NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome Family F077489

Metagenome Family F077489

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F077489
Family Type Metagenome
Number of Sequences 117
Average Sequence Length 48 residues
Representative Sequence MTYYLLLSGDSEKDSIYETNVLGEESFETFYPSVGFMILNRIIN
Number of Associated Samples 101
Number of Associated Scaffolds 117

Quality Assessment
Transcriptomic Evidence No
Most common taxonomic group Unclassified
% of genes with valid RBS motifs 25.89 %
% of genes near scaffold ends (potentially truncated) 91.45 %
% of genes from short scaffolds (< 2000 bps) 88.89 %
Associated GOLD sequencing projects 96
AlphaFold2 3D model prediction Yes
3D model pTM-score0.28

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Unclassified (45.299 % of family members)
NCBI Taxonomy ID N/A
Taxonomy N/A

Most Common Ecosystem
GOLD Ecosystem Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine
(43.590 % of family members)
Environment Ontology (ENVO) Unclassified
(89.744 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Saline → Water (saline)
(89.744 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 22.22%    β-sheet: 0.00%    Coil/Unstructured: 77.78%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  		pTM-score: 0.28
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 117 Family Scaffolds
PF01370Epimerase 14.53
PF00535Glycos_transf_2 8.55
PF07883Cupin_2 5.98
PF02562PhoH 5.13
PF01048PNP_UDP_1 4.27
PF00984UDPG_MGDP_dh 2.56
PF02585PIG-L 1.71
PF03721UDPG_MGDP_dh_N 1.71
PF02719Polysacc_synt_2 1.71
PF02709Glyco_transf_7C 1.71
PF16363GDP_Man_Dehyd 0.85
PF136402OG-FeII_Oxy_3 0.85
PF136612OG-FeII_Oxy_4 0.85

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 117 Family Scaffolds
COG1702Phosphate starvation-inducible protein PhoH, predicted ATPaseSignal transduction mechanisms [T] 5.13
COG1875Predicted ribonuclease YlaK, contains NYN-type RNase and PhoH-family ATPase domainsGeneral function prediction only [R] 5.13
COG0677UDP-N-acetyl-D-mannosaminuronate dehydrogenaseCell wall/membrane/envelope biogenesis [M] 4.27
COG0775Nucleoside phosphorylase/nucleosidase, includes 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase MtnN and futalosine hydrolase MqnBNucleotide transport and metabolism [F] 4.27
COG0813Purine-nucleoside phosphorylaseNucleotide transport and metabolism [F] 4.27
COG1004UDP-glucose 6-dehydrogenaseCell wall/membrane/envelope biogenesis [M] 4.27
COG2820Uridine phosphorylaseNucleotide transport and metabolism [F] 4.27
COG0451Nucleoside-diphosphate-sugar epimeraseCell wall/membrane/envelope biogenesis [M] 3.42
COG0702Uncharacterized conserved protein YbjT, contains NAD(P)-binding and DUF2867 domainsGeneral function prediction only [R] 3.42
COG1086NDP-sugar epimerase, includes UDP-GlcNAc-inverting 4,6-dehydratase FlaA1 and capsular polysaccharide biosynthesis protein EpsCCell wall/membrane/envelope biogenesis [M] 3.42
COG0240Glycerol-3-phosphate dehydrogenaseEnergy production and conversion [C] 1.71
COG1087UDP-glucose 4-epimeraseCell wall/membrane/envelope biogenesis [M] 1.71
COG1088dTDP-D-glucose 4,6-dehydrataseCell wall/membrane/envelope biogenesis [M] 1.71
COG1089GDP-D-mannose dehydrataseCell wall/membrane/envelope biogenesis [M] 1.71
COG1091dTDP-4-dehydrorhamnose reductaseCell wall/membrane/envelope biogenesis [M] 1.71
COG12503-hydroxyacyl-CoA dehydrogenaseLipid transport and metabolism [I] 1.71
COG1893Ketopantoate reductaseCoenzyme transport and metabolism [H] 1.71
COG2120N-acetylglucosaminyl deacetylase, LmbE familyCarbohydrate transport and metabolism [G] 1.71

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms54.70 %
UnclassifiedrootN/A45.30 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300000237|SI34jun09_150mDRAFT_1030507Not Available580Open in IMG/M
3300001589|JGI24005J15628_10156402All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium TMED8686Open in IMG/M
3300001589|JGI24005J15628_10177204All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium TMED8619Open in IMG/M
3300002484|JGI25129J35166_1076190Not Available609Open in IMG/M
3300004097|Ga0055584_101698722Not Available652Open in IMG/M
3300005430|Ga0066849_10047609All Organisms → Viruses → Predicted Viral1729Open in IMG/M
3300005605|Ga0066850_10129286All Organisms → cellular organisms → Archaea → DPANN group → Candidatus Pacearchaeota → Candidatus Pacearchaeota archaeon939Open in IMG/M
3300006090|Ga0082015_1059719Not Available603Open in IMG/M
3300006191|Ga0075447_10119642All Organisms → cellular organisms → Archaea → DPANN group → Candidatus Pacearchaeota → Candidatus Pacearchaeota archaeon901Open in IMG/M
3300006306|Ga0068469_1251771Not Available506Open in IMG/M
3300006309|Ga0068479_1152938All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium TMED8574Open in IMG/M
3300006318|Ga0068475_1416947Not Available680Open in IMG/M
3300006325|Ga0068501_1165213Not Available599Open in IMG/M
3300006336|Ga0068502_1870374Not Available606Open in IMG/M
3300006565|Ga0100228_1251108All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon802Open in IMG/M
3300006750|Ga0098058_1073301All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium TMED8944Open in IMG/M
3300006751|Ga0098040_1190295All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium TMED8601Open in IMG/M
3300007276|Ga0070747_1115826Not Available981Open in IMG/M
3300007514|Ga0105020_1289512All Organisms → Viruses → Predicted Viral1060Open in IMG/M
3300008050|Ga0098052_1063966All Organisms → Viruses → Predicted Viral1553Open in IMG/M
3300008050|Ga0098052_1169117All Organisms → cellular organisms → Archaea → DPANN group → Candidatus Pacearchaeota → Candidatus Pacearchaeota archaeon859Open in IMG/M
3300008221|Ga0114916_1127222Not Available590Open in IMG/M
3300009193|Ga0115551_1108076All Organisms → Viruses → Predicted Viral1300Open in IMG/M
3300009409|Ga0114993_10602409All Organisms → Viruses → environmental samples → uncultured virus808Open in IMG/M
3300009497|Ga0115569_10471502All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium TMED8534Open in IMG/M
3300009593|Ga0115011_10193985All Organisms → Viruses → Predicted Viral1497Open in IMG/M
3300009593|Ga0115011_12102142Not Available518Open in IMG/M
3300009703|Ga0114933_10534106Not Available759Open in IMG/M
3300009705|Ga0115000_10016560All Organisms → cellular organisms → Bacteria5352Open in IMG/M
3300009705|Ga0115000_10430730All Organisms → cellular organisms → Archaea → DPANN group → Candidatus Pacearchaeota → Candidatus Pacearchaeota archaeon837Open in IMG/M
3300009706|Ga0115002_10730995Not Available696Open in IMG/M
3300009785|Ga0115001_10678454Not Available625Open in IMG/M
3300009786|Ga0114999_10465867Not Available981Open in IMG/M
3300009790|Ga0115012_10666190All Organisms → cellular organisms → Archaea → DPANN group → Candidatus Pacearchaeota → Candidatus Pacearchaeota archaeon831Open in IMG/M
3300009790|Ga0115012_11009176All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon688Open in IMG/M
3300010150|Ga0098056_1122159Not Available884Open in IMG/M
3300010153|Ga0098059_1015906All Organisms → Viruses → Predicted Viral3106Open in IMG/M
3300010883|Ga0133547_10188630All Organisms → Viruses → Predicted Viral4412Open in IMG/M
3300012920|Ga0160423_11221050All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon501Open in IMG/M
3300012928|Ga0163110_10803477All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium TMED8740Open in IMG/M
3300012928|Ga0163110_11739893Not Available509Open in IMG/M
3300017703|Ga0181367_1051386Not Available726Open in IMG/M
3300017705|Ga0181372_1082874Not Available545Open in IMG/M
3300017731|Ga0181416_1126956Not Available613Open in IMG/M
3300017731|Ga0181416_1150900Not Available560Open in IMG/M
3300017738|Ga0181428_1150570Not Available544Open in IMG/M
3300017744|Ga0181397_1164712Not Available563Open in IMG/M
3300017781|Ga0181423_1131208Not Available971Open in IMG/M
3300017783|Ga0181379_1134932Not Available887Open in IMG/M
3300020169|Ga0206127_1197404All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium TMED8733Open in IMG/M
3300020333|Ga0211661_1122516Not Available612Open in IMG/M
3300020376|Ga0211682_10020611All Organisms → Viruses → Predicted Viral2684Open in IMG/M
3300020428|Ga0211521_10027070All Organisms → Viruses → Predicted Viral3189Open in IMG/M
3300020428|Ga0211521_10484677Not Available532Open in IMG/M
3300020435|Ga0211639_10079924All Organisms → Viruses → Predicted Viral1397Open in IMG/M
3300020441|Ga0211695_10433265Not Available502Open in IMG/M
3300020447|Ga0211691_10166252All Organisms → cellular organisms → Archaea → DPANN group → Candidatus Pacearchaeota → Candidatus Pacearchaeota archaeon840Open in IMG/M
3300020449|Ga0211642_10067560All Organisms → cellular organisms → Archaea → DPANN group → Candidatus Pacearchaeota → Candidatus Pacearchaeota archaeon1555Open in IMG/M
3300020454|Ga0211548_10180716All Organisms → Viruses → Predicted Viral1021Open in IMG/M
3300020463|Ga0211676_10243124All Organisms → Viruses → Predicted Viral1059Open in IMG/M
3300020470|Ga0211543_10558029All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium TMED8540Open in IMG/M
3300020471|Ga0211614_10189192All Organisms → cellular organisms → Archaea → DPANN group → Candidatus Pacearchaeota → Candidatus Pacearchaeota archaeon890Open in IMG/M
3300020474|Ga0211547_10206096All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon1009Open in IMG/M
3300020478|Ga0211503_10656276All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium TMED8541Open in IMG/M
3300020478|Ga0211503_10656781Not Available541Open in IMG/M
3300020595|Ga0206126_10129115All Organisms → Viruses → Predicted Viral1221Open in IMG/M
3300021442|Ga0206685_10255896Not Available593Open in IMG/M
3300021959|Ga0222716_10456835Not Available728Open in IMG/M
(restricted) 3300024264|Ga0233444_10095631All Organisms → Viruses → Predicted Viral1571Open in IMG/M
3300025072|Ga0208920_1089402All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium TMED8575Open in IMG/M
3300025082|Ga0208156_1038385All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium TMED81001Open in IMG/M
3300025086|Ga0208157_1071071All Organisms → cellular organisms → Archaea → DPANN group → Candidatus Pacearchaeota → Candidatus Pacearchaeota archaeon887Open in IMG/M
3300025096|Ga0208011_1018753All Organisms → Viruses → Predicted Viral1801Open in IMG/M
3300025102|Ga0208666_1048102All Organisms → Viruses → Predicted Viral1205Open in IMG/M
3300025109|Ga0208553_1086826All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium735Open in IMG/M
3300025122|Ga0209434_1031201Not Available1742Open in IMG/M
3300025125|Ga0209644_1060878Not Available872Open in IMG/M
3300025127|Ga0209348_1225286Not Available510Open in IMG/M
3300025133|Ga0208299_1058071All Organisms → Viruses → Predicted Viral1441Open in IMG/M
3300025830|Ga0209832_1201831Not Available556Open in IMG/M
3300025890|Ga0209631_10361351Not Available683Open in IMG/M
3300025892|Ga0209630_10401546Not Available593Open in IMG/M
3300026193|Ga0208129_1104849All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium TMED8552Open in IMG/M
3300026259|Ga0208896_1117825Not Available732Open in IMG/M
3300026263|Ga0207992_1127745Not Available651Open in IMG/M
3300026267|Ga0208278_1027738All Organisms → Viruses → Predicted Viral1481Open in IMG/M
3300026267|Ga0208278_1125963All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium TMED8569Open in IMG/M
3300026267|Ga0208278_1132931All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium TMED8548Open in IMG/M
3300026279|Ga0208411_1085431All Organisms → cellular organisms → Archaea → DPANN group → Candidatus Pacearchaeota → Candidatus Pacearchaeota archaeon904Open in IMG/M
3300026279|Ga0208411_1126217All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium TMED8691Open in IMG/M
3300026321|Ga0208764_10267655All Organisms → cellular organisms → Archaea → DPANN group → Candidatus Pacearchaeota → Candidatus Pacearchaeota archaeon830Open in IMG/M
3300027672|Ga0209383_1011530All Organisms → Viruses → Predicted Viral4145Open in IMG/M
3300027704|Ga0209816_1178481All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium TMED8727Open in IMG/M
3300027771|Ga0209279_10021334Not Available1982Open in IMG/M
3300027779|Ga0209709_10020368All Organisms → Viruses → Predicted Viral4363Open in IMG/M
3300027779|Ga0209709_10153658All Organisms → Viruses → Predicted Viral1125Open in IMG/M
3300027779|Ga0209709_10172713All Organisms → Viruses → Predicted Viral1035Open in IMG/M
3300027801|Ga0209091_10019287All Organisms → Viruses → Predicted Viral4413Open in IMG/M
3300027859|Ga0209503_10072349All Organisms → Viruses → Predicted Viral1591Open in IMG/M
3300028177|Ga0257122_1158685Not Available586Open in IMG/M
3300028189|Ga0257127_1072125All Organisms → cellular organisms → Archaea → DPANN group → Candidatus Pacearchaeota → Candidatus Pacearchaeota archaeon1071Open in IMG/M
3300028190|Ga0257108_1165397All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium TMED8638Open in IMG/M
3300028287|Ga0257126_1195621Not Available635Open in IMG/M
3300031644|Ga0308001_10105601All Organisms → Viruses → Predicted Viral1180Open in IMG/M
3300031695|Ga0308016_10257219Not Available654Open in IMG/M
3300031696|Ga0307995_1264622Not Available584Open in IMG/M
3300031801|Ga0310121_10299306Not Available943Open in IMG/M
3300031801|Ga0310121_10366765All Organisms → cellular organisms → Archaea → DPANN group → Candidatus Pacearchaeota → Candidatus Pacearchaeota archaeon826Open in IMG/M
3300032019|Ga0315324_10263344All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium TMED8633Open in IMG/M
3300032048|Ga0315329_10691961Not Available538Open in IMG/M
3300032278|Ga0310345_11384315Not Available688Open in IMG/M
3300032278|Ga0310345_11512605Not Available656Open in IMG/M

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
MarineEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Marine43.59%
MarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Marine17.09%
SeawaterEnvironmental → Aquatic → Marine → Strait → Unclassified → Seawater5.98%
SeawaterEnvironmental → Aquatic → Marine → Intertidal Zone → Unclassified → Seawater3.42%
MarineEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Marine2.56%
MarineEnvironmental → Aquatic → Marine → Oceanic → Photic Zone → Marine2.56%
Surface SeawaterEnvironmental → Aquatic → Marine → Oceanic → Photic Zone → Surface Seawater2.56%
MarineEnvironmental → Aquatic → Marine → Oceanic → Aphotic Zone → Marine2.56%
MarineEnvironmental → Aquatic → Marine → Inlet → Unclassified → Marine2.56%
MarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Marine2.56%
Pelagic MarineEnvironmental → Aquatic → Marine → Pelagic → Unclassified → Pelagic Marine2.56%
Pelagic MarineEnvironmental → Aquatic → Marine → Neritic Zone → Unclassified → Pelagic Marine2.56%
SeawaterEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Seawater1.71%
SeawaterEnvironmental → Aquatic → Marine → Pelagic → Unclassified → Seawater1.71%
Deep OceanEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Deep Ocean0.85%
SeawaterEnvironmental → Aquatic → Marine → Inlet → Unclassified → Seawater0.85%
MarineEnvironmental → Aquatic → Marine → Coastal → Unclassified → Marine0.85%
AqueousEnvironmental → Aquatic → Marine → Coastal → Unclassified → Aqueous0.85%
MarineEnvironmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine0.85%
Estuarine WaterEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water0.85%
Deep SubsurfaceEnvironmental → Aquatic → Marine → Volcanic → Unclassified → Deep Subsurface0.85%

Visualization
Powered by ApexCharts



Associated Samples

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Taxon OIDSample NameHabitat TypeIMG/M Link
3300000237Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - 34 06/16/09 150mEnvironmentalOpen in IMG/M
3300001589Marine viral communities from the Pacific Ocean - LP-40EnvironmentalOpen in IMG/M
3300002484Marine viral communities from the Pacific Ocean - ETNP_2_130EnvironmentalOpen in IMG/M
3300002514Marine viral communities from the Pacific Ocean - ETNP_6_85EnvironmentalOpen in IMG/M
3300004097Pelagic marine sediment microbial communities from the LTER site Helgoland, North Sea, for post-phytoplankton bloom and carbon turnover studies - OSD3 (Helgoland) metaGEnvironmentalOpen in IMG/M
3300005430Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201406SV69EnvironmentalOpen in IMG/M
3300005605Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201406SV67EnvironmentalOpen in IMG/M
3300006090Marine microbial communities from the Eastern Tropical South Pacific Oxygen Minumum Zone, cruise NBP1315, 2013 - sample NBP124EnvironmentalOpen in IMG/M
3300006191Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG104-DNAEnvironmentalOpen in IMG/M
3300006306Marine microbial communities from North Pacific Subtropical Gyre, Station ALOHA - HOT229_1_0500mEnvironmentalOpen in IMG/M
3300006309Marine microbial communities from North Pacific Subtropical Gyre, Station ALOHA - HOT232_1_0500mEnvironmentalOpen in IMG/M
3300006318Marine microbial communities from North Pacific Subtropical Gyre, Station ALOHA - HOT231_1_0200mEnvironmentalOpen in IMG/M
3300006325Marine microbial communities from North Pacific Subtropical Gyre, Station ALOHA - HOT238_1_0500mEnvironmentalOpen in IMG/M
3300006336Marine microbial communities from North Pacific Subtropical Gyre, Station ALOHA - HOT238_2_0500mEnvironmentalOpen in IMG/M
3300006565Marine microbial communities from North Pacific Subtropical Gyre, Station ALOHA - HOT231_2_0125mEnvironmentalOpen in IMG/M
3300006750Marine viral communities from the Subarctic Pacific Ocean - 19_ETSP_OMZ_AT15317 metaGEnvironmentalOpen in IMG/M
3300006751Marine viral communities from the Subarctic Pacific Ocean - 7_ETSP_OMZ_AT15161 metaGEnvironmentalOpen in IMG/M
3300007276Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_31EnvironmentalOpen in IMG/M
3300007514Marine water column microbial communities of the permanently stratified Cariaco Basin, Venezuela, November cruise - 143m, 2.7-0.2um, replicate aEnvironmentalOpen in IMG/M
3300008050Marine viral communities from the Subarctic Pacific Ocean - 15_ETSP_OMZ_AT15312 metaGEnvironmentalOpen in IMG/M
3300008221Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG Antarct_66EnvironmentalOpen in IMG/M
3300009193Pelagic marine microbial communities from North Sea - COGITO_mtgs_110321EnvironmentalOpen in IMG/M
3300009409Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB2_150EnvironmentalOpen in IMG/M
3300009497Pelagic marine microbial communities from North Sea - COGITO_mtgs_120503EnvironmentalOpen in IMG/M
3300009593Marine eukaryotic phytoplankton communities from Atlantic Ocean - Tropical Atlantic ANT8 MetagenomeEnvironmentalOpen in IMG/M
3300009703Deep subsurface microbial communities from Kolumbo volcano to uncover new lineages of life (NeLLi) - 4SBTROV12_W25 metaGEnvironmentalOpen in IMG/M
3300009705Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB8_128EnvironmentalOpen in IMG/M
3300009706Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB11_86EnvironmentalOpen in IMG/M
3300009785Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB8_130EnvironmentalOpen in IMG/M
3300009786Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB8_126EnvironmentalOpen in IMG/M
3300009790Marine eukaryotic phytoplankton communities from Atlantic Ocean - Tropical Atlantic ANT10 MetagenomeEnvironmentalOpen in IMG/M
3300010148Marine viral communities from the Subarctic Pacific Ocean - 9B_ETSP_OMZ_AT15188_CsCl metaGEnvironmentalOpen in IMG/M
3300010150Marine viral communities from the Subarctic Pacific Ocean - 17B_ETSP_OMZ_AT15314_CsCl metaGEnvironmentalOpen in IMG/M
3300010153Marine viral communities from the Subarctic Pacific Ocean - 20_ETSP_OMZ_AT15318 metaGEnvironmentalOpen in IMG/M
3300010883western Arctic Ocean co-assemblyEnvironmentalOpen in IMG/M
3300012920Marine microbial communities from the Costa Rica Dome - CRUD Field 142mm St8 metaGEnvironmentalOpen in IMG/M
3300012928Marine microbial communities from the Costa Rica Dome - CRUD Field 142mm St17 metaGEnvironmentalOpen in IMG/M
3300017703Marine viral communities from the Subarctic Pacific Ocean - ?Lowphox_02 viral metaGEnvironmentalOpen in IMG/M
3300017705Marine viral communities from the Subarctic Pacific Ocean - Lowphox_08 viral metaGEnvironmentalOpen in IMG/M
3300017730Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 40 SPOT_SRF_2013-02-13EnvironmentalOpen in IMG/M
3300017731Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 39 SPOT_SRF_2013-01-16EnvironmentalOpen in IMG/M
3300017738Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 51 SPOT_SRF_2014-02-12EnvironmentalOpen in IMG/M
3300017744Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 20 SPOT_SRF_2011-02-23EnvironmentalOpen in IMG/M
3300017781Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 46 SPOT_SRF_2013-08-14EnvironmentalOpen in IMG/M
3300017783Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 2 SPOT_SRF_2009-07-10EnvironmentalOpen in IMG/M
3300020169Pelagic subsurface seawater microbial communities from Kabeltonne, Helgoland, North Sea - Helgoland_Spring_Bloom_20160419_1EnvironmentalOpen in IMG/M
3300020333Marine microbial communities from Tara Oceans - TARA_B100000959 (ERX556081-ERR598953)EnvironmentalOpen in IMG/M
3300020374Marine microbial communities from Tara Oceans - TARA_A100001011 (ERX291766-ERR318618)EnvironmentalOpen in IMG/M
3300020376Marine microbial communities from Tara Oceans - TARA_B100000795 (ERX555997-ERR599121)EnvironmentalOpen in IMG/M
3300020428Marine microbial communities from Tara Oceans - TARA_E500000331 (ERX556032-ERR599094)EnvironmentalOpen in IMG/M
3300020435Marine microbial communities from Tara Oceans - TARA_B100000586 (ERX556070-ERR599086)EnvironmentalOpen in IMG/M
3300020441Marine prokaryotic communities collected during Tara Oceans survey from station TARA_078 - TARA_B100000524 (ERX556088-ERR599006)EnvironmentalOpen in IMG/M
3300020447Marine microbial communities from Tara Oceans - TARA_B100000745 (ERX556090-ERR599159)EnvironmentalOpen in IMG/M
3300020449Marine microbial communities from Tara Oceans - TARA_B100001079 (ERX556008-ERR599020)EnvironmentalOpen in IMG/M
3300020454Marine microbial communities from Tara Oceans - TARA_B100001769 (ERX556037-ERR599170)EnvironmentalOpen in IMG/M
3300020463Marine microbial communities from Tara Oceans - TARA_B100001057 (ERX555988-ERR599050)EnvironmentalOpen in IMG/M
3300020470Marine microbial communities from Tara Oceans - TARA_B100000287 (ERX555976-ERR599053)EnvironmentalOpen in IMG/M
3300020471Marine microbial communities from Tara Oceans - TARA_B100000214 (ERX556063-ERR599002)EnvironmentalOpen in IMG/M
3300020474Marine prokaryotic communities collected during Tara Oceans survey from station TARA_151 - TARA_B100001564 (ERX555957-ERR598976)EnvironmentalOpen in IMG/M
3300020478Marine microbial communities from Tara Oceans - TARA_B100000029 (ERX556025-ERR599111)EnvironmentalOpen in IMG/M
3300020595Pelagic subsurface seawater microbial communities from Kabeltonne, Helgoland, North Sea - Helgoland_Spring_Bloom_20160412_1EnvironmentalOpen in IMG/M
3300021442Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M2 200m 12015EnvironmentalOpen in IMG/M
3300021959Estuarine water microbial communities from San Francisco Bay, California, United States - C33_13DEnvironmentalOpen in IMG/M
3300024264 (restricted)Seawater microbial communities from Saanich Inlet, British Columbia, Canada - SI_124_October2016_10_MGEnvironmentalOpen in IMG/M
3300025072Marine viral communities from the Subarctic Pacific Ocean - 19_ETSP_OMZ_AT15317 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025082Marine viral communities from the Subarctic Pacific Ocean - 1_ETSP_OMZ_AT15124 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025086Marine viral communities from the Subarctic Pacific Ocean - 5_ETSP_OMZ_AT15132 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025096Marine viral communities from the Subarctic Pacific Ocean - 7_ETSP_OMZ_AT15161 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025102Marine viral communities from the Subarctic Pacific Ocean - 5B_ETSP_OMZ_AT15132_CsCl metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025109Marine viral communities from the Subarctic Pacific Ocean - 6_ETSP_OMZ_AT15160 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025122Marine viral communities from the Pacific Ocean - ETNP_2_300 (SPAdes)EnvironmentalOpen in IMG/M
3300025125Marine viral communities from the Pacific Ocean - ETNP_2_1000 (SPAdes)EnvironmentalOpen in IMG/M
3300025127Marine viral communities from the Pacific Ocean - ETNP_2_30 (SPAdes)EnvironmentalOpen in IMG/M
3300025133Marine viral communities from the Subarctic Pacific Ocean - 15_ETSP_OMZ_AT15312 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025830Pelagic marine microbial communities from North Sea - COGITO_mtgs_110407 (SPAdes)EnvironmentalOpen in IMG/M
3300025890Pelagic Microbial community sample from North Sea - COGITO 998_met_08 (SPAdes)EnvironmentalOpen in IMG/M
3300025892Pelagic Microbial community sample from North Sea - COGITO 998_met_01 (SPAdes)EnvironmentalOpen in IMG/M
3300026193Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201306PF47B (SPAdes)EnvironmentalOpen in IMG/M
3300026259Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201406SV63 (SPAdes)EnvironmentalOpen in IMG/M
3300026263Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP2014F10-02SV255 (SPAdes)EnvironmentalOpen in IMG/M
3300026267Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP2014F12-01SV259 (SPAdes)EnvironmentalOpen in IMG/M
3300026279Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP2014F12-01SV261 (SPAdes)EnvironmentalOpen in IMG/M
3300026321Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201302SV91 (SPAdes)EnvironmentalOpen in IMG/M
3300027672Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG029-DNA (SPAdes)EnvironmentalOpen in IMG/M
3300027704Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG017-DNA (SPAdes)EnvironmentalOpen in IMG/M
3300027771Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG006-DNA (SPAdes)EnvironmentalOpen in IMG/M
3300027779Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB4_136 (SPAdes)EnvironmentalOpen in IMG/M
3300027801Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB8_128 (SPAdes)EnvironmentalOpen in IMG/M
3300027859Marine eukaryotic phytoplankton communities from Atlantic Ocean - South Atlantic ANT15 Metagenome (SPAdes)EnvironmentalOpen in IMG/M
3300028177Marine microbial communities from Saanich Inlet, British Columbia, Canada - SI106_120EnvironmentalOpen in IMG/M
3300028189Marine microbial communities from Saanich Inlet, British Columbia, Canada - SI060_135mEnvironmentalOpen in IMG/M
3300028190Marine microbial communities from Northeast Subartic Pacific Ocean, Canada - LP_J_2011_P26_1000mEnvironmentalOpen in IMG/M
3300028287Marine microbial communities from Saanich Inlet, British Columbia, Canada - SI060_120mEnvironmentalOpen in IMG/M
3300031644Marine microbial communities from water near the shore, Antarctic Ocean - #5EnvironmentalOpen in IMG/M
3300031695Marine microbial communities from water near the shore, Antarctic Ocean - #233EnvironmentalOpen in IMG/M
3300031696Marine microbial communities from Ellis Fjord, Antarctic Ocean - #262EnvironmentalOpen in IMG/M
3300031801Marine microbial communities from Western Arctic Ocean, Canada - CB27_Tmax_986EnvironmentalOpen in IMG/M
3300031886Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 200m 3416EnvironmentalOpen in IMG/M
3300032019Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 500m 21515EnvironmentalOpen in IMG/M
3300032048Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 500m 32315EnvironmentalOpen in IMG/M
3300032278Marine microbial communities from station ALOHA, North Pacific Subtropical Gyre - HC15-DNA-20-500_MGEnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Protein ID Sample Taxon ID Habitat Sequence
SI34jun09_150mDRAFT_103050723300000237MarineMTYYLLLDGDSEKDSLYETNVLGEVSFDTFYPSIGFMILSRII
JGI24005J15628_1015640223300001589MarineMTYYLLLSGDSEKDALYETNVLGEESFNTFYPSVGFMIYIE*
JGI24005J15628_1017720433300001589MarineMTYYLLLSGDSEKDTLYETNVLGEESFKTFYPSVGFIILNRIINQ
JGI25129J35166_107619023300002484MarineMTYYLLLKGDTEKDVIYETNVLGEESFETFYPSVGFMILQRILNQQPDIVKTIK
JGI25133J35611_1003936433300002514MarineMMYYLLLDDDTEKDAIYDTNVLGEESFGVFYPSVGFTAFNNIIRKHPDLVDNVK
Ga0055584_10169872213300004097Pelagic MarineMTYYLLLNGDTEKDVIYETNVLGEESFGVFYPSIGFNIMSKIINDR
Ga0066849_1004760933300005430MarineMTYYLLLSGDSEKDALYETNVLGEESFETFYPSVGFIILNRII
Ga0066850_1012928613300005605MarineMTYYLLLSGDSEKDALYDTNVLGEESFETFYPSVGFIILNRIINQQP
Ga0082015_105971923300006090MarineMTYYLLLEGDTEEDALYDTNILGEESFGTFYPSVGFMMLN
Ga0075447_1011964223300006191MarineMTYYLLLDGDTEKDALYDVNILGEESFETFYPSVGFIMLN
Ga0068469_125177113300006306MarineMTYYLLLKGDTEKDTLFETNVLGEESFETFYPSIGFTVLNKIINENP
Ga0068479_115293823300006309MarineMTYYLLLSGDSEKDALYETNVLGEESFETFYPSVGL*
Ga0068475_141694723300006318MarineMTYYLLLSGDSEKDALYETNVLGEESFETFYPSV*
Ga0068501_116521323300006325MarineMTYYLLLKGDTEKDVFYETNVLGEESFETFYPSVGFIILNRIIKILI
Ga0068502_187037423300006336MarineMTYYLLLDGDSEKDSLYETNVLGEESFETFYPSIGFIILNRIINDNPE
Ga0100228_125110823300006565MarineMTYYLLLKGDTEKDVLFETNVLGEESFETFYPSIGFMILQRILND
Ga0098058_107330123300006750MarineMTYYLLLENDTEEDALYDTNILGEESFGTFYPSVGFMMLNRI
Ga0098040_119029523300006751MarineMTYYLLLAGDTESDVIYDTNIMGEESFGVFYPSIGFHMFQRIVNQQPELVESIKILDEH
Ga0070747_111582613300007276AqueousMTYYLLLSGDSEKDSIYETNVLGEESFGVFYPSIGFNIMSKIINDRPELL
Ga0105020_128951223300007514MarineMTYYLLLQGDTEKDVFYETNVLGEESFEMFYPSIGFIILQR
Ga0098052_106396633300008050MarineMTYYLLLSGDSEKDSIYETNVLGEESFETFYPSVGFMIL
Ga0098052_116911723300008050MarineMTYYLLLSGDSEKDALYETNVLGEVSFETFYPSVGFMIL
Ga0114916_112722213300008221Deep OceanMTYYLLLSGDSEKDTLYETNVLGEESFKTFYPSVGFIILNRIINQQPELLES
Ga0115551_110807633300009193Pelagic MarineMTYYLLLSGDNEKDVIYETNVLGEESFGVFYPSIGFNIMSKIINDRP
Ga0114993_1060240913300009409MarineMTYYLLLEGDSEKDVIYETNVLGEESFNTFYPSVGFMILQRILNQRPDLIETI
Ga0115569_1047150223300009497Pelagic MarineMTYYLLLSGDSEKDSIYETNVLGEESFETFYPSVGFMILNRIINQKPELLESL
Ga0115011_1019398533300009593MarineMTYYLLLSGDSEKDALYETNVLGEESFDTFYPSVGFMILSRIINQQPELLE
Ga0115011_1210214223300009593MarineMTYYLLLSGDSEKDALYDTNVLGEESFETFYPSVGFIILNRIINQQPELLE
Ga0114933_1053410623300009703Deep SubsurfaceMTYYLLLSGDSERDALYETNVLGEESFETFYPSVGFIILNRIINQEPELLESLQI
Ga0115000_1001656073300009705MarineMTYYLLLSGDSEKDALYETNVLGEESFNTFYPSVGFMILHRI
Ga0115000_1043073023300009705MarineMTYYLLLSGDSEKDTLYETNVLGEESFKTFYPSVGFIILNRI
Ga0115002_1073099523300009706MarineMTYYLLLEGDTEKDALYDTNILGEESFETFYPSVGFMILHRI
Ga0115001_1067845423300009785MarineMTYYLLLDGDTEKDVIYETNVLGEESFGVFYPSIGFNIMSNIINNRPELLEDIRILD
Ga0114999_1046586723300009786MarineMTYYLLLDGDTEKDALYDVNILGEESFETFYPSAGFMILLRIINEKPELLE
Ga0115012_1066619023300009790MarineMTYYLLLSGDSEQDALYDTNVLGEESFETFYPSVGFMILNRIINQQPELLESLQILDEQ
Ga0115012_1100917613300009790MarineMTYYLLLEGDSEKDAIFETNVLGEESFGTFYTSVGFMILQRILNNNPEIIDRVKILDERK
Ga0098043_104336023300010148MarineMTYYLLLDGDTEKDVIYETNVLGEESFGVFYPAMGLGLLNKIIQDVEDDALLENIRI
Ga0098056_112215913300010150MarineMTYYLLLKGDTEKDVMYETNVLGEESFGVFYSSIGFKMLNMIINQRPELIEDIKILDEQKNY
Ga0098059_101590643300010153MarineMTYYLLLSGDTEKDSLYETNVLGEESFDTFYPSVGFMML
Ga0133547_1018863013300010883MarineMTYYLLLSGDSEKDALYETNVLGEESFNTFYPSVGFMILHRIIND
Ga0160423_1122105013300012920Surface SeawaterMTYYLLLDGDSEQDTLYDTNVLGEESFGTFYTSVGFMILQRILDNNPEII
Ga0163110_1080347723300012928Surface SeawaterMTYYLLLKGDTEKDAMFETNVLGEESFGVFYPSMGFQLLNRIIQDVESDEFLDKLDKWRIKKA*
Ga0163110_1173989323300012928Surface SeawaterMTYYLLLDGDTEKDVIYETNVLGEESFGVFYPAMGLGLLNKIIQD
Ga0181367_105138613300017703MarineMTTYYLLLEGDTEEDSFYETNVLGEESLGTFYPGQGF
Ga0181372_108287423300017705MarineMTYYLLLSGDSEKDSLYDTNVLGEESFETFYPSVGFMILSRIVNQQPELLEFSCLQSNSTTI
Ga0181417_115940513300017730SeawaterMTYYLLLDGDTEKDVIYETNVLGEESFGVFYPAMGLGLLNKIIQDVEDDALLEN
Ga0181416_112695623300017731SeawaterMTYYLLLNGDTEKDVIYETNVLGEESFGVFYPSMGLGLLNKIIQDVED
Ga0181416_115090013300017731SeawaterMTYYLLLDGDTEKDVIYETNVLGEESFGVFYPSMGLGLLNKIIQDVED
Ga0181428_115057013300017738SeawaterMTYYLLLDGDTEKDVIYETNVLGEESFGVFYPSMGLGLLNKIIQDVEDDALLE
Ga0181397_116471223300017744SeawaterMTYYLLLDGDTEKDVIYETNVLGEESFETFYPSVGFMILNRIVNQQPELLE
Ga0181423_113120823300017781SeawaterMTYYLLLDGDTEKDVIYETNVLGEESFGVFYPSMGLGLLNKIIQDVEDDALLEDIRILD
Ga0181379_113493223300017783SeawaterMTYYLLLNGDTEKDVIYETNVLGEESFGVFYPSIGFNIMSKIINDRPELLE
Ga0206127_119740433300020169SeawaterMTYYLLLSGDSEKDSIYETNVLGEESFETFYPSVGFMILNRIINQKPELL
Ga0211661_112251623300020333MarineMKYYLLLSGATEKDSIYETNVLGDESFGTFYPSVGFMILQRIVDQTPDVVESVKII
Ga0211477_1022521013300020374MarineMIYYLLLSGDEESDTIYEPNMIGEESFKVFYPALGFHLLNKIIN
Ga0211682_1002061113300020376MarineMTYYLLLNGDSEKDSLYETNVLGEESFDTFYPSVGFMILSRII
Ga0211521_1002707013300020428MarineMTYYLLLSGDSEKDTLYETNVLGEESFDTFYPSVGFMMLHRIINQQPELLESIQILDEQKKS
Ga0211521_1048467713300020428MarineMTYYLLLSGDSEKDALYDTNVLGEESFETFYPSVGFMILHRIINQQPELLESL
Ga0211639_1007992433300020435MarineMKYYLLLSGATEKDSIYETNVLGDESFGTFYPSVGFMILQRIVDQ
Ga0211695_1043326513300020441MarineMTYYLLLSGDSEKDSIYETNVLGEESFETFYPSVGFMILNRIIN
Ga0211691_1016625213300020447MarineMTYYLLLSGDSEEDALYDTNVLGEESFEMFYPEKGLVA
Ga0211642_1006756013300020449MarineMKYYLLLSGATEKDSIYETNVLGDESFGTFYPSVGFMILQRIVDQTPDVVESV
Ga0211548_1018071613300020454MarineMTYYLLLSGDSEKDSIYETNVLGEESFETFYPSVGFMILNRI
Ga0211676_1024312423300020463MarineMTYYLLLDGDTEKDVIYETNVLGEESFGVFYPAMGL
Ga0211543_1055802913300020470MarineMTYYLLLKGDTEKDVMFETNVLGEDSFGVFYPAMGFNVLHKIINQKPELME
Ga0211614_1018919223300020471MarineMIYYLLLSGDTEKDLVNETNILGEESFKVFYPSLGFNMLHKIINTKPELLE
Ga0211547_1020609633300020474MarineMTYYLLLKGDSEKDTMFETNVLGEESFGTFYTSVGFMILQR
Ga0211503_1065627623300020478MarineMTYYLLLSGDSEKDSLYETNVLGEESFETFYPSVGFIILNRIINQQPELLESLKILDDHKKSY
Ga0211503_1065678123300020478MarineMTYYLLLQGDTEKDVFYETNVLGEESFEMFYPSIGFIILQRIIDDKPEVLETVKILDERKNA
Ga0206126_1012911523300020595SeawaterMTYYLLLSGDSEEDALYETNVLGEESFKTFYPSVGFMILHRIINQQPELLESLQIIDEH
Ga0206685_1025589623300021442SeawaterMTYYLLLSGDSEKDALYDTNVLGEESFETFYPSVGFIILNRIINQQPEL
Ga0222716_1045683513300021959Estuarine WaterMTYYLLLDGDTEKDVIYETNVLGEESFGVFYPSMGLGLLNKIIQDVEDDAL
(restricted) Ga0233444_1009563113300024264SeawaterMTYYLLLDGDSEKDSLYETNVLGEVSFDTFYPSIGFMILSRIINQEPELLE
Ga0208920_108940223300025072MarineMTYYLLLEGDTEEDALYDTNILGEESFGTFYPSVGFMMLSRIIND
Ga0208156_103838523300025082MarineMTYYLLLEGDTEEDALYDTNILGEESFGTFYPSVGFMMLNRII
Ga0208157_107107113300025086MarineMTYYLLLSGDTEKDSLYETNVLGEESFDTFYPSVGFMMLHRIVNQKPELL
Ga0208011_101875313300025096MarineMTYYLLLKGDTEKDVFYETNVLGEESFETFYPSIGFIILN
Ga0208666_104810223300025102MarineMTYYLLLSGDTEKDSLYETNVLGEESFDTFYPSVGFM
Ga0208553_108682613300025109MarineMTYYLLLEGDTEEDALYDTNILGEESFGTFYPSVGFMMLSRIINDK
Ga0209434_103120113300025122MarineMTYYLLLEGDTEEDTLYDTNILGEVSFGTFYPSVGFMILQRIVDQTPDVVESVKIIDDQGNSHTIT
Ga0209644_106087823300025125MarineMTYYLLLKGDTEKDVFYETNVLGEESFETFYPSIGFIILNRIINDNPELVETIKILD
Ga0209348_122528623300025127MarineMTYYLLLKGDTEKDVIFDTNVLGEESFGVFYPSQGFNLLHKIINEKPELLEEIRIIDDHK
Ga0208299_105807123300025133MarineMTYYLLLSGDSEKDSIYETNVLGEESFETFYPSVGFMILNRIINQQPELL
Ga0209832_120183123300025830Pelagic MarineMTYYLLLNGDTEKDVIYETNVLGEESFGVFYPSIGFNIMSKIINDRPELLEDI
Ga0209631_1036135123300025890Pelagic MarineMTYYLLLNGDTEKDVIYETNVLGEESFGVFYPSIGFNIMSKIIN
Ga0209630_1040154613300025892Pelagic MarineMTYYLLLSGDNEKDVIYETNVLGEESFGVFYPSIGF
Ga0208129_110484923300026193MarineMTYYLLLENDTEEDALYDTNILGEESFGTFYPSVGF
Ga0208896_111782523300026259MarineMRYYLLLNNDSEKDTLYETNVLGEESFEVFYPEKGFIALRNIVHNQPELLESLQILD
Ga0207992_112774513300026263MarineMTYYLLLSGDSEKDSLYETNVLGEESFETFYPSVGFMIL
Ga0208278_102773813300026267MarineMIYYLLLKGDTEKDTIYETNVLGEESFEIFYPSIGFIMLNRIVKEKPEILET
Ga0208278_112596323300026267MarineMTYYLLLENDTEEDALYDTNILGEESFGTFYPSVGFMMLNR
Ga0208278_113293113300026267MarineMTYYLLLEGDTEEDALYDTNILGEESFGTFYPSVGFMMLNR
Ga0208411_108543113300026279MarineMTYYLLLSGDSEKDSLYETNVLGEESFETFYPSVGFMILSRIVNQQPELLESLQILDEQK
Ga0208411_112621723300026279MarineMTYYLLLEGDTEEDALYDTNILGEESFGTFYPSVGF
Ga0208764_1026765513300026321MarineMTYYLLLNGDSEKDALYETNVLGEESFETFYPSVGFIILNRIINQQPE
Ga0209383_101153053300027672MarineMTYYLLLSGDSEKDTLYETNVLGEESFKTFYPSVGFMILSRIINQQPE
Ga0209816_117848113300027704MarineMTYYLLLSGDSEKDTLYETNVLGEESFKTFYPSVGFM
Ga0209279_1002133443300027771MarineMTYYLLLSGDSEKDTLYETNVLGEESFKTFYPSVGFMILSRIINQQPELLESLQNKCFR
Ga0209709_1002036813300027779MarineMTYYLLLSGDSEKDALYETNVLGEESFNTFYPSVGFM
Ga0209709_1015365833300027779MarineMTYYLLLSGDSEKDTLYETNVLGEESFKTFYPSVGFIILNRIINQQ
Ga0209709_1017271313300027779MarineMTYYLLLDGDTEKDVIYETNVLGEESFEVFYPSIGFNIMSNIINNRPEL
Ga0209091_1001928773300027801MarineMTYYLLLSGDSEKDALYETNVLGEESFNTFYPSVGFMILHRIINDK
Ga0209503_1007234913300027859MarineMTYYLLLKGDSEKDTMFETNVLGEESFGTFYTSVGFMILQRILNDK
Ga0257122_115868513300028177MarineMTYYLLLDGDSEKDSLYETNVLGEVSFDTFYPSIGFMILSRIINQEPELLESL
Ga0257127_107212513300028189MarineMTYYLLLDGDSEKDSLYETNVLGEVSFDTFYPSIGFMILSRIINQEPELLESLRI
Ga0257108_116539723300028190MarineMTYYLLLEGDTEEDALYDTNILGEVSFGTFYPSIGFIMLNRIINEKPELLETIQILDEHKNSY
Ga0257126_119562113300028287MarineMTYYLLLDGDSEKDSLYETNVLGEVSFDTFYPSIGFMILSR
Ga0308001_1010560113300031644MarineMTYYLLLNGDSEKDSLYETNVLGEESFDTFYPSVGFMI
Ga0308016_1025721923300031695MarineMTYYLLLSGDSEKDTMYETNVLGEESFKTFYPSVGFIILNRIINQ
Ga0307995_126462223300031696MarineMTYYLLLSGDSEKDTLYETNVLGEESFKTFYPSVGFIILNRIIN
Ga0310121_1029930613300031801MarineMTYYLLLEGDTEEDALYDTNILGEESFGTFYPSAGFMILLRIIN
Ga0310121_1036676523300031801MarineMTYYLLLSGDSEKDAIYETNALGEESFETFYPSVGFMILHRIINQQPEL
Ga0315318_1020332833300031886SeawaterMTYYLLLAGDTESDVIYDTNIMGEESFGVFYPSIGFHMFQRI
Ga0315324_1026334423300032019SeawaterMTYYLLLEGDTEEDAMYDTNILGEVSFGTFYPSVGFMMLNRIINDKPELLETIQIL
Ga0315329_1069196123300032048SeawaterMTYYLLLSGDSEKDALYDTNVLGEESFEMFYPEKGLVALKNIVN
Ga0310345_1138431513300032278SeawaterMTYYLLLSGDSEKDSLYETNVLGEESFETFYPSIGFIILNRIINNNP
Ga0310345_1151260523300032278SeawaterMTYYLLLSGDSEKDALYDTNVLGEESFEMFYPEKGLVALKNIVNNQPELMESIQILDDHK

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.