Basic Information | |
---|---|
Family ID | F077548 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 117 |
Average Sequence Length | 38 residues |
Representative Sequence | GDEIVVGSYKALRTLKPESSVKVDNSAPKKQDDQQS |
Number of Associated Samples | 101 |
Number of Associated Scaffolds | 117 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Unclassified |
% of genes with valid RBS motifs | 0.86 % |
% of genes near scaffold ends (potentially truncated) | 96.58 % |
% of genes from short scaffolds (< 2000 bps) | 89.74 % |
Associated GOLD sequencing projects | 96 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.21 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Unclassified (58.120 % of family members) |
NCBI Taxonomy ID | N/A |
Taxonomy | N/A |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (23.077 % of family members) |
Environment Ontology (ENVO) | Unclassified (31.624 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (58.974 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 0.00% β-sheet: 0.00% Coil/Unstructured: 100.00% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.21 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 117 Family Scaffolds |
---|---|---|
PF00005 | ABC_tran | 84.62 |
PF00282 | Pyridoxal_deC | 5.98 |
PF06271 | RDD | 5.13 |
PF02146 | SIR2 | 0.85 |
PF01960 | ArgJ | 0.85 |
PF08402 | TOBE_2 | 0.85 |
PF00515 | TPR_1 | 0.85 |
PF12704 | MacB_PCD | 0.85 |
COG ID | Name | Functional Category | % Frequency in 117 Family Scaffolds |
---|---|---|---|
COG0076 | Glutamate or tyrosine decarboxylase or a related PLP-dependent protein | Amino acid transport and metabolism [E] | 5.98 |
COG1714 | Uncharacterized membrane protein YckC, RDD family | Function unknown [S] | 5.13 |
COG0846 | NAD-dependent protein deacetylase, SIR2 family | Posttranslational modification, protein turnover, chaperones [O] | 0.85 |
COG1364 | Glutamate N-acetyltransferase (ornithine transacetylase) | Amino acid transport and metabolism [E] | 0.85 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
Unclassified | root | N/A | 58.12 % |
All Organisms | root | All Organisms | 41.88 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300003352|JGI26345J50200_1039882 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 527 | Open in IMG/M |
3300004080|Ga0062385_11208728 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 517 | Open in IMG/M |
3300004092|Ga0062389_100196277 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1976 | Open in IMG/M |
3300005546|Ga0070696_101025006 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 691 | Open in IMG/M |
3300005569|Ga0066705_10802949 | Not Available | 561 | Open in IMG/M |
3300005575|Ga0066702_10398099 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 840 | Open in IMG/M |
3300005602|Ga0070762_10473012 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 818 | Open in IMG/M |
3300005602|Ga0070762_10634894 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 712 | Open in IMG/M |
3300005602|Ga0070762_11247669 | Not Available | 515 | Open in IMG/M |
3300006050|Ga0075028_101055280 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 508 | Open in IMG/M |
3300006086|Ga0075019_10962313 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 550 | Open in IMG/M |
3300006176|Ga0070765_100187144 | All Organisms → cellular organisms → Bacteria | 1872 | Open in IMG/M |
3300006804|Ga0079221_10517473 | Not Available | 779 | Open in IMG/M |
3300006806|Ga0079220_11883564 | Not Available | 530 | Open in IMG/M |
3300006854|Ga0075425_102271208 | Not Available | 603 | Open in IMG/M |
3300006893|Ga0073928_11016421 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 564 | Open in IMG/M |
3300007258|Ga0099793_10098301 | Not Available | 1352 | Open in IMG/M |
3300009090|Ga0099827_11238032 | Not Available | 649 | Open in IMG/M |
3300009624|Ga0116105_1163118 | Not Available | 597 | Open in IMG/M |
3300009792|Ga0126374_10152236 | All Organisms → cellular organisms → Bacteria | 1403 | Open in IMG/M |
3300010048|Ga0126373_13109377 | Not Available | 517 | Open in IMG/M |
3300010360|Ga0126372_11530389 | Not Available | 704 | Open in IMG/M |
3300010376|Ga0126381_100038401 | All Organisms → cellular organisms → Bacteria | 5786 | Open in IMG/M |
3300010379|Ga0136449_102768462 | Not Available | 693 | Open in IMG/M |
3300010379|Ga0136449_104126954 | Not Available | 540 | Open in IMG/M |
3300010858|Ga0126345_1268443 | Not Available | 608 | Open in IMG/M |
3300011120|Ga0150983_10578839 | Not Available | 1102 | Open in IMG/M |
3300011120|Ga0150983_10938986 | Not Available | 675 | Open in IMG/M |
3300012205|Ga0137362_10299545 | Not Available | 1392 | Open in IMG/M |
3300012361|Ga0137360_10942937 | Not Available | 744 | Open in IMG/M |
3300012362|Ga0137361_10507611 | Not Available | 1107 | Open in IMG/M |
3300012389|Ga0134040_1304919 | Not Available | 1225 | Open in IMG/M |
3300012685|Ga0137397_10338053 | Not Available | 1122 | Open in IMG/M |
3300012918|Ga0137396_10170508 | All Organisms → cellular organisms → Bacteria | 1591 | Open in IMG/M |
3300012948|Ga0126375_10686448 | Not Available | 795 | Open in IMG/M |
3300012964|Ga0153916_11306830 | Not Available | 803 | Open in IMG/M |
3300012971|Ga0126369_10695386 | Not Available | 1094 | Open in IMG/M |
3300014169|Ga0181531_10060985 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2214 | Open in IMG/M |
3300015053|Ga0137405_1035021 | Not Available | 731 | Open in IMG/M |
3300015053|Ga0137405_1277248 | Not Available | 736 | Open in IMG/M |
3300015054|Ga0137420_1005267 | Not Available | 738 | Open in IMG/M |
3300015054|Ga0137420_1336760 | All Organisms → cellular organisms → Bacteria | 3361 | Open in IMG/M |
3300015054|Ga0137420_1477225 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 5309 | Open in IMG/M |
3300015168|Ga0167631_1053268 | Not Available | 664 | Open in IMG/M |
3300015241|Ga0137418_10354518 | All Organisms → cellular organisms → Bacteria | 1210 | Open in IMG/M |
3300015372|Ga0132256_102731664 | Not Available | 593 | Open in IMG/M |
3300016270|Ga0182036_10192413 | All Organisms → cellular organisms → Bacteria | 1489 | Open in IMG/M |
3300016294|Ga0182041_11121431 | Not Available | 715 | Open in IMG/M |
3300017928|Ga0187806_1107285 | All Organisms → cellular organisms → Bacteria | 896 | Open in IMG/M |
3300017932|Ga0187814_10069830 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1289 | Open in IMG/M |
3300017961|Ga0187778_10160689 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → unclassified Acidobacteriaceae → Acidobacteriaceae bacterium URHE0068 | 1420 | Open in IMG/M |
3300017975|Ga0187782_10047160 | All Organisms → cellular organisms → Bacteria | 3137 | Open in IMG/M |
3300018088|Ga0187771_10752960 | All Organisms → cellular organisms → Bacteria | 826 | Open in IMG/M |
3300018431|Ga0066655_10081888 | All Organisms → cellular organisms → Bacteria | 1760 | Open in IMG/M |
3300020579|Ga0210407_10232024 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1436 | Open in IMG/M |
3300020581|Ga0210399_11370149 | Not Available | 554 | Open in IMG/M |
3300020582|Ga0210395_10702293 | Not Available | 756 | Open in IMG/M |
3300020583|Ga0210401_11071678 | Not Available | 664 | Open in IMG/M |
3300021088|Ga0210404_10426851 | Not Available | 743 | Open in IMG/M |
3300021168|Ga0210406_10563190 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 894 | Open in IMG/M |
3300021170|Ga0210400_10802841 | Not Available | 771 | Open in IMG/M |
3300021171|Ga0210405_10697755 | Not Available | 784 | Open in IMG/M |
3300021180|Ga0210396_10320077 | All Organisms → cellular organisms → Bacteria | 1371 | Open in IMG/M |
3300021180|Ga0210396_10669249 | Not Available | 898 | Open in IMG/M |
3300021181|Ga0210388_11060962 | Not Available | 693 | Open in IMG/M |
3300021405|Ga0210387_11297335 | Not Available | 629 | Open in IMG/M |
3300021432|Ga0210384_11611097 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 555 | Open in IMG/M |
3300021475|Ga0210392_10038184 | All Organisms → cellular organisms → Bacteria | 2879 | Open in IMG/M |
3300021479|Ga0210410_10166706 | All Organisms → cellular organisms → Bacteria | 1967 | Open in IMG/M |
3300021479|Ga0210410_10875333 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 785 | Open in IMG/M |
3300021479|Ga0210410_11435472 | Not Available | 583 | Open in IMG/M |
3300021559|Ga0210409_10205514 | All Organisms → cellular organisms → Bacteria | 1792 | Open in IMG/M |
3300023056|Ga0233357_1037779 | Not Available | 610 | Open in IMG/M |
3300023250|Ga0224544_1019376 | Not Available | 938 | Open in IMG/M |
3300025905|Ga0207685_10113095 | All Organisms → cellular organisms → Bacteria | 1180 | Open in IMG/M |
3300025905|Ga0207685_10344441 | Not Available | 750 | Open in IMG/M |
3300025915|Ga0207693_11283949 | Not Available | 548 | Open in IMG/M |
3300026335|Ga0209804_1028720 | All Organisms → cellular organisms → Bacteria | 2833 | Open in IMG/M |
3300026354|Ga0257180_1011130 | Not Available | 1081 | Open in IMG/M |
3300026469|Ga0257169_1026989 | Not Available | 843 | Open in IMG/M |
3300026498|Ga0257156_1081177 | Not Available | 673 | Open in IMG/M |
3300026551|Ga0209648_10220602 | All Organisms → cellular organisms → Bacteria | 1429 | Open in IMG/M |
3300026551|Ga0209648_10533703 | Not Available | 662 | Open in IMG/M |
3300027034|Ga0209730_1019626 | Not Available | 719 | Open in IMG/M |
3300027104|Ga0208095_1002616 | All Organisms → cellular organisms → Bacteria | 1182 | Open in IMG/M |
3300027439|Ga0209332_1101912 | Not Available | 514 | Open in IMG/M |
3300027603|Ga0209331_1160926 | Not Available | 529 | Open in IMG/M |
3300027729|Ga0209248_10241761 | Not Available | 527 | Open in IMG/M |
3300027846|Ga0209180_10496006 | Not Available | 684 | Open in IMG/M |
3300027875|Ga0209283_10582305 | Not Available | 711 | Open in IMG/M |
3300027882|Ga0209590_10010885 | All Organisms → cellular organisms → Bacteria | 4253 | Open in IMG/M |
3300027898|Ga0209067_10005033 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → Rhodoferax → Rhodoferax saidenbachensis | 7378 | Open in IMG/M |
3300027902|Ga0209048_10261131 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1229 | Open in IMG/M |
3300028047|Ga0209526_10090415 | All Organisms → cellular organisms → Bacteria | 2156 | Open in IMG/M |
3300028145|Ga0247663_1018983 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1024 | Open in IMG/M |
3300028380|Ga0268265_11257701 | Not Available | 739 | Open in IMG/M |
3300028747|Ga0302219_10237032 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 706 | Open in IMG/M |
3300028780|Ga0302225_10464449 | Not Available | 592 | Open in IMG/M |
3300028800|Ga0265338_10450771 | Not Available | 911 | Open in IMG/M |
3300029636|Ga0222749_10340449 | Not Available | 783 | Open in IMG/M |
3300031128|Ga0170823_10888933 | Not Available | 871 | Open in IMG/M |
3300031545|Ga0318541_10029767 | All Organisms → cellular organisms → Bacteria | 2696 | Open in IMG/M |
3300031719|Ga0306917_11475488 | Not Available | 524 | Open in IMG/M |
3300031720|Ga0307469_10172433 | Not Available | 1652 | Open in IMG/M |
3300031720|Ga0307469_10438153 | Not Available | 1127 | Open in IMG/M |
3300031720|Ga0307469_10911916 | Not Available | 815 | Open in IMG/M |
3300031720|Ga0307469_12223606 | Not Available | 534 | Open in IMG/M |
3300031754|Ga0307475_10598877 | Not Available | 882 | Open in IMG/M |
3300031896|Ga0318551_10892351 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 519 | Open in IMG/M |
3300032035|Ga0310911_10704403 | Not Available | 585 | Open in IMG/M |
3300032160|Ga0311301_12423128 | Not Available | 591 | Open in IMG/M |
3300032174|Ga0307470_10184500 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1316 | Open in IMG/M |
3300032261|Ga0306920_102504978 | Not Available | 710 | Open in IMG/M |
3300032828|Ga0335080_10589230 | All Organisms → cellular organisms → Bacteria | 1171 | Open in IMG/M |
3300032955|Ga0335076_10203916 | All Organisms → cellular organisms → Bacteria | 1880 | Open in IMG/M |
3300032955|Ga0335076_10269300 | All Organisms → cellular organisms → Bacteria | 1596 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 23.08% |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 13.68% |
Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 5.98% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 5.13% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 5.13% |
Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 3.42% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 3.42% |
Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 3.42% |
Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 3.42% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 3.42% |
Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 2.56% |
Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 2.56% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 2.56% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 2.56% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 2.56% |
Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 1.71% |
Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 1.71% |
Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 1.71% |
Freshwater Lake Sediment | Environmental → Aquatic → Freshwater → Lentic → Sediment → Freshwater Lake Sediment | 0.85% |
Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 0.85% |
Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 0.85% |
Freshwater Wetlands | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands | 0.85% |
Iron-Sulfur Acid Spring | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring | 0.85% |
Glacier Forefield Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soil | 0.85% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 0.85% |
Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 0.85% |
Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Soil | 0.85% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.85% |
Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 0.85% |
Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere | 0.85% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 0.85% |
Boreal Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil | 0.85% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300003352 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP14_OM1 | Environmental | Open in IMG/M |
3300004080 | Coassembly of ECP04_OM1, ECP04_OM2, ECP04_OM3 | Environmental | Open in IMG/M |
3300004092 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3, ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Environmental | Open in IMG/M |
3300005569 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_154 | Environmental | Open in IMG/M |
3300005575 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_151 | Environmental | Open in IMG/M |
3300005602 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 | Environmental | Open in IMG/M |
3300006050 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2014 | Environmental | Open in IMG/M |
3300006086 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2013 | Environmental | Open in IMG/M |
3300006176 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 | Environmental | Open in IMG/M |
3300006804 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 | Environmental | Open in IMG/M |
3300006806 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 | Environmental | Open in IMG/M |
3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
3300006893 | Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPA 5.5 metaG | Environmental | Open in IMG/M |
3300007258 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3 | Environmental | Open in IMG/M |
3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
3300009624 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_10 | Environmental | Open in IMG/M |
3300009792 | Tropical forest soil microbial communities from Panama - MetaG Plot_12 | Environmental | Open in IMG/M |
3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
3300010379 | Sb_50d combined assembly | Environmental | Open in IMG/M |
3300010858 | Boreal forest soil eukaryotic communities from Alaska, USA - C3-2 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
3300011120 | Combined assembly of Microbial Forest Soil metaT | Environmental | Open in IMG/M |
3300012205 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG | Environmental | Open in IMG/M |
3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
3300012362 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG | Environmental | Open in IMG/M |
3300012389 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_20cm_5_16_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300012685 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz1.16 metaG | Environmental | Open in IMG/M |
3300012918 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaG | Environmental | Open in IMG/M |
3300012948 | Tropical forest soil microbial communities from Panama - MetaG Plot_14 | Environmental | Open in IMG/M |
3300012964 | Freshwater wetland microbial communities from Ohio, USA - Open water 3 Core 3 Depth 4 metaG | Environmental | Open in IMG/M |
3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
3300014169 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin11_10_metaG | Environmental | Open in IMG/M |
3300015053 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
3300015054 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
3300015168 | Arctic soil microbial communities from a glacier forefield, Russell Glacier, Kangerlussuaq, Greenland (Sample G4A, Ice margin, adjacent to proglacial lake) | Environmental | Open in IMG/M |
3300015241 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
3300016270 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 | Environmental | Open in IMG/M |
3300016294 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 | Environmental | Open in IMG/M |
3300017928 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_1 | Environmental | Open in IMG/M |
3300017932 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW-S_4 | Environmental | Open in IMG/M |
3300017961 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_20_MG | Environmental | Open in IMG/M |
3300017975 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
3300018086 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_10_MG | Environmental | Open in IMG/M |
3300018088 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_10_MG | Environmental | Open in IMG/M |
3300018431 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_104 | Environmental | Open in IMG/M |
3300020579 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-M | Environmental | Open in IMG/M |
3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
3300020582 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-O | Environmental | Open in IMG/M |
3300020583 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-M | Environmental | Open in IMG/M |
3300021088 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-M | Environmental | Open in IMG/M |
3300021168 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-M | Environmental | Open in IMG/M |
3300021170 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-M | Environmental | Open in IMG/M |
3300021171 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-M | Environmental | Open in IMG/M |
3300021180 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-O | Environmental | Open in IMG/M |
3300021181 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-O | Environmental | Open in IMG/M |
3300021405 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-O | Environmental | Open in IMG/M |
3300021432 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M | Environmental | Open in IMG/M |
3300021475 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-O | Environmental | Open in IMG/M |
3300021479 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-M | Environmental | Open in IMG/M |
3300021559 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-M | Environmental | Open in IMG/M |
3300023056 | Soil microbial communities from Shasta-Trinity National Forest, California, United States - GEON-SFM-MS2 | Environmental | Open in IMG/M |
3300023250 | Peat soil microbial communities from Stordalen Mire, Sweden - 717 P1 10-14 | Environmental | Open in IMG/M |
3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) | Environmental | Open in IMG/M |
3300026335 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_139 (SPAdes) | Environmental | Open in IMG/M |
3300026354 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NR-04-B | Environmental | Open in IMG/M |
3300026469 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DL-17-B | Environmental | Open in IMG/M |
3300026498 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NI-49-A | Environmental | Open in IMG/M |
3300026551 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cm (SPAdes) | Environmental | Open in IMG/M |
3300027034 | Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_RefH0_M2 (SPAdes) | Environmental | Open in IMG/M |
3300027104 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF024 (SPAdes) | Environmental | Open in IMG/M |
3300027439 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM3_M1 (SPAdes) | Environmental | Open in IMG/M |
3300027603 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM3H0_M3 (SPAdes) | Environmental | Open in IMG/M |
3300027729 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP04_OM1 (SPAdes) | Environmental | Open in IMG/M |
3300027846 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG (SPAdes) | Environmental | Open in IMG/M |
3300027875 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
3300027882 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
3300027898 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2013 (SPAdes) | Environmental | Open in IMG/M |
3300027902 | Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - CRP12 CR (SPAdes) | Environmental | Open in IMG/M |
3300028047 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M1 (SPAdes) | Environmental | Open in IMG/M |
3300028145 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK04 | Environmental | Open in IMG/M |
3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300028747 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E1_2 | Environmental | Open in IMG/M |
3300028780 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E3_2 | Environmental | Open in IMG/M |
3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Host-Associated | Open in IMG/M |
3300029636 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300031128 | Oak Summer Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
3300031545 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f26 | Environmental | Open in IMG/M |
3300031719 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 (v2) | Environmental | Open in IMG/M |
3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
3300031754 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515 | Environmental | Open in IMG/M |
3300031896 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f19 | Environmental | Open in IMG/M |
3300032035 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF170 | Environmental | Open in IMG/M |
3300032160 | Sb_50d combined assembly (MetaSPAdes) | Environmental | Open in IMG/M |
3300032174 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05 | Environmental | Open in IMG/M |
3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
3300032828 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.4 | Environmental | Open in IMG/M |
3300032955 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.5 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
JGI26345J50200_10398822 | 3300003352 | Bog Forest Soil | TKGLQVGDEIVVGSYKALRTLKPEASVKIDNSAPKKQQDDQQS* |
Ga0062385_112087281 | 3300004080 | Bog Forest Soil | KGLQVGDEIVVGSYKALRTLKPEASVKIDNTAPKKQQDDQQS* |
Ga0062389_1001962773 | 3300004092 | Bog Forest Soil | KGLQVGDEIVVGSYKALRTLKPEASVKIDNSAPKKQQDDQQS* |
Ga0070696_1010250062 | 3300005546 | Corn, Switchgrass And Miscanthus Rhizosphere | LQPGDEIVVGSYKALRTLKPEAAVKVDNSAPKKADDQQS* |
Ga0066705_108029491 | 3300005569 | Soil | GDEIVIGSYKALRTLKPEASVKVDNSAPKKPDDSQS* |
Ga0066702_103980991 | 3300005575 | Soil | QGDEIVVGSYKALRTLKPEANVKIDNSAPKKPEDNQS* |
Ga0070762_104730122 | 3300005602 | Soil | QKGDEIVVGSYKALRTLKPESSVKVDNSAPKKAASDDQSS* |
Ga0070762_106348941 | 3300005602 | Soil | QKGDEIVVGSYKALRTLKPEASVKVDNSAPKKTEPDDQSS* |
Ga0070762_112476691 | 3300005602 | Soil | VVGSYKALRTLKPEASVKVDNSAPKKPASDDQSS* |
Ga0075028_1010552802 | 3300006050 | Watersheds | TKGLQAGDEIVVGSYKALRTLKPEATVKVDNTAPKKIEEKE* |
Ga0075019_109623131 | 3300006086 | Watersheds | TKGLQVGDEIVVGSYKALRTLKPEASVKIDNTAPKKQQDDQQS* |
Ga0070765_1001871441 | 3300006176 | Soil | QKGDEIVVGSYKALRTLKPESSVKVDNSAPKKTESDDDKSS* |
Ga0079221_105174731 | 3300006804 | Agricultural Soil | KGDEIVVGSYKALRTLKPESSVKVDNSAPKKTESDDQSS* |
Ga0079220_118835641 | 3300006806 | Agricultural Soil | EIVVGSYKALRTLKPESQVKVDNSAPKKQDDQQS* |
Ga0075425_1022712081 | 3300006854 | Populus Rhizosphere | LQPGDEIVVGSYKALRTLKPEAPIKVDNSAPKKTDDQQS* |
Ga0073928_110164211 | 3300006893 | Iron-Sulfur Acid Spring | QQGDEIVVGSYKALRTLKPESNVKIDNSAPKKPEENQS* |
Ga0099793_100983011 | 3300007258 | Vadose Zone Soil | KGLQSGDEIVVGSYKALRTLKPESSVKIDNSAPKKPEDNQS* |
Ga0099827_112380321 | 3300009090 | Vadose Zone Soil | NDEIITGSYKALRTLRPNATIKVDNKAPKKPEDEKS* |
Ga0116105_11631181 | 3300009624 | Peatland | KGLQAGDEIVIGSYKALRTLKPEASVKVDNTAPKKPDDQQS* |
Ga0126374_101522363 | 3300009792 | Tropical Forest Soil | EIVTGSYKALRTLKPEAMIKIDNSAPKKQEDQQS* |
Ga0126373_131093772 | 3300010048 | Tropical Forest Soil | DGEEIVVGSYKALRTLKPEAAVKVDNSAPKKTEETP* |
Ga0126372_115303891 | 3300010360 | Tropical Forest Soil | EIVIGSYKALRTLKPEAQVKVDNSAPKSQEDQQS* |
Ga0126381_1000384019 | 3300010376 | Tropical Forest Soil | LQPGDEIVIGSYKALRTLKPEAQIKVDNSAPKKQDDQQS* |
Ga0136449_1027684622 | 3300010379 | Peatlands Soil | AESDEIITGCYKVLRTLRDGSSVKVDNTPPKKEES* |
Ga0136449_1041269541 | 3300010379 | Peatlands Soil | KAGDEIVVGSYKALRTLKPESQVKVDNSAPKKQDDQQS* |
Ga0126345_12684431 | 3300010858 | Boreal Forest Soil | DIEITKGLQAGDEIVVGSYKALRTLKPEASVKVDNTAPKKIEEKE* |
Ga0150983_105788391 | 3300011120 | Forest Soil | EIVVGSYKALRTLKPESQVKVDNSAPKKQEDQQS* |
Ga0150983_109389862 | 3300011120 | Forest Soil | DEIVVGSYKALRTLKPESQVKVDNSAPKKQDDQQS* |
Ga0137362_102995452 | 3300012205 | Vadose Zone Soil | DEIVVGSYKALRTLKPEASVKVDNSAPKKPEDSQS* |
Ga0137360_109429372 | 3300012361 | Vadose Zone Soil | DEIVLGSYKALRTLKPESSVKVDNTAPKKTEDQNN* |
Ga0137361_105076111 | 3300012362 | Vadose Zone Soil | PGDEIVTGSYKALRTLKPESDVKVDNSAPKKPEDQQS* |
Ga0134040_13049191 | 3300012389 | Grasslands Soil | EIVIGSYKALRTLKPEAQVKVDNSAPKKQEDQQS* |
Ga0137397_103380531 | 3300012685 | Vadose Zone Soil | GDEIVVGSYKALRTLKPEAAIKVDNSAPKKTDDQQS* |
Ga0137396_101705081 | 3300012918 | Vadose Zone Soil | PGDEIVVGSYKALRTLKPESQVKVDNSAPKKQDDQQG* |
Ga0126375_106864481 | 3300012948 | Tropical Forest Soil | DEIVIGSYKALRTLKPEAQVKVDNSAPKKQEDQQS* |
Ga0153916_113068301 | 3300012964 | Freshwater Wetlands | EIVIGSYKALRTLKPEASVKVDNTPPKKTEDQQS* |
Ga0126369_106953863 | 3300012971 | Tropical Forest Soil | GLQAGDEIVVGSYKALRTLKPEAQIKIDNSAPKKTEDQQS* |
Ga0181531_100609851 | 3300014169 | Bog | IVVGSYKALRTLKPEASVKVDNSAPKKTEPDDQSS* |
Ga0137405_10350211 | 3300015053 | Vadose Zone Soil | PGDEIVVGSYKALRTLKPEAQIKVDNSAPKKTDDQQS* |
Ga0137405_12772481 | 3300015053 | Vadose Zone Soil | SRATGDEIVVGSYKALRTLKPEAQIKVDNSAPKKTDDQQS* |
Ga0137420_10052672 | 3300015054 | Vadose Zone Soil | DEIVVGSYKALRTLKPESQIKVDNSAPKKQDDQQS* |
Ga0137420_13367607 | 3300015054 | Vadose Zone Soil | LQPGDEIVVGSYKALRTLKPEAAIKVDNTAPKKIEEKE* |
Ga0137420_14772255 | 3300015054 | Vadose Zone Soil | LQSGDEIVVGSYKALRTLKPESQVKWTNSAPKKQDDQQS* |
Ga0167631_10532682 | 3300015168 | Glacier Forefield Soil | LQPGDEIVVGSYKALRTLKPASSVKVDNTPPKKPEEEGQS* |
Ga0137418_103545183 | 3300015241 | Vadose Zone Soil | PGDEIVVGSYKALRTLKPEAAIKVDNTAPKKIEEKE* |
Ga0132256_1027316641 | 3300015372 | Arabidopsis Rhizosphere | LQAGDEIVVGSYKALRTLKPEAQIKIDNSAPKKTDDQQS* |
Ga0182036_101924131 | 3300016270 | Soil | LQPGDEIVVGSYKALRTLKPEAPIKVDNSAPKKTEDEQS |
Ga0182041_111214312 | 3300016294 | Soil | DEIVIGSYKALRTLKPEAQVKVDNSAPKSQEDQQS |
Ga0187806_11072851 | 3300017928 | Freshwater Sediment | LQPGDEIVVGSYKVLRTLKNDAPVKIDNTVKKQEES |
Ga0187814_100698301 | 3300017932 | Freshwater Sediment | GVQEGDEIVVGSYKALRTLKPEASIKIDNSAPKKTEETSE |
Ga0187778_101606891 | 3300017961 | Tropical Peatland | QEGEEIVVGSYKALRTLKPEASVKVDNSAAKKVEEQQ |
Ga0187782_100471601 | 3300017975 | Tropical Peatland | GLQSGDEIVVGSYKALRTLKPEASVKVDNTVQKPTEESQ |
Ga0187769_100261711 | 3300018086 | Tropical Peatland | GDLIVTGSYKALRTLKPGAAVKIDNSTPKTEESSSSSSS |
Ga0187771_107529601 | 3300018088 | Tropical Peatland | LQEGDEIVVGSYKALRTLKPEAPVKVDNSVQKKTEESQ |
Ga0066655_100818883 | 3300018431 | Grasslands Soil | PGDEIVVGSYKALRTLKPESQVKVDNSTPKKQEDQQS |
Ga0210407_102320241 | 3300020579 | Soil | ITKGLQPGDEIVVGSYKALRTLKPEADIKIDNTAPKKPEDQQS |
Ga0210399_113701491 | 3300020581 | Soil | DEIVVGSYKALRTLKPEASVKVDNSAPKKTEDQQS |
Ga0210395_107022931 | 3300020582 | Soil | GDEIVVGSYKALRTLKPESSVKVDNSAPKKPDDQQS |
Ga0210401_110716781 | 3300020583 | Soil | DEIVVGSYKALRTLKPESPVKVDNSAPKKQDDQQS |
Ga0210404_104268512 | 3300021088 | Soil | LQVGDEIVVGSYKALRTLKPEASVKIDNSAPKKQQDDQQS |
Ga0210406_105631901 | 3300021168 | Soil | ITKGLQNGDEIVVGSYKALRTLKPESSVKIDNSAPKKPEDTQS |
Ga0210400_108028412 | 3300021170 | Soil | DEIVVGSYKALRTLKPEASVKVDNSAPKKPEDSQS |
Ga0210405_106977551 | 3300021171 | Soil | LQPGDEIVVGSYKALRTLKPESPVKVDNSAPKKQDDQQS |
Ga0210396_103200773 | 3300021180 | Soil | VTKGLQVGDEIVVGSYKALRTLKPEASVKIDNSAPKKQQDDQQS |
Ga0210396_106692492 | 3300021180 | Soil | EITKGLQPGDEIVVGSYKALRTLKPASSVKVDNTVPKKPEEEGQS |
Ga0210388_110609622 | 3300021181 | Soil | TKGLQACDEIVVGSYKALRTLKPEASVKVDNAAPKKTEDSQ |
Ga0210387_112973351 | 3300021405 | Soil | GLQQGDEIVVGSYKALRTLKPEASVKVDNTAPKKTEDQQN |
Ga0210384_116110971 | 3300021432 | Soil | EGDQIVTGSYKALRTLKPGTKLKVDNTVTARDETSGS |
Ga0210392_100381841 | 3300021475 | Soil | VTKGLQVGDEIVVGSYKALRTLKPEASVKIDNTAPKKQQDDQQS |
Ga0210410_101667061 | 3300021479 | Soil | KGLQVGDEIVVGSYKALRTLKPEASVKIDNSAPKKQDDQQS |
Ga0210410_108753331 | 3300021479 | Soil | GVTDIEITKGLQAGDEIVVGSYKALRTLKPEAAIKVDNTAPKKIEEKE |
Ga0210410_114354722 | 3300021479 | Soil | GDEIVVGSYKALRTLKPESSVKVDNSAPKKQDDQQS |
Ga0210409_102055141 | 3300021559 | Soil | PGDEIVVGSYKALRTLKPQSAIKVDNSAPKKMDDQQS |
Ga0233357_10377792 | 3300023056 | Soil | IEITKGLQPGDEIVVGSYKALRTLKPASSVKVDNTVPKKPEDEGQS |
Ga0224544_10193761 | 3300023250 | Soil | QAGDQIITGSYKALRTLKPNSPIKVDNSAPKVPADTDQS |
Ga0207685_101130951 | 3300025905 | Corn, Switchgrass And Miscanthus Rhizosphere | KGLQAGDEIVIGSYKALRTLKPEAAVKVDNTAPKKIEEKE |
Ga0207685_103444412 | 3300025905 | Corn, Switchgrass And Miscanthus Rhizosphere | EVTDGLQTGDEIVVGSYKALRTLKPEAQIKVDNTAPKKPDDQQS |
Ga0207693_112839491 | 3300025915 | Corn, Switchgrass And Miscanthus Rhizosphere | KGLQAGDEIVVGSYKALRTLKPEATVKIDNSAPKKTEDQQ |
Ga0209804_10287201 | 3300026335 | Soil | PGDEIVVGSYKALRTLKPESQVKVDNSAPKKQDDQQS |
Ga0257180_10111301 | 3300026354 | Soil | QPGDEIVVGSYKALRTLKPEAQIKVDNSAPKKTDDQQS |
Ga0257169_10269891 | 3300026469 | Soil | LKPGDEIVVGSYKALRTLKPESQIKVDNSAPKKQDDQQS |
Ga0257156_10811772 | 3300026498 | Soil | QPGDEIVVGSYKALRTLKPEAPVKVDNSAPKKTDDQQS |
Ga0209648_102206023 | 3300026551 | Grasslands Soil | AGDEIVVGSYKALRTLKPESQVKVDNSAPKKQDDQQS |
Ga0209648_105337032 | 3300026551 | Grasslands Soil | GDEIVVGSYKALRTLKPESQVKVDNSAPKKQDDQQS |
Ga0209730_10196261 | 3300027034 | Forest Soil | GDEIVVGSYKALRTLKPEASIKIDNSAPKKPEDNQS |
Ga0208095_10026162 | 3300027104 | Forest Soil | GLQEGEEIVIGSYKALRTLKPGASIKVDNTVPKREELTS |
Ga0209332_11019122 | 3300027439 | Forest Soil | TKGLQNGDEIVVGSYKALRTLKPESSVKIDNSAPKKPEDNQS |
Ga0209331_11609262 | 3300027603 | Forest Soil | QGDEIVVGSYKALRTLKPESNVKIDNSAPKKPEENQS |
Ga0209248_102417612 | 3300027729 | Bog Forest Soil | DEIVVGSYKALRTLKPEASVKVDNTAPKKTEDQQN |
Ga0209180_104960061 | 3300027846 | Vadose Zone Soil | QPGDEIVVGNYKALRTLKPEAPIKVDNSAPKKTDDQQS |
Ga0209283_105823051 | 3300027875 | Vadose Zone Soil | LQPGDEIVVGSYKALRTLKPESQVKVDNSAPKKQDDQQS |
Ga0209590_100108851 | 3300027882 | Vadose Zone Soil | NDEIITGSYKALRTLRPNATIKVDNKAPKKPEDEKS |
Ga0209067_100050338 | 3300027898 | Watersheds | GDEIVVGSYKALRTLKPEASVKIDNTAPKKQQDDQQS |
Ga0209048_102611313 | 3300027902 | Freshwater Lake Sediment | GDEIVVGSYKALRTLKPDSTVKIDNSAPKKADDQQ |
Ga0209526_100904153 | 3300028047 | Forest Soil | LQTGDEIVVGSYKALRTLKPQASVKIDNSAPKKPEDNQS |
Ga0247663_10189833 | 3300028145 | Soil | SGDEIVIGSYKALRTLKPEAPIKVDNSAPKKTEDQQS |
Ga0268265_112577012 | 3300028380 | Switchgrass Rhizosphere | GDEIITGSYKILRTLKTDTQIKVDNSSPDKFEKKELL |
Ga0302219_102370321 | 3300028747 | Palsa | DIEIANGIREGDVIVIGSFKALRTLKPGASVKVDNTTPKPEDSSSSS |
Ga0302225_104644492 | 3300028780 | Palsa | AAGDEIVIGSYKALRTLKPQASVKVDNSAPKKPDDQQS |
Ga0265338_104507712 | 3300028800 | Rhizosphere | KGLQPGDEIVVGSYKALRTLKPDSTVKIDNSAPKKTDEQQP |
Ga0222749_103404492 | 3300029636 | Soil | VGDEIVVGSYKALRTLKPEASVKIDNSAPKKQDDQQS |
Ga0170823_108889332 | 3300031128 | Forest Soil | QVGDEIVVGSYKALRTLKPEASVKIDNTAPKKQQDDQQS |
Ga0318541_100297671 | 3300031545 | Soil | DGEDIVVGSYKALRTLKPEAAVKVDNSAPKKTEETQ |
Ga0306917_114754881 | 3300031719 | Soil | GLQEGEEIVIGSYKALRTLKPGTSIKVDNTVPKREELTS |
Ga0307469_101724331 | 3300031720 | Hardwood Forest Soil | IEVTDGLQPGDEIVVGSYKALRTLKPEAPIKVDNTAPKKTDDQQS |
Ga0307469_104381533 | 3300031720 | Hardwood Forest Soil | EITKGLQPGDEIVIGSYKALRTLKPEAAIKVDNTAPKKIEEKE |
Ga0307469_109119162 | 3300031720 | Hardwood Forest Soil | DEIVIGSYKALRTLKPEAPIKVDNSAPKKTEDQQS |
Ga0307469_122236062 | 3300031720 | Hardwood Forest Soil | PGDEIVVGSYKALRTLKPESQIKVDNSAPKKQDDQQS |
Ga0307475_105988771 | 3300031754 | Hardwood Forest Soil | DEIVVGSYKALRTLKPEAQVKVDNSAPKKQDDQQS |
Ga0318551_108923511 | 3300031896 | Soil | GDEIVVGSYKALRTLKPDASVKVDNTVKKTEETNN |
Ga0310911_107044031 | 3300032035 | Soil | QPGDEIVIGSYKALRTLKPEAQVKVDNSAPKSQEDQQS |
Ga0311301_124231282 | 3300032160 | Peatlands Soil | KAGDEIVVGSYKALRTLKPESQVKVDNSAPKKQDDQQS |
Ga0307470_101845003 | 3300032174 | Hardwood Forest Soil | VTKGLQPGDEIVVGSYKALRTLKPNAQIKVDNTAPKKTDDQQS |
Ga0306920_1025049781 | 3300032261 | Soil | GLQAGDEIVVGSYKALRTLKPEASVKIDNSAPKKTEDQQ |
Ga0335080_105892302 | 3300032828 | Soil | LQQGDEIVVGSYKALRTLKPESSVKVDNSAPKKTDDQQN |
Ga0335076_102039161 | 3300032955 | Soil | QKGDEIVVGSYKALRTLKPEASVKVDNSAPKKTASDDQSS |
Ga0335076_102693003 | 3300032955 | Soil | LQVGDEIVTGSYKALRTLKPEASVKIDNSAPKKQDDQQS |
⦗Top⦘ |