/M
3300012977Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_20cm_5_24_1 metaGEnvironmentalOpen in IMG/M
3300013100Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaGHost-AssociatedOpen in IMG/M
3300013102Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaGHost-AssociatedOpen in IMG/M
3300013297Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaGHost-AssociatedOpen in IMG/M
3300013306Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaGHost-AssociatedOpen in IMG/M
3300013308Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaGHost-AssociatedOpen in IMG/M
3300014487Bulk soil microbial communities from Mexico - Magueyal (Ma) metaGEnvironmentalOpen in IMG/M
3300014745Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaGHost-AssociatedOpen in IMG/M
3300015371Combined assembly of cpr5 and col0 rhizosphere and soilHost-AssociatedOpen in IMG/M
3300015372Soil combined assemblyHost-AssociatedOpen in IMG/M
3300015373Combined assembly of cpr5 rhizosphereHost-AssociatedOpen in IMG/M
3300018466Populus adjacent soil microbial communities from riparian zone of Blue River, Arizona, USA - 249 TEnvironmentalOpen in IMG/M
3300018482Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118EnvironmentalOpen in IMG/M
3300025885Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025899Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025908Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025911Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025924Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025925Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025930Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes)EnvironmentalOpen in IMG/M
3300025934Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025935Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025961Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025981Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026035Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026089Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026116Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026142Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300027880Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3 (SPAdes)Host-AssociatedOpen in IMG/M
3300027886Agricultural soil microbial communities from Utah to study Nitrogen management - NC Compost (SPAdes)EnvironmentalOpen in IMG/M
3300028380Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300031548Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3Host-AssociatedOpen in IMG/M
3300031731Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1Host-AssociatedOpen in IMG/M
3300031858Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8D2EnvironmentalOpen in IMG/M
3300031995Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2Host-AssociatedOpen in IMG/M
3300032004Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3Host-AssociatedOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
MRS1b_0280.000006902162886011Miscanthus RhizosphereERIFNSIMNGRNARGNMPAFANKINGKEADALVEFVRRLKGNEQ
JGI11643J11755_1141241133300000787SoilSIMNGRSVRGNMPAFSDKLNEKEVESLVSFVRKFKG*
JGI1027J11758_1104479613300000789SoilDVSDERIFNSIMNGRNVRGNMPSFSNKLNEKEADALVTFVRSFK*
JGI12627J13344_10051663300001116Forest SoilMNGRNVRGNMPAFSDKLKEKEINSLVTVVRGFKAQQ*
F14TB_10793502123300001431SoilYNSIMNGRNVRGKMPAFSDKLNNEEAEALVDLVRGLRK*
JGI24747J21853_104231123300001978Corn, Switchgrass And Miscanthus RhizosphereWQDDVTDERIFNSIMNGRNVRGNMPGFKNKLNEKDAEALVGMVRGFRK*
JGI24804J43974_102108013300002897SoilWQDEVTDERIFNSIMNGRSARGNMPAFSNKMNQQEVESLVKVVRGFKG*
Ga0062589_10270314823300004156SoilTDAKWQDEVTDERIFNSIMNGRNVRGNMPSFSNKINQKEVESLVNFVRRFKG*
Ga0062591_10088406133300004643SoilDVSDERIYNSIMNGRNVRGNMPAFSNKLNDKEADSLVSFVRGLKAQ*
Ga0070676_1065957513300005328Miscanthus RhizosphereWHDDVTDERIFNSIMNGRNVRGNMPSFSNKLNENEVESLVSFVRKFKG*
Ga0070701_1105463213300005438Corn, Switchgrass And Miscanthus RhizosphereRIFNSITNGRNVRGNMPSFANKLKENEINSLVDFVRRLKGPQQQQ*
Ga0070681_1062026633300005458Corn RhizosphereDVSDERIFNSIMNGRNVRGNMPAFSDKISPAEAESLVSFVRRMRG*
Ga0070697_10196962423300005536Corn, Switchgrass And Miscanthus RhizosphereDVSDERIFNSIMNGRNVRGNMPAFSDKLKEKEVNSLVTLVRKFKPPQ*
Ga0070672_10055664533300005543Miscanthus RhizosphereDERIFNSIMNGRNTRGNMPAFSNKLKDKDVDSLVTFVRGLKAK*
Ga0070695_10152259023300005545Corn, Switchgrass And Miscanthus RhizosphereRIFNSITNGRNVRGNMPAFANKLNEKEINSLVEFVRRLKGPQQQ*
Ga0070696_10099090523300005546Corn, Switchgrass And Miscanthus RhizosphereIFNSIMNGRNVRGNMPAFSNKLNQKAADSLVNFVRQMRG*
Ga0070693_10115968413300005547Corn, Switchgrass And Miscanthus RhizosphereWQGDVSDERIFNSIMNGRNTRGNMPSFANKLNQQEVDSLVSFVRGLKAQ*
Ga0066707_1067706223300005556SoilIFNSIMNGRNVRGNMPAFNKKISEEETDALVVYVRSLKR*
Ga0068855_10090085033300005563Corn RhizosphereVSDERIFNSIMNGRNVRGNMPGFKDKLNEQEADTLVEYVRRFKK*
Ga0068855_10199730813300005563Corn RhizosphereERIFNSIMNGRSVRGNMPPFANKLSEKEVNSLVEFVRRLKGPQQQ*
Ga0068857_10121332233300005577Corn RhizosphereDVSDERIFNSIMNGRNVRGNMPSFSDKLNEREVNSLVTFVRAFK*
Ga0068857_10132674813300005577Corn RhizosphereDVSDERIFNSIMNGRNTRGNMPAFANKLNEKEVNSLVGFVRGLKAQ*
Ga0068857_10195363413300005577Corn RhizosphereRNVRGNMPAFANKLNEREANSLVEFVRGLKGPQQ*
Ga0068854_10038140913300005578Corn RhizosphereGRNLRGNMPAFANKLNEKEANSLVEFVRGLKGPPQ*
Ga0068854_10113505313300005578Corn RhizosphereSDERIFNSIMNGRNTRGNMPAFANKLNEKEVNSLVSFVRGLKAQ*
Ga0070702_10158765813300005615Corn, Switchgrass And Miscanthus RhizosphereDERIFNSIMNGRNVRGNMPKFADRLSEAEVNGLVTFVRDLRSK*
Ga0068864_10232426123300005618Switchgrass RhizosphereMNGRNVRGNMPSFSNKLNEKEVDSLVTYVRKFKG*
Ga0068861_10248243313300005719Switchgrass RhizosphereDVTDERIFNSIMNGRNVRGNMPSFSNKLNENEVESLVSFVRKFKG*
Ga0068870_1008252933300005840Miscanthus RhizosphereNSIMNGRNVRGNMPAFANKLNEREANSLVEFVRGLKGPQQ*
Ga0068870_1015344533300005840Miscanthus RhizosphereLTDAKWQDDVTDERIFNSIMNGRNVRGNMPGFKNKLNEKDAEALVGMVRGFRK*
Ga0068870_1112372623300005840Miscanthus RhizosphereNSIMNGRNVRGNMPSFANKLKENDVNSLVGFVRGLKAKQ*
Ga0068863_10016963513300005841Switchgrass RhizosphereDVSDERIFNSIMNGRNVRGNMPGFANKLNAQEADSLVNFVRSLKG*
Ga0068863_10046306233300005841Switchgrass RhizosphereDVSDERIFNSIMNGRNVRGNMPSFSNKLDQNEAESLVSFVRRLRG*
Ga0075286_103052823300005886Rice Paddy SoilDVTDERIFNSIMNGRNVRGNMPAFSDKLKENEVNSLVNFVRALKAK*
Ga0075417_1049265313300006049Populus RhizosphereDVSDERIFNSIMNGRNSSGNMPAFANKLNEKEINSLVTFVRGLKQ*
Ga0075427_1002601713300006194Populus RhizosphereVSDERIFNSIMNGRSVRGNMPPFANKLSEKEVNSLVEFVRRLKGPQQQ*
Ga0075431_10077763013300006847Populus RhizosphereEVSDERIFNSIMNGRNVRGNMPAFANKLKDKEADVLVNFVRGLKATQQ*
Ga0075433_1024456433300006852Populus RhizosphereFNSIMNGRNVRGNMPAFSNKLNDQEAESLVSFVRRFRK*
Ga0075434_10234887823300006871Populus RhizosphereRIFNSIMNGRNIRGNMPAFSDKLNEREVNSLVTFVRTFK*
Ga0079215_10000094103300006894Agricultural SoilMNGRNVRGNMPAFSDKLNEKEVDSLVSFVRKFKG*
Ga0097620_10036606513300006931Switchgrass RhizosphereDERIFNSIMNGRNVRGNMPKFADRLSEAEVNGLVTFVRDLKSK*
Ga0075419_1013935833300006969Populus RhizosphereRIFNSIMNGRNVRGNMPAFANKLKDKEADVLVNFVRGLKAAQQ*
Ga0105247_1052456313300009101Switchgrass RhizosphereVSDERIFNSIMNGRNVRGNMPAFSNKLNEKEAESLVNFVRSLK*
Ga0105243_1057221333300009148Miscanthus RhizosphereAQWQDDVTDERLFNSIMNGRNVRGNMPAFADKLKENDVNSLVNFVRGLKAK*
Ga0075423_1138972523300009162Populus RhizosphereMNGRNVRGNMPAFSDKLNEKEVESLVSFVRKFKG*
Ga0105241_1093799933300009174Corn RhizosphereDERIFNSIMNGRNVRGNMPGFKDKLNEQEADTLVEYVRRFKK*
Ga0105241_1097466313300009174Corn RhizosphereERIFNSVMNGRNMRGNMPPFGQKLKEDEINSLVTFVRGLKG*
Ga0105241_1105265413300009174Corn RhizosphereIMNGRNVRGNMPAFSDKLNEKEVDSLVSLVRKFKG*
Ga0105237_1168040523300009545Corn RhizosphereSITNGRNQRGNMPAFADKINEKEVDSLVSFVRGLKAQ*
Ga0126307_1148289613300009789Serpentine SoilGRNVRGNMPAFADKLNEKEANSLVSFVRGLKAQQ*
Ga0126313_1046387613300009840Serpentine SoilNSVMNGRNVRGNMPAFGQKLNEKEINSLVDFVRRLKGNGQ*
Ga0126313_1185411513300009840Serpentine SoilIFNSIMNGRNVRGNMPAFADKLNEKQVNSLVTFVRGLKAQQ*
Ga0126305_1098433823300010036Serpentine SoilSIMNGRNVRGNMPAFADKLNEKEANSLVSFVRGLKAQQ*
Ga0126308_1085455413300010040Serpentine SoilDERIFNSIMNGRNVRGNMPAFSDKLNENQVNSLVTFVRGLKAQQ*
Ga0126311_1000584273300010045Serpentine SoilDVSDERIFNSIMNGRNVRGNMPAFSDKLKEQQVNSLVSFVRGLKAQQ*
Ga0126311_1009661543300010045Serpentine SoilWQADVSDERIFNSIMNGRNVRGNMPAFSDKVNEKEVNSLVSFVRGLKAKQ*
Ga0126384_1094698433300010046Tropical Forest SoilMNGRNVRGNMPPFGQKLKEDEINSLVTFVRTLKG*
Ga0126384_1190725123300010046Tropical Forest SoilFNSIMNGRNTRGNMPAFSDKLNDKEADLLVSFVRGLKAQ*
Ga0126306_1098664923300010166Serpentine SoilRIFNSIMNGREISGNMPAFAKKLNEKEVNSLVTFVRGLKG*
Ga0126370_1260606413300010358Tropical Forest SoilQDDVGDERLFNSIMNGRNVRGNMPAFSDKLNDGEAESLVQFVRRFRK*
Ga0126376_1082312113300010359Tropical Forest SoilDAEWQDVVSDERLFNSIMNGRNVRGNMPAFSNKLKEKEVESLVSFVRQFRK*
Ga0126377_1155734613300010362Tropical Forest SoilIFNSIMNGRNVRGNMPPFGQKLKEDEINSLVTFIRGLKG*
Ga0134128_1094573123300010373Terrestrial SoilLTDAEWQDDVGDERLFNSIMNGRNVRGNMPAFSNKLNTREAESLVSFVRRFRK*
Ga0105239_1212442113300010375Corn RhizosphereDVSDERIYNSIMNGRKVRGEMPSFSNKLSNEEADALVGLVRGFRK*
Ga0134124_1310183513300010397Terrestrial SoilDERIYNSIMNGRNVRGNMPAFSNKLNDKEADSLVSFVRGLKAQ*
Ga0134127_1162661113300010399Terrestrial SoilIMNGRNVRGNMPAFSNKLNDKEADSLVSFVRGLKAQ*
Ga0134127_1359370313300010399Terrestrial SoilVTDERIFNSIMNGRNVRGNMPAFSDKLNEKEVDSLVSFVRKFKG*
Ga0134122_1106538133300010400Terrestrial SoilMNGRNVRGNMPPFGQKLKEDEINSLVTFVRGLKG*
Ga0134123_1052295913300010403Terrestrial SoilRDLTDPKWQDDVTDERIFNSIMNGRNVRGNMPKFADRLSEAEVNGLVTLVRDLRSK*
Ga0134123_1313557213300010403Terrestrial SoilNSIMNGRNVRGNMPALSNKLNDKEADSFVSFVRGLKEQ*
Ga0124844_126069213300010868Tropical Forest SoilLTDAEWQDDVGDERLFNSIMNGRNVRGNMPAFSNKLKTREAESLVSFVRRFRK*
Ga0105246_1164397523300011119Miscanthus RhizosphereYNSIMNGRNVRGNMPAFSNKLNDKEADSLVSFVRGLKAQ*
Ga0164300_1034772413300012951SoilDDVTDERIFNSIMNGRNVRGNMPGFKNKLNEKDAEALVGMVRGFRK*
Ga0164302_1180805323300012961SoilSIMNGRNVRGNMPGFKNKLNEKDAEALVGMVRGFRK*
Ga0134087_1077601413300012977Grasslands SoilGRNVRGNMPAFSKKLSEQEANSLVDFVRRLKVQQQ*
Ga0157373_1039340613300013100Corn RhizosphereIFNSITNGRNVRGNMPPFGQKLKEDEINSLVTFVRELKG*
Ga0157371_1102376513300013102Corn RhizosphereNSIMNGRNVRGNMPSFSNKLNENEVESLVSFVRKFKG*
Ga0157378_1125331933300013297Miscanthus RhizosphereNSIMNGRNIRGNMPAFKDKLNEQEVESLVEYVRRFKK*
Ga0163162_1319882513300013306Switchgrass RhizosphereRIFNSITNGRNVRGNMPSFANKLKENEINSLVDFVRRLKGPQRQQ*
Ga0157375_1049843933300013308Miscanthus RhizosphereFNSIMNGRNVRGNMPKFADRLSEAEVNGLVTFVRDLKSK*
Ga0157375_1134673513300013308Miscanthus RhizosphereVSDERIFNSIMNGRNTRGNMPAFSNKLKDKDVDSLVTFVRGLKAK*
Ga0182000_1048659313300014487SoilIFNSIMNGRDVRGNMPAFSKQLNEKEVESLVSFVRKFKG*
Ga0157377_1118287223300014745Miscanthus RhizosphereARDLTDAKWHDDVTDERIFNSIMNGRNVRGNMPSFSNKLNENEVESLVSFVRKFKG*
Ga0132258_1119671933300015371Arabidopsis RhizosphereDERIFNSILNGRNVRGNMPRFADKLNEKEVDSLVSFVRGLKG*
Ga0132258_1138440213300015371Arabidopsis RhizosphereDVSDERIFNSIMNGRNVRGNMPGFANKLNAQEADSLVNFVRGLKG*
Ga0132256_10121835013300015372Arabidopsis RhizosphereIYNSIMNGRKVRGEMPSFSNKLSNEEADALVGLVRGFRK*
Ga0132257_10147692513300015373Arabidopsis RhizosphereFNSIMNGRNVRGNMPGFKNKLNEKDVEALVGMVRGFRK*
Ga0132257_10351164423300015373Arabidopsis RhizosphereDLTDPKWQDDVTDERIFNSIMNGRNVRGNMPKFADRLSEAEVNGLVTLVRDLRSK*
Ga0190268_1083200823300018466SoilVSDARIFNSIMNGRSERGNMPQFTGKLDEKEVNSLVDFVRKLKASK
Ga0190268_1183748323300018466SoilGEVSDARIFNSIMNGRNEQGNMPPFANKLKEKEIDSLVEFVRRLKG
Ga0066669_1230473823300018482Grasslands SoilARDLTDPQWQADVGDERIFNSIMNGRNVRGNMPAFANKLNEKEANSLVDFVRRLKAN
Ga0207653_1034823533300025885Corn, Switchgrass And Miscanthus RhizosphereKWHDDVTDERIFNSIMNGRNVRGNMPSFSNKLNENEVESLVSFVRKFKG
Ga0207642_1085772123300025899Miscanthus RhizosphereIYNSIMNGRKVRGEMPSFSNKLSNEEADALVGLVRGFRK
Ga0207643_1091366723300025908Miscanthus RhizosphereIFNSIMNGRNVRGNMPSFANKLKENDVNSLVGFVRGLKAKQ
Ga0207654_1022750833300025911Corn RhizosphereQDEVTDERIFNSIMNGRSQRGNMPPFSNKIDQKEAESLVNFVRRFRAS
Ga0207654_1098984523300025911Corn RhizosphereVSDERIFNSILNGRNVRGNMPRFADKLNEKEVDSLVSFVRGLKG
Ga0207694_1170933313300025924Corn RhizosphereSDERIFNSIINGRNVRGNMPAFADKISQVEAESLVSFVRRMRG
Ga0207650_1055661513300025925Switchgrass RhizosphereVSDERIFNSIMNGRNVRGNMPAFTDKLNEREVNSLVKFVRTFKAQQQ
Ga0207701_1120998523300025930Corn, Switchgrass And Miscanthus RhizosphereSIMNGRNVRGNMPSFSNKLNENEVESLVSFVRKFKG
Ga0207686_1070019613300025934Miscanthus RhizosphereFNSIMNGRNVRGNMPKFADRLSEAEVNGLVTFVRDLKSK
Ga0207709_1108601913300025935Miscanthus RhizosphereDERIFNSIMNGRNVRGNMPGFKNKLNEKDAEALVGMVRGFRK
Ga0207712_1113409923300025961Switchgrass RhizosphereFNSIMNGRNVRGNMPGFKNKLNEKDAESLVGMVRGFRK
Ga0207640_1031315233300025981Corn RhizosphereIYNSIMSGRKVRGEMPSFSNKLSNEEADALVGLVRGFRK
Ga0207703_1131512713300026035Switchgrass RhizosphereDLTDAKWQDDVTDERIFNSIMNGRNVRGNMPGFKNKLNEKDAEALVGMVRGFRK
Ga0207703_1155089913300026035Switchgrass RhizosphereIFNSIMNGRSVRGNMPAFTDKLNEREVNSLVKFVRAFKAQQQ
Ga0207648_1055925213300026089Miscanthus RhizosphereIMNGRNVRGNMPRFSNKMNQQEADSLVGLVRGLRK
Ga0207674_1086255333300026116Corn RhizosphereDERIFNSIMNGRNVRGNMPAFSDKLKENEVNSLVSFVRAFKGQQ
Ga0207674_1171403923300026116Corn RhizosphereAEWQDDAGDERLFNSIMNGRNVRGNMPAFSNKLNDQEAESLVSFVRRFRK
Ga0207698_1239049913300026142Corn RhizosphereAKWHDDVTDERIFNSIMNGRNVRGNMPSFSNKLNENEVESLVSFVRKFKG
Ga0209481_1008380133300027880Populus RhizosphereDERIFNSIMNGRNVRGNMPAFANKLKDKEADVLVNFVRGLKAAQQ
Ga0209486_1082812023300027886Agricultural SoilRIFNSIMNGRNVRGNMPAFSDKLNEKEVESLVGFVRKFKG
Ga0268265_1046132413300028380Switchgrass RhizosphereIFNSILNGRNVRGNMPRFADKLNEKEVDSLVSFVRGLKG
Ga0307408_10054666333300031548RhizosphereSIMNGRNVRGNMPAFANKLNEREANSLVEFVRGLKGPQQ
Ga0307405_1186946923300031731RhizosphereSIMNGRDIGGNMPAFANKMNEKEINSLVTFVRGLKG
Ga0310892_1104757213300031858SoilNSIMNGRDISGNMPSFANKMNEKEVESLVTFVRGLKG
Ga0307409_10231186723300031995RhizosphereDARIFNSIMNGRNVRGNMPPFSNKIDEKEADSLVNFVRSLKG
Ga0307414_1125043823300032004RhizosphereSDARIFNSIMNGRNVRGNMPAFSNKIDEKEADSLVDFVRRLKG

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.