NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F077533

Metagenome / Metatranscriptome Family F077533

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F077533
Family Type Metagenome / Metatranscriptome
Number of Sequences 117
Average Sequence Length 44 residues
Representative Sequence DADEAAYKVTGEHLHSEGERRKVRLRVRRLGNGSPPPKLFYAA
Number of Associated Samples 83
Number of Associated Scaffolds 117

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 2.56 %
% of genes near scaffold ends (potentially truncated) 95.73 %
% of genes from short scaffolds (< 2000 bps) 93.16 %
Associated GOLD sequencing projects 77
AlphaFold2 3D model prediction Yes
3D model pTM-score0.32

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (83.761 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil
(36.752 % of family members)
Environment Ontology (ENVO) Unclassified
(55.556 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(64.957 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 0.00%    β-sheet: 29.58%    Coil/Unstructured: 70.42%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  		pTM-score: 0.32
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 117 Family Scaffolds
PF04392ABC_sub_bind 4.27
PF00162PGK 1.71
PF02806Alpha-amylase_C 1.71
PF00589Phage_integrase 1.71
PF03401TctC 0.85
PF13439Glyco_transf_4 0.85
PF02922CBM_48 0.85
PF01546Peptidase_M20 0.85
PF01593Amino_oxidase 0.85
PF00118Cpn60_TCP1 0.85
PF07758DUF1614 0.85
PF11295DUF3096 0.85
PF02668TauD 0.85
PF00128Alpha-amylase 0.85
PF08448PAS_4 0.85
PF01594AI-2E_transport 0.85
PF00239Resolvase 0.85
PF05990DUF900 0.85
PF16655PhoD_N 0.85
PF06689zf-C4_ClpX 0.85
PF00753Lactamase_B 0.85

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 117 Family Scaffolds
COG2984ABC-type uncharacterized transport system, periplasmic componentGeneral function prediction only [R] 4.27
COG02961,4-alpha-glucan branching enzymeCarbohydrate transport and metabolism [G] 2.56
COG0366Glycosidase/amylase (phosphorylase)Carbohydrate transport and metabolism [G] 2.56
COG1523Pullulanase/glycogen debranching enzymeCarbohydrate transport and metabolism [G] 2.56
COG01263-phosphoglycerate kinaseCarbohydrate transport and metabolism [G] 1.71
COG0459Chaperonin GroEL (HSP60 family)Posttranslational modification, protein turnover, chaperones [O] 0.85
COG0628Predicted PurR-regulated permease PerMGeneral function prediction only [R] 0.85
COG1961Site-specific DNA recombinase SpoIVCA/DNA invertase PinEReplication, recombination and repair [L] 0.85
COG2175Taurine dioxygenase, alpha-ketoglutarate-dependentSecondary metabolites biosynthesis, transport and catabolism [Q] 0.85
COG2452Predicted site-specific integrase-resolvaseMobilome: prophages, transposons [X] 0.85
COG3181Tripartite-type tricarboxylate transporter, extracytoplasmic receptor component TctCEnergy production and conversion [C] 0.85
COG3280Maltooligosyltrehalose synthaseCarbohydrate transport and metabolism [G] 0.85
COG4089Uncharacterized membrane proteinFunction unknown [S] 0.85
COG4782Esterase/lipase superfamily enzymeGeneral function prediction only [R] 0.85

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms83.76 %
UnclassifiedrootN/A16.24 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300000597|AF_2010_repII_A1DRAFT_10011974All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium2394Open in IMG/M
3300000837|AP72_2010_repI_A100DRAFT_1022914All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria876Open in IMG/M
3300003505|JGIcombinedJ51221_10191484All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium830Open in IMG/M
3300004479|Ga0062595_102347431All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium527Open in IMG/M
3300005332|Ga0066388_101604952All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1145Open in IMG/M
3300005332|Ga0066388_104492702All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium710Open in IMG/M
3300005363|Ga0008090_14501303All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium512Open in IMG/M
3300005560|Ga0066670_10168596All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1294Open in IMG/M
3300005713|Ga0066905_101184293All Organisms → cellular organisms → Bacteria682Open in IMG/M
3300005764|Ga0066903_100796307All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1689Open in IMG/M
3300005764|Ga0066903_101564300All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1248Open in IMG/M
3300005764|Ga0066903_105066102All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria698Open in IMG/M
3300005764|Ga0066903_105120111All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium694Open in IMG/M
3300005764|Ga0066903_105476258All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium669Open in IMG/M
3300005764|Ga0066903_106673613All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium600Open in IMG/M
3300005764|Ga0066903_106900407All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium589Open in IMG/M
3300006032|Ga0066696_10324173All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1003Open in IMG/M
3300006176|Ga0070765_100481057All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1165Open in IMG/M
3300006797|Ga0066659_11304758All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium605Open in IMG/M
3300010046|Ga0126384_11178932All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium706Open in IMG/M
3300010047|Ga0126382_11029406All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium724Open in IMG/M
3300010048|Ga0126373_12732280All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium551Open in IMG/M
3300010366|Ga0126379_10131054All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Chromatiaceae → Nitrosococcus2298Open in IMG/M
3300010366|Ga0126379_10557655All Organisms → cellular organisms → Bacteria1226Open in IMG/M
3300010366|Ga0126379_10590070All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1195Open in IMG/M
3300010366|Ga0126379_11554747All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium767Open in IMG/M
3300010366|Ga0126379_11602305All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria756Open in IMG/M
3300010376|Ga0126381_102102937All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium813Open in IMG/M
3300010376|Ga0126381_102519916All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium737Open in IMG/M
3300010398|Ga0126383_10978676All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium934Open in IMG/M
3300010863|Ga0124850_1036489All Organisms → cellular organisms → Bacteria1567Open in IMG/M
3300012957|Ga0164303_10222044All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1062Open in IMG/M
3300012961|Ga0164302_11873484All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium509Open in IMG/M
3300012971|Ga0126369_11998435All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium668Open in IMG/M
3300012971|Ga0126369_12408818All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria612Open in IMG/M
3300012971|Ga0126369_12425997All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium610Open in IMG/M
3300012971|Ga0126369_13486823All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium515Open in IMG/M
3300012989|Ga0164305_10650822All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium854Open in IMG/M
3300012989|Ga0164305_12132658All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium514Open in IMG/M
3300016294|Ga0182041_10105599All Organisms → cellular organisms → Bacteria2080Open in IMG/M
3300016319|Ga0182033_10075551All Organisms → cellular organisms → Bacteria2391Open in IMG/M
3300016319|Ga0182033_10257833All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1420Open in IMG/M
3300016319|Ga0182033_10857939Not Available802Open in IMG/M
3300016357|Ga0182032_11418702All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium601Open in IMG/M
3300016387|Ga0182040_11853454All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium517Open in IMG/M
3300016404|Ga0182037_10745789Not Available841Open in IMG/M
3300016404|Ga0182037_11499450All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium598Open in IMG/M
3300016422|Ga0182039_10054180All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales2748Open in IMG/M
3300016422|Ga0182039_10968905All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium762Open in IMG/M
3300016445|Ga0182038_11018232All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria734Open in IMG/M
3300018431|Ga0066655_10485481All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium817Open in IMG/M
3300018482|Ga0066669_10587436All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium975Open in IMG/M
3300020579|Ga0210407_10581499All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium873Open in IMG/M
3300021168|Ga0210406_10608001All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium852Open in IMG/M
3300021171|Ga0210405_11398097All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium510Open in IMG/M
3300021432|Ga0210384_10308621All Organisms → cellular organisms → Bacteria → Proteobacteria1424Open in IMG/M
3300021475|Ga0210392_10663419All Organisms → cellular organisms → Bacteria → Proteobacteria775Open in IMG/M
3300021478|Ga0210402_11613728All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium575Open in IMG/M
3300021560|Ga0126371_11995965All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium698Open in IMG/M
3300025915|Ga0207693_10271396All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1329Open in IMG/M
3300025928|Ga0207700_11465513All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium606Open in IMG/M
3300027846|Ga0209180_10634663All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium587Open in IMG/M
3300031474|Ga0170818_100994247All Organisms → cellular organisms → Bacteria → Proteobacteria919Open in IMG/M
3300031546|Ga0318538_10753552Not Available528Open in IMG/M
3300031561|Ga0318528_10387446All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria750Open in IMG/M
3300031572|Ga0318515_10380919Not Available756Open in IMG/M
3300031573|Ga0310915_11046150All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium568Open in IMG/M
3300031573|Ga0310915_11121360All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium546Open in IMG/M
3300031679|Ga0318561_10539165All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium642Open in IMG/M
3300031681|Ga0318572_10508300Not Available718Open in IMG/M
3300031719|Ga0306917_10291688All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1258Open in IMG/M
3300031719|Ga0306917_10662590All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium820Open in IMG/M
3300031736|Ga0318501_10076310All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1630Open in IMG/M
3300031747|Ga0318502_10582622All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium673Open in IMG/M
3300031748|Ga0318492_10080416Not Available1575Open in IMG/M
3300031751|Ga0318494_10506930All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium703Open in IMG/M
3300031768|Ga0318509_10475553All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium699Open in IMG/M
3300031780|Ga0318508_1020148All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales1613Open in IMG/M
3300031782|Ga0318552_10460628Not Available649Open in IMG/M
3300031796|Ga0318576_10392473Not Available656Open in IMG/M
3300031805|Ga0318497_10362676All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium809Open in IMG/M
3300031835|Ga0318517_10117953All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1173Open in IMG/M
3300031835|Ga0318517_10274014All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium762Open in IMG/M
3300031879|Ga0306919_10671096All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium799Open in IMG/M
3300031879|Ga0306919_10802477Not Available723Open in IMG/M
3300031880|Ga0318544_10196308All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria779Open in IMG/M
3300031890|Ga0306925_11404235All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria688Open in IMG/M
3300031894|Ga0318522_10068892All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1277Open in IMG/M
3300031897|Ga0318520_10136251Not Available1412Open in IMG/M
3300031897|Ga0318520_10997531All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium529Open in IMG/M
3300031912|Ga0306921_11157683All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium863Open in IMG/M
3300031912|Ga0306921_11574014All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria715Open in IMG/M
3300031941|Ga0310912_10574048Not Available878Open in IMG/M
3300031942|Ga0310916_10065232Not Available2830Open in IMG/M
3300031942|Ga0310916_10803483Not Available792Open in IMG/M
3300031942|Ga0310916_11166474All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium638Open in IMG/M
3300031945|Ga0310913_10980158Not Available593Open in IMG/M
3300031946|Ga0310910_10556217Not Available910Open in IMG/M
3300031954|Ga0306926_10655310All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1277Open in IMG/M
3300031954|Ga0306926_10686635All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales1243Open in IMG/M
3300031959|Ga0318530_10348515Not Available613Open in IMG/M
3300031981|Ga0318531_10138944All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1085Open in IMG/M
3300032001|Ga0306922_11046278All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium840Open in IMG/M
3300032001|Ga0306922_11273570Not Available745Open in IMG/M
3300032010|Ga0318569_10419229All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium624Open in IMG/M
3300032035|Ga0310911_10700769Not Available586Open in IMG/M
3300032039|Ga0318559_10624900All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium502Open in IMG/M
3300032041|Ga0318549_10399383All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium619Open in IMG/M
3300032059|Ga0318533_10596446All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium810Open in IMG/M
3300032068|Ga0318553_10521294Not Available623Open in IMG/M
3300032076|Ga0306924_12470298All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium522Open in IMG/M
3300032089|Ga0318525_10135354All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1263Open in IMG/M
3300032261|Ga0306920_100029258All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria7830Open in IMG/M
3300032261|Ga0306920_100232045All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium2753Open in IMG/M
3300032261|Ga0306920_100473151All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1861Open in IMG/M
3300032261|Ga0306920_101019460All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1204Open in IMG/M
3300032261|Ga0306920_104422787All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales503Open in IMG/M


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil36.75%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil23.93%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil13.68%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil9.40%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil3.42%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil2.56%
Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil2.56%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil1.71%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere1.71%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil0.85%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil0.85%
Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil0.85%
SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Soil0.85%
Tropical Rainforest SoilEnvironmental → Terrestrial → Soil → Unclassified → Tropical Rainforest → Tropical Rainforest Soil0.85%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300000597Forest soil microbial communities from Amazon forest - 2010 replicate II A1EnvironmentalOpen in IMG/M
3300000837Forest soil microbial communities from Amazon forest - Pasture72 2010 replicate I A100EnvironmentalOpen in IMG/M
3300003505Forest soil microbial communities from Harvard Forest LTER, USA - Combined assembly of forest soil metaG samples (ASSEMBLY_DATE=20140924)EnvironmentalOpen in IMG/M
3300004479Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAsEnvironmentalOpen in IMG/M
3300005332Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300005363Tropical rainforest soil microbial communities from the Amazon Forest, Brazil, analyzing deforestation - Metatranscriptome F II A100 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300005560Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_119EnvironmentalOpen in IMG/M
3300005713Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2)EnvironmentalOpen in IMG/M
3300005764Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)EnvironmentalOpen in IMG/M
3300006032Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145EnvironmentalOpen in IMG/M
3300006176Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5EnvironmentalOpen in IMG/M
3300006797Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108EnvironmentalOpen in IMG/M
3300010046Tropical forest soil microbial communities from Panama - MetaG Plot_36EnvironmentalOpen in IMG/M
3300010047Tropical forest soil microbial communities from Panama - MetaG Plot_30EnvironmentalOpen in IMG/M
3300010048Tropical forest soil microbial communities from Panama - MetaG Plot_11EnvironmentalOpen in IMG/M
3300010366Tropical forest soil microbial communities from Panama - MetaG Plot_24EnvironmentalOpen in IMG/M
3300010376Tropical forest soil microbial communities from Panama - MetaG Plot_28EnvironmentalOpen in IMG/M
3300010398Tropical forest soil microbial communities from Panama - MetaG Plot_35EnvironmentalOpen in IMG/M
3300010863Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (PacBio error correction)EnvironmentalOpen in IMG/M
3300012957Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_207_MGEnvironmentalOpen in IMG/M
3300012961Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_202_MGEnvironmentalOpen in IMG/M
3300012971Tropical forest soil microbial communities from Panama - MetaG Plot_1EnvironmentalOpen in IMG/M
3300012989Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MGEnvironmentalOpen in IMG/M
3300016294Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178EnvironmentalOpen in IMG/M
3300016319Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00HEnvironmentalOpen in IMG/M
3300016357Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000EnvironmentalOpen in IMG/M
3300016387Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176EnvironmentalOpen in IMG/M
3300016404Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082EnvironmentalOpen in IMG/M
3300016422Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111EnvironmentalOpen in IMG/M
3300016445Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108EnvironmentalOpen in IMG/M
3300018431Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_104EnvironmentalOpen in IMG/M
3300018482Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118EnvironmentalOpen in IMG/M
3300020579Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-MEnvironmentalOpen in IMG/M
3300021168Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-MEnvironmentalOpen in IMG/M
3300021171Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-MEnvironmentalOpen in IMG/M
3300021432Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-MEnvironmentalOpen in IMG/M
3300021475Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-OEnvironmentalOpen in IMG/M
3300021478Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-MEnvironmentalOpen in IMG/M
3300021560Tropical forest soil microbial communities from Panama - MetaG Plot_4EnvironmentalOpen in IMG/M
3300025915Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025928Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300027846Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300031474Fir Coassembly Site 11 - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031546Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f23EnvironmentalOpen in IMG/M
3300031561Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f26EnvironmentalOpen in IMG/M
3300031572Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f19EnvironmentalOpen in IMG/M
3300031573Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN111EnvironmentalOpen in IMG/M
3300031679Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f23EnvironmentalOpen in IMG/M
3300031681Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f20EnvironmentalOpen in IMG/M
3300031719Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 (v2)EnvironmentalOpen in IMG/M
3300031736Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f21EnvironmentalOpen in IMG/M
3300031747Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f22EnvironmentalOpen in IMG/M
3300031748Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f22EnvironmentalOpen in IMG/M
3300031751Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f24EnvironmentalOpen in IMG/M
3300031768Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f22EnvironmentalOpen in IMG/M
3300031780Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f21EnvironmentalOpen in IMG/M
3300031782Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f20EnvironmentalOpen in IMG/M
3300031796Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f24EnvironmentalOpen in IMG/M
3300031805Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f23EnvironmentalOpen in IMG/M
3300031835Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f21EnvironmentalOpen in IMG/M
3300031879Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 (v2)EnvironmentalOpen in IMG/M
3300031880Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f25EnvironmentalOpen in IMG/M
3300031890Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2)EnvironmentalOpen in IMG/M
3300031894Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f18EnvironmentalOpen in IMG/M
3300031897Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f16EnvironmentalOpen in IMG/M
3300031912Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2)EnvironmentalOpen in IMG/M
3300031941Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX080EnvironmentalOpen in IMG/M
3300031942Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF176EnvironmentalOpen in IMG/M
3300031945Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX082EnvironmentalOpen in IMG/M
3300031946Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF172EnvironmentalOpen in IMG/M
3300031954Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2)EnvironmentalOpen in IMG/M
3300031959Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f24EnvironmentalOpen in IMG/M
3300031981Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f25EnvironmentalOpen in IMG/M
3300032001Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2)EnvironmentalOpen in IMG/M
3300032010Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f22EnvironmentalOpen in IMG/M
3300032035Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF170EnvironmentalOpen in IMG/M
3300032039Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f21EnvironmentalOpen in IMG/M
3300032041Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f22EnvironmentalOpen in IMG/M
3300032059Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f27EnvironmentalOpen in IMG/M
3300032068Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f21EnvironmentalOpen in IMG/M
3300032076Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2)EnvironmentalOpen in IMG/M
3300032089Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f23EnvironmentalOpen in IMG/M
3300032261Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2)EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
AF_2010_repII_A1DRAFT_1001197413300000597Forest SoilYKVTGEHLHSEGERRKVRLRVRRLGNGSPPPKLFYAA*
AP72_2010_repI_A100DRAFT_102291413300000837Forest SoilCDEEHARFVAAGDADEAAYKVAGEHLHSEGDRRRLRLRVRRLGNGSPPPKLFYAF*
JGIcombinedJ51221_1019148413300003505Forest SoilADEAAYKVTGIQLRSEGERRKIRLRVRRLGNGSPPPTLFYAE*
Ga0062595_10234743113300004479SoilEEEHARFVAAGDAEEAAYKVAGEQLHSEGDRRKLRLRVRRLGNGSPPPKLFYAS*
Ga0066388_10160495243300005332Tropical Forest SoilDEAAYKVTGEHLHSEGERRKVRVRVRRLGNGSPPPKVFYAA*
Ga0066388_10449270223300005332Tropical Forest SoilVNEFTSHCDEAAYKVTEEHLHSEGERRKVRLRVRRLGNGSPPPKLFYAA*
Ga0008090_1450130323300005363Tropical Rainforest SoilEQQDARFVAAEDADEAAYKVTKEHLHSEGERRKVRLRVRRLGNGSPPPKLFYAA*
Ga0066670_1016859613300005560SoilDEAAYKVTGEHLRSEGERRRVRLRVRRLGNGSAPPKLFYAA*
Ga0066905_10118429323300005713Tropical Forest SoilRQQSRVVAARDEEEAAYKVAGERLTRDGDRRKARLRVLRLGTGSPPPTVFYAA*
Ga0066903_10079630743300005764Tropical Forest SoilTGEHLHSEGERSKVRLRVRRLGNGSPPPKLFYAA*
Ga0066903_10156430013300005764Tropical Forest SoilAGEHLHIEGERRKVRLRVRRLGNGSPPPKLFYAA*
Ga0066903_10506610213300005764Tropical Forest SoilVTGEHLHSEGERSKVRLRVRRLGNGSPPPKLFYAA*
Ga0066903_10512011133300005764Tropical Forest SoilTGEHLHSEGERRKVRLRVRRLGNGSPPPKLFYAA*
Ga0066903_10547625833300005764Tropical Forest SoilYKVTGEHLQSEGERRKVRLRVRRLGNGSPSPKLFYAA*
Ga0066903_10667361323300005764Tropical Forest SoilAAGNADEAAYKVTGEHLHSEGERRKVRLRVRRLGNGSPPPKLFYAA*
Ga0066903_10690040713300005764Tropical Forest SoilVAARDADEAAYRVTGEHLHSEGERRKVRLRVRRLGNGSPPPKLFYAA*
Ga0066696_1032417323300006032SoilLAQRSSRTYARFVAAGDADEAAYKVAGEYLQSEGDRRKLRLRARRLGNGSPAPKLFYAS*
Ga0070765_10048105713300006176SoilVTGIQLRSEGERRKIRLRVRRLGNGSPPPTLFYAE*
Ga0066659_1130475823300006797SoilDADEAAYKVTGEHLRSEGERRKVRLRVRRLGNGGPPPKLFYAA*
Ga0126384_1117893213300010046Tropical Forest SoilVAAGDADEAAYKVTGEHLHSEGERRKVRLRVRRLGNGSPPPKLFYAA*
Ga0126382_1102940613300010047Tropical Forest SoilNADEAAYKVAGGHLQSEGERRKVRLRVRRLGNGSPSPKLFYAA*
Ga0126373_1273228013300010048Tropical Forest SoilTREHLHSEGERRKVRLRVRRLGNGSPPPKLFYAA*
Ga0126379_1013105443300010366Tropical Forest SoilVAARDADEAAYRVTGEHLHSEGERRKVRLRVRKLGNGSPPPKLFYAA*
Ga0126379_1055765523300010366Tropical Forest SoilQEARVVAARDADEAAYRVIGKHLRSEGERRKMRLRVHRLGNGSPPPKLFYAA*
Ga0126379_1059007013300010366Tropical Forest SoilVAATDADEAAYKVTREHLHSEGERRKVRLRVRRLGNGSPPPRLFYAA*
Ga0126379_1155474713300010366Tropical Forest SoilYKVTGGHLHSEGERRKVWLRVRRLGNGTPPPKLFYAA*
Ga0126379_1160230513300010366Tropical Forest SoilAYKVTGEHLHSEGERRKVRLRVRRLGNGSPPPKLFYAA*
Ga0126381_10210293713300010376Tropical Forest SoilADEAAYTVTGKHLRSEGERRKVRLRVRRLGIGSEPPKLFYAG*
Ga0126381_10251991613300010376Tropical Forest SoilRFVAARDADEAAYKVTGEHLRSEGERRKVRLRVRRLGNGSPPPRLFYAA*
Ga0126383_1097867633300010398Tropical Forest SoilIAARDADEAAYKVTGEHLHSEGERRKVRLRVRRLGNGSPPPKLFYAA*
Ga0124850_103648913300010863Tropical Forest SoilQGSNLHSEGERRKVRLRVRRLGNGSPPPKLFYAA*
Ga0164303_1022204413300012957SoilIVAARDANEAAYNVTGEHLRSQGERRKVRLRVRRLGNGSPPPKLFYTG*
Ga0164302_1187348413300012961SoilANEAAYNVTGEHLRSQGERRKVRLRVRRLGNGSPPPKLFYTG*
Ga0126369_1199843513300012971Tropical Forest SoilVRFVAAGDADEAAYKVTGEHLHSEGERSKVRLRVRRLGNGSPPPKLFYAA*
Ga0126369_1240881813300012971Tropical Forest SoilEAAYKVTGEHLHSEGERGKVRLRVRRLGNGSPPPKLFYAA*
Ga0126369_1242599713300012971Tropical Forest SoilDVRFVAARDADEAAYKVTGEHLHSEGERGKVRLRVRRLGNGSPPPKLFYAA*
Ga0126369_1348682323300012971Tropical Forest SoilAGDADEAAYRVTGEHLHSEGEHRKVRLRVRRLGNGSPPPKLFYAV*
Ga0164305_1065082213300012989SoilVAARDANEAAYNVTGEHLRSQGERRKVRLRVRRLGNGSPPPKLFYAG*
Ga0164305_1213265813300012989SoilVAARDANEAAYNVTGEHLRSQGERRKVRLRVRRLGNGSPPPKLFYTG*
Ga0182041_1010559913300016294SoilQQHARFVAARDADEAAYKVTGEHLRSEGERRKLRLRVKRLGNGSPPPKLFYAA
Ga0182033_1007555113300016319SoilDEAAYKVTGEHLRSEGERRKVRLRVRRLGTGSPPPKLFYAA
Ga0182033_1025783313300016319SoilRFVAARDADEAAYKVTGEHLHSDGERKKVRLRIRRLGNGSPPPKLFYAC
Ga0182033_1085793913300016319SoilDARFVAAGDADEAAYKVTGEHLHSEGERRKVRLRVRRLGNGSPPPKLFYAA
Ga0182032_1141870213300016357SoilEAAYRVAGQHLYSEGERRKVRLRVRRLGNGSPPPKLFYAA
Ga0182040_1185345413300016387SoilRNAEEAAYTVTGIHLRSEGERRKIRLRVRRLGNGSPPPMLFYAG
Ga0182037_1074578923300016404SoilAYRVIGKHLRSQGERRKMRLRVHRLGNGSPPPKLFYAG
Ga0182037_1149945013300016404SoilYNITGKHLRSEGEPRKVQLRVRRLGNGSPPPKLFYAA
Ga0182039_1005418093300016422SoilEMPTKPHTKVTGEHLHSDGERKKVRLRIRRLGNGSPPPKLFYAC
Ga0182039_1096890513300016422SoilMGVVAARDADEAAYRVTGEHLHSEGERRKVRLRVRRLGNGSPPPKLFYAA
Ga0182038_1101823223300016445SoilVAARDADEAAYKVTGEHLHSDGERKKVRLRIRRLGNGSPPPKLFYAC
Ga0066655_1048548113300018431Grasslands SoilWEQQDARFVAAGDAGEAAYKVARAHLHSEGDRRRIRLRVRRLGNGSPPPKLFYAS
Ga0066669_1058743613300018482Grasslands SoilRDEDDAAYKVTGEYLRKEGERKKVRLRVARLGNGSPPPTLFYAS
Ga0210407_1058149923300020579SoilARFVAARNADEAAYKVTGIQLRSEGERRKIRLRVRRLGNGSPPPTLFYAE
Ga0210406_1060800123300021168SoilKVTGIQLRSEGERRKIRLRVRRLGNGSPPPTLFYAE
Ga0210405_1139809713300021171SoilRQQDARFVAARNANEAAYNVTGEHLRSQGERRKVRLRVRRLGNGSPPPKLFYTG
Ga0210384_1030862123300021432SoilRNADEAAYKATGIQLRSEGERRKIRLRVRRLGNGSPPPTLFYAE
Ga0210392_1066341913300021475SoilAARDADEAAYKVTGEQLRSEGERRKVRLRVRRLGNGSPPPKLFYAA
Ga0210402_1161372813300021478SoilAARNADEAAYKATGIQLRSEGERRKIRLRVRRLGNGSPPPTLFYAE
Ga0126371_1199596513300021560Tropical Forest SoilDADEAAYKVTGEHLHSEGERRKVRLRVRRLGNGSPPPKLFYAA
Ga0207693_1027139613300025915Corn, Switchgrass And Miscanthus RhizosphereAAYNVTGEHLRSQGERRKVRLRVRRLGNGSPPPKLFYAG
Ga0207700_1146551313300025928Corn, Switchgrass And Miscanthus RhizosphereRDANEAAYNVTGEHLRSQGERRKVRLRVRRLGNGSPPPKLFYAG
Ga0209180_1063466313300027846Vadose Zone SoilDEDEAAYKVTGERLRKEGERRKIRLRVVRLGNGSPPPTLFYAA
Ga0170818_10099424713300031474Forest SoilAYKVTGEQLRSEGERRKVRLRVRRLGNGSPPPKLFYAA
Ga0318538_1075355223300031546SoilKVTGEHLHSEGGRRKVRLRVRRLGNGSPPPKLFYAA
Ga0318528_1038744623300031561SoilRDADEAAYKVTGEHLHSEGERGKVRLRVRRLGNGSPPPKLFYAA
Ga0318515_1038091913300031572SoilYKVTGEHLHSEGEQRKVRLRVRRLGNGSPPPKLFYAA
Ga0310915_1104615013300031573SoilEAAYRVAGQHLYSEGERRKVRLRVRRLGNGIPPPKLFYAV
Ga0310915_1112136013300031573SoilFVAARDADEAAYKVTGEHLRSEGERKKLRLRVKRLGNGSPPPKLFYAA
Ga0318561_1053916513300031679SoilADEAAYKVTGEQLHSEGERRKVRLRVRRLGNGSPPPKLFYAA
Ga0318572_1050830013300031681SoilDEDEAAYKVTGEHLSKQGERRKVRVRVVRLGNGSPPPTLYYAT
Ga0306917_1029168813300031719SoilEQQHARFVAARDADEAAYKVTGEHLRSEGERRKVRLRVKRLGNGSPPPKLFYAA
Ga0306917_1066259013300031719SoilYKVTGEHLHSEGERRKVRLRVRRLGNGSPPPKLFYAA
Ga0318501_1007631043300031736SoilKVTGEHLHSDGERKKVRLRIRRLGNGSPPPKLFYAC
Ga0318502_1058262213300031747SoilVAARDADEAAYRVTGKHLRSEGERRKMRLRVHRLGNGSPPPKLFYAG
Ga0318492_1008041613300031748SoilDEAAYKVTGEHLHSEGEQRKVRLRVRRLGNGSPPPKLFYAA
Ga0318494_1050693013300031751SoilQDARFVAARDADEAAYKVTGEHLHSEGEQRKVRLRVRRLGNGSPSPKLFYAA
Ga0318509_1047555313300031768SoilFVAARDADEAAYKVTGEHLHSEGEQRKVRLRVRRLGNGSPSPKLFYAA
Ga0318508_102014813300031780SoilHEAAYKVTGEHLHSEGEQRKVRLRVRRLGNGSPPPKLFYAA
Ga0318552_1046062813300031782SoilYKVTGEQLHSEGERRKVRLRVRRLGNGSPPPKLFYAA
Ga0318576_1039247313300031796SoilADEAAYKVTGEHLHSEGGRRKVRLRVRRLGNGSPPPKLFYAA
Ga0318497_1036267623300031805SoilARFVAARDADEAAYKVTGEHLHSEGERRQVRLRVRRLGNGSPPPKLFYAA
Ga0318517_1011795333300031835SoilEAAYKVTGEHLHSEGERRQVRLRVRRLGNGSPAPKLFYAA
Ga0318517_1027401433300031835SoilVTGEQLHSEGERRKVRLRVRRLGNGSPPPKLFYAA
Ga0306919_1067109623300031879SoilFVAARDADEAAYKVTGEHLRSEGERRKLRLRVKRLGNGSPPPKLFYAA
Ga0306919_1080247733300031879SoilAARDADEVAYKVTREHLHSEGEPRKVRLRVRRLGNGSPPPKLFYAA
Ga0318544_1019630833300031880SoilYKVTGERLHSEGERGKVRLRVRRLGNGSPPPKLFYAA
Ga0306925_1140423533300031890SoilELQRARFVAARDADEAAYKVTGEHLRSEGERKKLRLRVKRLGNGSPPPKLFYAA
Ga0318522_1006889213300031894SoilVAARDADEAAYKVTGEQLHSEGERRKVRLRVRRLGNGSPPPKLFYAA
Ga0318520_1013625113300031897SoilAYKVTGEHLRSEGEFRKVRLRVRRLGNGSPPAKLFYTA
Ga0318520_1099753123300031897SoilDEAAYKVTGEYLHSDGERRKVRLRVRRLGNGSPPPKLFYAA
Ga0306921_1115768323300031912SoilVNEFTSHCDEAAYKVTEEHLHSEGERRKVRLRVRRLGNGSPPPKLFYAA
Ga0306921_1157401413300031912SoilADEAAYKVAGEHLHIEGERRKVRLRVRRLGNGSPPPKLFYAA
Ga0310912_1057404823300031941SoilDEAAYRVIGKHLRSQGERRKMRLRVHRLGNGSPPPKLFYAG
Ga0310916_1006523243300031942SoilHARFVAARDADEAAYKVTGEHLRSEGERRKLRLRVKRLGNGSPPPKLFYAA
Ga0310916_1080348313300031942SoilDEAAYKVTGEHLSKQGERRKVRVRVVRLGNGSPPPTLYYAT
Ga0310916_1116647413300031942SoilEQQHARFVAARDADEAAYKVTGEHLRSEGERRKLRLRVKRLGNGGPPPKLFYAA
Ga0310913_1098015813300031945SoilFSAARDADEAAYKVTGEHLRSEGERKKLRLRVKRLGNGSPPPKLFYAA
Ga0310910_1055621713300031946SoilDADEAAYKVTGEHLHSEGERRKIRLRIRRLGNGSPPPKLFYAC
Ga0306926_1065531023300031954SoilLPPWPLGAADARFVAASDAAEAAYKVTGEHLHSEGERRKVRLRVRRLGNGSPPPKLFYAA
Ga0306926_1068663513300031954SoilKVTGEHLHREGERRKVRLRVRRLGNGSPPPKLFYAA
Ga0318530_1034851513300031959SoilFVAARDADEAAYKVTGEHLHSEGGRRKVRLRVRRLGNGSPPPKLFYAA
Ga0318531_1013894413300031981SoilYKVTGEYLHSDGERRKVRLRVRRLGNGSPPPKLFYAA
Ga0306922_1104627833300032001SoilYARFVAAKDADEAAYKVTGEHLRSEGNRRNVRLRVRRLGNGSPPPKLFYAA
Ga0306922_1127357013300032001SoilNEAAYRVIGKHLRSQGERRKMRLRVHRLGNGSPLPKLFYAG
Ga0318569_1041922913300032010SoilARDADEAAYKVTGEQLHSEGERRKVRLRVRRLGNGSPPPKLFYAA
Ga0310911_1070076913300032035SoilEQQDARFVAAGDADEAAYKVTGEHLHSEGERRKVRLRVRRLGNGSPPPKLFYAA
Ga0318559_1062490013300032039SoilYKVTEEHLHSEGERRKVRLRVRRLGNGSPPPKLFYAA
Ga0318549_1039938313300032041SoilVTGEHLHSEGEQRKVRLRVRRLGNGSPSPKLFYAA
Ga0318533_1059644623300032059SoilQDARFVAARDADEAAYKVTGEHLHGEGERRQVRLRVRRLGNGSPPPKLFYAA
Ga0318553_1052129413300032068SoilARDADEVAYKVTREHLHSEGEPRKVRLRVRRLGNGSPPPKLFYAA
Ga0306924_1247029813300032076SoilYKVTGEHLQSEGERRKVRLRVRRLGNGSPSPKLFYAA
Ga0318525_1013535413300032089SoilYKVTGEHLHSEGERRQVRLRVRRLGNGSPPPKLFYAA
Ga0306920_100029258163300032261SoilDARFVAARDADEAAYKVTGEHLHSDGERKKVRLRIRRLGNGSPPPKLFYAC
Ga0306920_10023204513300032261SoilWEQQDVRFVAARDADEAAYKVTGEHLHSEGERRKVRLRVRRLGNGSPPPKLFYAA
Ga0306920_10047315113300032261SoilWRVVAARDEDEAAYKVTGEHLSKQGERRKVRVRVVRLGNGSPPPTLYYAT
Ga0306920_10101946033300032261SoilQHARFVAARDADEAAYKVTGEHLRSEGERRKVRLRVKRLGNGSPPPKLFYAA
Ga0306920_10442278723300032261SoilFVAAVNADEAAYKVTGEHLQSEGERRKVRLRVRRLGNGSPSPKLFYAA

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.