NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome Family F077589

Metagenome Family F077589

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F077589
Family Type Metagenome
Number of Sequences 117
Average Sequence Length 41 residues
Representative Sequence FGTFFDPQSTVAVAIPNVLFDHRTVTPAQPLSVYVGMRAKL
Number of Associated Samples 89
Number of Associated Scaffolds 117

Quality Assessment
Transcriptomic Evidence No
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 0.00 %
% of genes near scaffold ends (potentially truncated) 99.15 %
% of genes from short scaffolds (< 2000 bps) 92.31 %
Associated GOLD sequencing projects 83
AlphaFold2 3D model prediction Yes
3D model pTM-score0.20

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (96.581 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil
(17.949 % of family members)
Environment Ontology (ENVO) Unclassified
(31.624 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(56.410 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 33.33%    β-sheet: 0.00%    Coil/Unstructured: 66.67%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.20
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 117 Family Scaffolds
PF13442Cytochrome_CBB3 29.06
PF13570PQQ_3 5.13
PF13505OMP_b-brl 5.13
PF00756Esterase 2.56
PF13557Phenol_MetA_deg 2.56
PF08238Sel1 0.85
PF01011PQQ 0.85
PF13531SBP_bac_11 0.85
PF04392ABC_sub_bind 0.85
PF12951PATR 0.85
PF13594Obsolete Pfam Family 0.85
PF00034Cytochrom_C 0.85
PF07687M20_dimer 0.85
PF03992ABM 0.85
PF00005ABC_tran 0.85
PF07110EthD 0.85
PF00528BPD_transp_1 0.85

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 117 Family Scaffolds
COG2984ABC-type uncharacterized transport system, periplasmic componentGeneral function prediction only [R] 0.85


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms96.58 %
UnclassifiedrootN/A3.42 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2199352025|deepsgr__Contig_52477All Organisms → cellular organisms → Bacteria → Proteobacteria3134Open in IMG/M
3300000655|AF_2010_repII_A100DRAFT_1027914All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1049Open in IMG/M
3300000787|JGI11643J11755_11643829All Organisms → cellular organisms → Bacteria → Proteobacteria602Open in IMG/M
3300000955|JGI1027J12803_103689582All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Rhodopseudomonas → Rhodopseudomonas palustris513Open in IMG/M
3300000956|JGI10216J12902_116356527All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium540Open in IMG/M
3300001867|JGI12627J18819_10138832All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales993Open in IMG/M
3300002911|JGI25390J43892_10071981All Organisms → cellular organisms → Bacteria → Proteobacteria795Open in IMG/M
3300005332|Ga0066388_102263597All Organisms → cellular organisms → Bacteria → Proteobacteria982Open in IMG/M
3300005332|Ga0066388_102796575All Organisms → cellular organisms → Bacteria → Proteobacteria891Open in IMG/M
3300005332|Ga0066388_105341111All Organisms → cellular organisms → Bacteria → Proteobacteria651Open in IMG/M
3300005436|Ga0070713_101120719All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria761Open in IMG/M
3300005437|Ga0070710_10011445All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium4382Open in IMG/M
3300005468|Ga0070707_100224425All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales1829Open in IMG/M
3300005468|Ga0070707_101643553All Organisms → cellular organisms → Bacteria → Proteobacteria609Open in IMG/M
3300005553|Ga0066695_10686498All Organisms → cellular organisms → Bacteria → Proteobacteria602Open in IMG/M
3300005555|Ga0066692_10633100All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales668Open in IMG/M
3300005764|Ga0066903_100485367All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium2085Open in IMG/M
3300005764|Ga0066903_100823887All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae1664Open in IMG/M
3300005764|Ga0066903_101539999All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1257Open in IMG/M
3300005764|Ga0066903_101703305All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1200Open in IMG/M
3300005764|Ga0066903_101997718All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Alcaligenaceae → Azohydromonas → Azohydromonas australica1114Open in IMG/M
3300005764|Ga0066903_102793003All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria947Open in IMG/M
3300005764|Ga0066903_103373429All Organisms → cellular organisms → Bacteria → Proteobacteria862Open in IMG/M
3300005764|Ga0066903_103828499Not Available808Open in IMG/M
3300005764|Ga0066903_106378195All Organisms → cellular organisms → Bacteria615Open in IMG/M
3300005764|Ga0066903_108890238All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria509Open in IMG/M
3300006046|Ga0066652_100976499All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria805Open in IMG/M
3300006175|Ga0070712_100798924All Organisms → cellular organisms → Bacteria → Proteobacteria809Open in IMG/M
3300006177|Ga0075362_10688837All Organisms → cellular organisms → Bacteria533Open in IMG/M
3300006845|Ga0075421_101203711All Organisms → cellular organisms → Bacteria → Proteobacteria845Open in IMG/M
3300006903|Ga0075426_11539956All Organisms → cellular organisms → Bacteria506Open in IMG/M
3300006904|Ga0075424_100556080All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales1225Open in IMG/M
3300006904|Ga0075424_102446160All Organisms → cellular organisms → Bacteria → Proteobacteria547Open in IMG/M
3300009081|Ga0105098_10614708All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria568Open in IMG/M
3300009143|Ga0099792_10070335All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1763Open in IMG/M
3300009147|Ga0114129_12762061All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium584Open in IMG/M
3300009162|Ga0075423_12725575All Organisms → cellular organisms → Bacteria541Open in IMG/M
3300009162|Ga0075423_13048624All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium513Open in IMG/M
3300009792|Ga0126374_10576993All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria826Open in IMG/M
3300009792|Ga0126374_11392702All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Afipia → unclassified Afipia → Afipia sp. OHSU_II-uncloned571Open in IMG/M
3300010360|Ga0126372_11600548All Organisms → cellular organisms → Bacteria690Open in IMG/M
3300010375|Ga0105239_13551257All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium507Open in IMG/M
3300010376|Ga0126381_101939226All Organisms → cellular organisms → Bacteria849Open in IMG/M
3300010398|Ga0126383_10285999All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1639Open in IMG/M
3300010398|Ga0126383_11093062All Organisms → cellular organisms → Bacteria887Open in IMG/M
3300010398|Ga0126383_11435867All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria780Open in IMG/M
3300012096|Ga0137389_10118897All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales2126Open in IMG/M
3300012200|Ga0137382_10135332Not Available1659Open in IMG/M
3300012202|Ga0137363_11629815All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria537Open in IMG/M
3300012357|Ga0137384_11456922All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria533Open in IMG/M
3300012469|Ga0150984_106849517Not Available554Open in IMG/M
3300012929|Ga0137404_10424051All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1177Open in IMG/M
3300012951|Ga0164300_10479161All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria706Open in IMG/M
3300012960|Ga0164301_10618438All Organisms → cellular organisms → Bacteria802Open in IMG/M
3300012971|Ga0126369_11446981All Organisms → cellular organisms → Bacteria777Open in IMG/M
3300012985|Ga0164308_11253875All Organisms → cellular organisms → Bacteria671Open in IMG/M
3300014745|Ga0157377_10059416All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes2179Open in IMG/M
3300015200|Ga0173480_11019242All Organisms → cellular organisms → Bacteria546Open in IMG/M
3300016270|Ga0182036_10407367All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC68601061Open in IMG/M
3300016270|Ga0182036_11073460All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria666Open in IMG/M
3300016319|Ga0182033_10714265All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria878Open in IMG/M
3300016319|Ga0182033_11226295All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria672Open in IMG/M
3300016319|Ga0182033_11769823All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales560Open in IMG/M
3300016341|Ga0182035_10501703All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1036Open in IMG/M
3300016357|Ga0182032_10241545All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Rhodopseudomonas → Rhodopseudomonas palustris1399Open in IMG/M
3300016371|Ga0182034_10469149All Organisms → cellular organisms → Bacteria → Proteobacteria1045Open in IMG/M
3300016371|Ga0182034_10921960All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria752Open in IMG/M
3300016371|Ga0182034_11384952All Organisms → cellular organisms → Bacteria615Open in IMG/M
3300016404|Ga0182037_10909111All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales764Open in IMG/M
3300016422|Ga0182039_10305286All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1320Open in IMG/M
3300016445|Ga0182038_12069563All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium516Open in IMG/M
3300018482|Ga0066669_10065879All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales2369Open in IMG/M
3300021168|Ga0210406_11286723All Organisms → cellular organisms → Bacteria527Open in IMG/M
3300021178|Ga0210408_10769874All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales755Open in IMG/M
3300021560|Ga0126371_10625720All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1225Open in IMG/M
3300021560|Ga0126371_11892911All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860716Open in IMG/M
3300021560|Ga0126371_11908293All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium713Open in IMG/M
3300025906|Ga0207699_10517445All Organisms → cellular organisms → Bacteria863Open in IMG/M
3300025922|Ga0207646_10350985All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC68601333Open in IMG/M
3300025922|Ga0207646_11689141All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium544Open in IMG/M
3300025922|Ga0207646_11750040Not Available533Open in IMG/M
3300025928|Ga0207700_10512479All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales1062Open in IMG/M
3300025928|Ga0207700_11859849All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium528Open in IMG/M
3300026309|Ga0209055_1187523All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860636Open in IMG/M
3300026550|Ga0209474_10277060All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1011Open in IMG/M
3300027875|Ga0209283_10810724All Organisms → cellular organisms → Bacteria575Open in IMG/M
3300028047|Ga0209526_10414450All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860892Open in IMG/M
3300028715|Ga0307313_10297558All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium502Open in IMG/M
3300028722|Ga0307319_10047850All Organisms → cellular organisms → Bacteria → Proteobacteria1340Open in IMG/M
3300028784|Ga0307282_10377111All Organisms → cellular organisms → Bacteria686Open in IMG/M
3300028787|Ga0307323_10313300All Organisms → cellular organisms → Bacteria563Open in IMG/M
3300031544|Ga0318534_10006173All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC68605714Open in IMG/M
3300031546|Ga0318538_10303419All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium860Open in IMG/M
3300031572|Ga0318515_10750487All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium515Open in IMG/M
3300031668|Ga0318542_10139054All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1199Open in IMG/M
3300031682|Ga0318560_10503444All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium656Open in IMG/M
3300031736|Ga0318501_10159609All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1164Open in IMG/M
3300031744|Ga0306918_10113945All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1947Open in IMG/M
3300031770|Ga0318521_10891759All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria543Open in IMG/M
3300031771|Ga0318546_10330653All Organisms → cellular organisms → Bacteria → Proteobacteria1058Open in IMG/M
3300031782|Ga0318552_10103456All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Rhodopseudomonas → Rhodopseudomonas palustris1406Open in IMG/M
3300031782|Ga0318552_10646752All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria539Open in IMG/M
3300031831|Ga0318564_10021361All Organisms → cellular organisms → Bacteria2688Open in IMG/M
3300031879|Ga0306919_10699994All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria780Open in IMG/M
3300031941|Ga0310912_11015098All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium636Open in IMG/M
3300031954|Ga0306926_11133050All Organisms → cellular organisms → Bacteria → Proteobacteria923Open in IMG/M
3300032025|Ga0318507_10028417All Organisms → cellular organisms → Bacteria → Proteobacteria2062Open in IMG/M
3300032041|Ga0318549_10243132All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860809Open in IMG/M
3300032044|Ga0318558_10122373All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales1234Open in IMG/M
3300032076|Ga0306924_11818120All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria634Open in IMG/M
3300032090|Ga0318518_10725011All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria505Open in IMG/M
3300032091|Ga0318577_10139590All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1150Open in IMG/M
3300032094|Ga0318540_10339886All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria725Open in IMG/M
3300032174|Ga0307470_10127915All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales1513Open in IMG/M
3300032180|Ga0307471_103489954All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium556Open in IMG/M
3300032261|Ga0306920_104045183All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria531Open in IMG/M
3300033289|Ga0310914_10787229All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium849Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil17.95%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil15.38%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil11.11%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil9.40%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere9.40%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil6.84%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil6.84%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil5.98%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere5.98%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil1.71%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil1.71%
Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil1.71%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment0.85%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil0.85%
Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil0.85%
Populus EndosphereHost-Associated → Plants → Roots → Bulk Soil → Unclassified → Populus Endosphere0.85%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere0.85%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.85%
Avena Fatua RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere0.85%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
2199352025Soil microbial communities from Rothamsted, UK, for project Deep Soil - DEEP SOILEnvironmentalOpen in IMG/M
3300000655Forest soil microbial communities from Amazon forest - 2010 replicate II A100EnvironmentalOpen in IMG/M
3300000787Soil microbial communities from Great Prairies - Iowa, Continuous Corn soilEnvironmentalOpen in IMG/M
3300000955Soil microbial communities from Great Prairies - Iowa, Native Prairie soilEnvironmentalOpen in IMG/M
3300000956Soil microbial communities from Great Prairies - Kansas, Native Prairie soilEnvironmentalOpen in IMG/M
3300001867Texas A ecozone_OM1H0_M2 (Combined assembly for Texas A ecozone Site metagenome samples, ASSEMBLY_DATE=20130705)EnvironmentalOpen in IMG/M
3300002911Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_2_20cmEnvironmentalOpen in IMG/M
3300005332Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300005436Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaGEnvironmentalOpen in IMG/M
3300005437Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaGEnvironmentalOpen in IMG/M
3300005468Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaGEnvironmentalOpen in IMG/M
3300005553Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_144EnvironmentalOpen in IMG/M
3300005555Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141EnvironmentalOpen in IMG/M
3300005764Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)EnvironmentalOpen in IMG/M
3300006046Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101EnvironmentalOpen in IMG/M
3300006175Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaGEnvironmentalOpen in IMG/M
3300006177Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2Host-AssociatedOpen in IMG/M
3300006845Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5Host-AssociatedOpen in IMG/M
3300006903Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD5Host-AssociatedOpen in IMG/M
3300006904Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3Host-AssociatedOpen in IMG/M
3300009081Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 19-21cm May2015EnvironmentalOpen in IMG/M
3300009143Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2EnvironmentalOpen in IMG/M
3300009147Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2)Host-AssociatedOpen in IMG/M
3300009162Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2Host-AssociatedOpen in IMG/M
3300009792Tropical forest soil microbial communities from Panama - MetaG Plot_12EnvironmentalOpen in IMG/M
3300010360Tropical forest soil microbial communities from Panama - MetaG Plot_6EnvironmentalOpen in IMG/M
3300010375Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaGHost-AssociatedOpen in IMG/M
3300010376Tropical forest soil microbial communities from Panama - MetaG Plot_28EnvironmentalOpen in IMG/M
3300010398Tropical forest soil microbial communities from Panama - MetaG Plot_35EnvironmentalOpen in IMG/M
3300012096Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaGEnvironmentalOpen in IMG/M
3300012200Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaGEnvironmentalOpen in IMG/M
3300012202Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaGEnvironmentalOpen in IMG/M
3300012357Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaGEnvironmentalOpen in IMG/M
3300012469Combined assembly of Soil carbon rhizosphereHost-AssociatedOpen in IMG/M
3300012929Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012951Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_226_MGEnvironmentalOpen in IMG/M
3300012960Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MGEnvironmentalOpen in IMG/M
3300012971Tropical forest soil microbial communities from Panama - MetaG Plot_1EnvironmentalOpen in IMG/M
3300012985Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_246_MGEnvironmentalOpen in IMG/M
3300014745Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaGHost-AssociatedOpen in IMG/M
3300015200Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S209-509C-1 (version 2)EnvironmentalOpen in IMG/M
3300016270Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080EnvironmentalOpen in IMG/M
3300016319Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00HEnvironmentalOpen in IMG/M
3300016341Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170EnvironmentalOpen in IMG/M
3300016357Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000EnvironmentalOpen in IMG/M
3300016371Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172EnvironmentalOpen in IMG/M
3300016404Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082EnvironmentalOpen in IMG/M
3300016422Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111EnvironmentalOpen in IMG/M
3300016445Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108EnvironmentalOpen in IMG/M
3300018482Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118EnvironmentalOpen in IMG/M
3300021168Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-MEnvironmentalOpen in IMG/M
3300021178Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-MEnvironmentalOpen in IMG/M
3300021560Tropical forest soil microbial communities from Panama - MetaG Plot_4EnvironmentalOpen in IMG/M
3300025906Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025922Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025928Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300026309Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110 (SPAdes)EnvironmentalOpen in IMG/M
3300026550Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145 (SPAdes)EnvironmentalOpen in IMG/M
3300027875Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300028047Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M1 (SPAdes)EnvironmentalOpen in IMG/M
3300028715Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_203EnvironmentalOpen in IMG/M
3300028722Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_368EnvironmentalOpen in IMG/M
3300028784Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_121EnvironmentalOpen in IMG/M
3300028787Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_381EnvironmentalOpen in IMG/M
3300031544Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f26EnvironmentalOpen in IMG/M
3300031546Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f23EnvironmentalOpen in IMG/M
3300031572Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f19EnvironmentalOpen in IMG/M
3300031668Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f23EnvironmentalOpen in IMG/M
3300031682Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f22EnvironmentalOpen in IMG/M
3300031736Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f21EnvironmentalOpen in IMG/M
3300031744Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H (v2)EnvironmentalOpen in IMG/M
3300031770Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f17EnvironmentalOpen in IMG/M
3300031771Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f19EnvironmentalOpen in IMG/M
3300031782Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f20EnvironmentalOpen in IMG/M
3300031831Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f20EnvironmentalOpen in IMG/M
3300031879Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 (v2)EnvironmentalOpen in IMG/M
3300031941Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX080EnvironmentalOpen in IMG/M
3300031954Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2)EnvironmentalOpen in IMG/M
3300032025Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f20EnvironmentalOpen in IMG/M
3300032041Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f22EnvironmentalOpen in IMG/M
3300032044Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f20EnvironmentalOpen in IMG/M
3300032076Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2)EnvironmentalOpen in IMG/M
3300032090Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f22EnvironmentalOpen in IMG/M
3300032091Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f25EnvironmentalOpen in IMG/M
3300032094Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f25EnvironmentalOpen in IMG/M
3300032174Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05EnvironmentalOpen in IMG/M
3300032180Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515EnvironmentalOpen in IMG/M
3300032261Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2)EnvironmentalOpen in IMG/M
3300033289Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN108EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
deepsgr_005890302199352025SoilTYFDPQSVINAVANPPTDHRTVTPAQPLSVYVGLRAKL
AF_2010_repII_A100DRAFT_102791423300000655Forest SoilTFFDPQSTVALAIPNVLFDHRMVTPAQPXSVYVGMRAKL*
JGI11643J11755_1164382923300000787SoilYFDPQSVINAVSNPPTDHRTVTPAQPLSVYVGLRAKL*
JGI1027J12803_10368958213300000955SoilFGTFFDTQSTVAVAIPNVLTDPRMVTPAQPLSVYVGMRAKL*
JGI10216J12902_11635652723300000956SoilFFDTQSTVAIAIPNVLTDPRMVTPAQPLSVYVGMRAKL*
JGI12627J18819_1013883213300001867Forest SoilDTQSTVAVAIPNVLNDPRTVTPAQPLSVYVGMRAKL*
JGI25390J43892_1007198113300002911Grasslands SoilATFGTFFDPQSTVAVAIPNVLFDHRTVTPAQPLSVYVGMRAKL*
Ga0066388_10226359733300005332Tropical Forest SoilNRKFATFGTFFDPQSTVAIAIPNVLFDHRTVTPAQPLSVYVGMRAKL*
Ga0066388_10279657523300005332Tropical Forest SoilMFNRKFATFGTFFNTQSTVAIAIPNVLTDPRMVTPAQPLSVYVGMRAN*
Ga0066388_10534111113300005332Tropical Forest SoilFNRKFATFGTFFDPQSTVALAIPNVLFDHRMVTPAQPLSVYVGVRAKL*
Ga0070713_10112071933300005436Corn, Switchgrass And Miscanthus RhizosphereRKFATFGTFFDPQSTVANALPGILNDHRTVTPAQPLSVYVGMRAKL*
Ga0070710_1001144563300005437Corn, Switchgrass And Miscanthus RhizosphereGTFFDTQSTVAVAIPNVLNDPRTVTPAQPLSVYVGMRAKL*
Ga0070707_10022442513300005468Corn, Switchgrass And Miscanthus RhizosphereFGTFFDPQSTVAVAIPNVLFDHRTVTPAQPLSVYVGMRAKL*
Ga0070707_10164355323300005468Corn, Switchgrass And Miscanthus RhizosphereLFNRKFATFGTFFDPQSTVAVAIPNVLFDHRTVTPAQPLSVYVGMRAKL*
Ga0066695_1068649823300005553SoilTFGTFFDPQSTVANAIPNVLFDHRTVTPAQPLSVYVGMRAKL*
Ga0066692_1063310023300005555SoilFDPQSTVAIAIPNVLFDHRTVTPAQPLSVYVGLRAKL*
Ga0066903_10048536763300005764Tropical Forest SoilTFFDTHSTVAIAIPNVLNDPRMVTPAQPLSVYVGMRAKL*
Ga0066903_10082388733300005764Tropical Forest SoilTFFDTQSTVANAIPNALSDPRMVTPVQPLSVYVGLRVKL*
Ga0066903_10153999923300005764Tropical Forest SoilATFGTFFDTHSTVAIAIPNVLTDPRTVTPAQPLSVYVGMHARL*
Ga0066903_10170330533300005764Tropical Forest SoilHSTVAIAIPNVLNDPRMVTPAQPLSVYVGMRAKL*
Ga0066903_10199771813300005764Tropical Forest SoilGTFFDTQSTVAIAIPNVLTDPRMVTPAQPLSVYVGMRAKL*
Ga0066903_10279300323300005764Tropical Forest SoilFATFGTFFDPQSTVALAIPNVLFDHRTITPAQPLSVYVGIHAKL*
Ga0066903_10337342933300005764Tropical Forest SoilNNLFNRKFATFGTFFDPQSTVAIAIPNVLFDHRTVTPAQPFSVYVGMRAKL*
Ga0066903_10382849913300005764Tropical Forest SoilTQSTVAVAIPNVLNDPRMVTPAQPLSVYLGMRAKL*
Ga0066903_10637819513300005764Tropical Forest SoilFFDPQSTVALAIPNVLFDHRMVTPAQPLSVYVGVRAKL*
Ga0066903_10889023823300005764Tropical Forest SoilFATFGTFFDPQSTVALAIPNVLFDHRTITPAQPLSVYVGMHAKL*
Ga0066652_10097649913300006046SoilVYGTYFEPQSIVNAIANPPTDQRTQTPAQPLSVYAGLRYKLP*
Ga0070712_10079892443300006175Corn, Switchgrass And Miscanthus RhizosphereTFFDTQSTVAVAIPNVLNDPRTVTPAQPLSVYVGMRAKL*
Ga0075362_1068883723300006177Populus EndosphereYFDAGSIANVLPNPPTDHRTITPAQPLSIYVGMRAKL*
Ga0075421_10120371113300006845Populus RhizosphereATFGTYFDAGSIANVLPNPPTDPRTITPAQPLSVYVGMRAKL*
Ga0075426_1153995623300006903Populus RhizosphereFFDTQSTVAVAIPNVLNDPRMVTPAQPLSVYVGMRAKL*
Ga0075424_10055608033300006904Populus RhizosphereTFGTFFDTQSTVAVAIPNVLNDPRTVTPAQPLSVYVGMRAKL*
Ga0075424_10244616013300006904Populus RhizosphereATFGTFFDTQSTVAVAIPNVLNDPRTVTPAQPLSVYVGMRAKL*
Ga0105098_1061470823300009081Freshwater SedimentYFDPQSIVNAIPNPPTDHRTITPAQPLSVYVGMRAKL*
Ga0099792_1007033543300009143Vadose Zone SoilTFGTFFDPQSTVAVAIPNVLFDHRMVTPAQPLSVYLGLRAKL*
Ga0114129_1276206123300009147Populus RhizosphereFFDPQSTVANALPGVLNDPRTVTPAQPLSVYVGMRAKL*
Ga0075423_1272557523300009162Populus RhizosphereQSTVAVAIPNVLFDHRTVTPAQPLSVYVGMRAKL*
Ga0075423_1304862413300009162Populus RhizosphereTFGTFFDTQSTVAIAIPNVLTDPRMVTPAQPLSVYVGMRAKL*
Ga0126374_1057699313300009792Tropical Forest SoilPQSTVALAIPNVLFDHRTVTPAQPLSIYVGLRAKL*
Ga0126374_1139270213300009792Tropical Forest SoilNNLFNRKFATFGTFFNPQSTVAIAIPNVLEDHRTVTPAQPLSVYVGMRAKF*
Ga0126372_1160054813300010360Tropical Forest SoilPQSTVAIAIPNVLFDHRTVTPAQPLSVYVGMRAKL*
Ga0105239_1355125713300010375Corn RhizosphereGTFFDPQSTVALAVPNVLFDHRMVTPAQPLSVYVGMRAKL*
Ga0126381_10193922613300010376Tropical Forest SoilNNLFNRKFATFGTFFDPQSTVANAIPNVLFDHRMVTPAQPLSVYVGMRAKL*
Ga0126383_1028599923300010398Tropical Forest SoilATIGTFFDTQSTVAIAIPNVLNDPRMVTPAQPLSVYVGMRAKL*
Ga0126383_1109306233300010398Tropical Forest SoilTFFDPQSTVALAIPNVLFDHRTITPAQPLSVYVGMRAKL*
Ga0126383_1143586723300010398Tropical Forest SoilKFATIGTFFDTQSTVAIAIPNVLNDPRMVTPAQPLSVYVGMRAKL*
Ga0137389_1011889733300012096Vadose Zone SoilFFDPQSTVAVAIPNVLFDHRTVTPAQPLSIYVGMRAKL*
Ga0137382_1013533233300012200Vadose Zone SoilTFFDTQSTVAVAIPNVLFDHRTVTPAQPLSIYVSLRAKL*
Ga0137363_1162981523300012202Vadose Zone SoilPQVIANAIPDPPSDHRMVTPAQPLSIYVGLRAKL*
Ga0137384_1145692223300012357Vadose Zone SoilDPRVIANAIPDPPTDHRMVTPAQPLSIYVGLRAKL*
Ga0150984_10684951713300012469Avena Fatua RhizosphereESIVNAIASPPTDHRTQTPAQPLAVYAGLRYRLP*
Ga0137404_1042405113300012929Vadose Zone SoilYFDPQVIANAISNPPTDHRMVTPAQPLAVYVGLRAKL*
Ga0164300_1047916123300012951SoilFGKFSYSQSLCAVAIGNVLCVQRTITPAQPLSNYVGMHAKL*
Ga0164301_1061843813300012960SoilPQSVINAVSNPPTDHRTITPAQPLAVYVGLRAKL*
Ga0126369_1144698133300012971Tropical Forest SoilTSGTFFDPQSTVALAIPNVLNDHRMITPAQPLAIYVGLRAKL*
Ga0164308_1125387513300012985SoilPQSVINAVSNPPTDHRTITPAQPLAVYMGLRVKL*
Ga0157377_1005941633300014745Miscanthus RhizosphereFDPQSVINAVSNPPTDHRTITPAQPLSVYMGLRVKL*
Ga0173480_1101924213300015200SoilTYFDPQSVINAVSNPPTDHRTITPAQPLAVYVCLRAKL*
Ga0182036_1040736713300016270SoilNNLFNRKFATFGTFFDPQSTVAIAIPNVLFDHRTVTPAQPLSVYVGMRAKL
Ga0182036_1107346013300016270SoilTFFNPQSTVAIAIPNVLEDHRTVTPAQPLSVYVGMRAKL
Ga0182033_1071426513300016319SoilKFATFGTFFDSQSTGALAIPNVVFDHRTVTPAQPLSVYVGMHAKL
Ga0182033_1122629523300016319SoilFATFGTFFDPQSTVALAIPNVLSDHRTITPAQPLSVYVGIHAKL
Ga0182033_1176982313300016319SoilTFGTFFDPQSTVALAIPNVLSDHRTITPAQPLSVYVGMHAKL
Ga0182035_1050170313300016341SoilFATFGTFFNPQSTVAIAIPNVLEDHRTVTPAQPLSVYVGMRAKF
Ga0182032_1024154523300016357SoilFNPQSTVAIAIPNVLEDHRTVTPAQPLSVYVGMRAKF
Ga0182034_1046914913300016371SoilTFFDPQSTVAIAIPNVLFDHRTVTPAQPLSVYVGMRAKL
Ga0182034_1092196023300016371SoilPQSTVAIAIPNTLFDHRTITPAQPLSVYVGMHAKL
Ga0182034_1138495223300016371SoilFDPQSTVAVAIPNVLFDHRTVTPAQPLSVYVGMRAKL
Ga0182037_1090911123300016404SoilFNRKFATFGTFFDPQSTVANAIPNVLFDHRTVTPAQPLSVYVGMRAKL
Ga0182039_1030528613300016422SoilRKFATFGTFFNPQSTVAIAIPNVLEDHRTVTPAQPLSVYVGMRAKL
Ga0182038_1206956323300016445SoilFDPQSTVALAIPNVLFDHRTVTPAQPLSVYVGMRAKL
Ga0066669_1006587933300018482Grasslands SoilNRKFASVGTFFDTQSTVAVAIPNVLTDPRMVTPAQPLSVYVGMRAKL
Ga0210406_1128672323300021168SoilFDPQSTVAVAIPNTLFDHRTVTPAQPLSVYVGMRAKL
Ga0210408_1076987413300021178SoilKFATFGTFFDPQSTVAIAIPNVLFDHRTVTPAQPLSVYVGMRAKL
Ga0126371_1062572013300021560Tropical Forest SoilNRKFATFGTFFNPQSTVAIAIPNVLEDHRMVTPAQPLSVYVGMRAKL
Ga0126371_1189291113300021560Tropical Forest SoilFGTFFDPQSTVAIAIPNVLFDHRTVTPAQPLSVYLGMRAKL
Ga0126371_1190829333300021560Tropical Forest SoilRKFATFGTFFNPQSTVALAIPNVLFDHRMVTPAQPLSVYVGMRAKL
Ga0207699_1051744513300025906Corn, Switchgrass And Miscanthus RhizosphereNRKFATVGTFFDTQSTVAVAIPNVLNDPRMVTPAQPLSVYLGMRAKL
Ga0207646_1035098513300025922Corn, Switchgrass And Miscanthus RhizosphereNRKFATFGTFFDPQSTVAVAIPNVLFDHRTVTPAQPLSVYVGMRAKL
Ga0207646_1168914113300025922Corn, Switchgrass And Miscanthus RhizosphereTFFDPQSTVAVAIPNVLFDHRTVTPAQPLSVYVGMRAKL
Ga0207646_1175004023300025922Corn, Switchgrass And Miscanthus RhizosphereTYFDPQSVINAVSNPPTDHRTITPAQPLSVYMGLRVKL
Ga0207700_1051247933300025928Corn, Switchgrass And Miscanthus RhizosphereKFATFGTFFDTQSTVAVAIPNVLNDPRTVTPAQPLSVYVGMRAKL
Ga0207700_1185984913300025928Corn, Switchgrass And Miscanthus RhizosphereNRKFATFGTFFDPQSTVANALPNVLFDHRTVTPAQPLSVYVGMRAKL
Ga0209055_118752313300026309SoilFNRKFATFGTFFDPQSTVAVAIPNVLFDHRTVTPAQPLSVYVGMRAKL
Ga0209474_1027706013300026550SoilTQSTVAIAIPNVLTDPRMVTPAQPLSVYVGMRAKL
Ga0209283_1081072413300027875Vadose Zone SoilDPQSTVAVAIPNVLFDHRTVTPAQPLSIYVGMRAKL
Ga0209526_1041445013300028047Forest SoilLFNRKFATFGTFFDPQSTVAVAIPNTLFDHRTVTPAQPLSVYVGMRAKL
Ga0307313_1029755813300028715SoilVGTFFDTQSTVAVAIPNVLNDPRMVTPAQPLSVYVGMRAKL
Ga0307319_1004785013300028722SoilFDPQSVINAVSNPPTDHRTVTPAQPLSVYVGLRAKL
Ga0307282_1037711133300028784SoilKFATFGTFFDTQSTVAVAIPNVLTDPRMVTPAQPLSVYVGMRAKL
Ga0307323_1031330023300028787SoilTFGTFFDTQSTVAVAIPNVLTDPRMVTPAQPLSVYVGMRAKL
Ga0318534_1000617373300031544SoilDPQSTVANAIPNVLFDHRTVTPAQPLSVYVGMRAKL
Ga0318538_1030341913300031546SoilNPQSTVAIAIPNVLEDHRTVTPAQPLSVYVGMRAKF
Ga0318515_1075048713300031572SoilFGTFFNPQSTVAIAIPNVLEDHRTVTPAQPLSVYVGMRAKF
Ga0318542_1013905413300031668SoilTFGTFFDPQSTVALAIPNVLSDHRTITPAQPLSVYVGIHAKL
Ga0318560_1050344413300031682SoilFNPQVIANAIPDPPTDHRMVTPTQPLSIYVGLRAKL
Ga0318501_1015960913300031736SoilRKFATFGTFFDPQSTVAIAIPNVLFDHRMVTPAQPLSVYVGMRAKL
Ga0306918_1011394533300031744SoilKFATFGTFFNPQSTVAIAIPNVLEDHRTVTPAQPLSVYVGMRAKF
Ga0318521_1089175923300031770SoilATFGTFFNPQSTVAIAIPNVLEDHRTVTPAQPLSVYVGMRAKL
Ga0318546_1033065313300031771SoilFDTQSTVAIAIPNVLTNPRMVTPAQPLSVYVGMRAKL
Ga0318552_1010345623300031782SoilTFFNPQSTVAIAIPNVLEDHRTVTPAQPLSVYVGMRAKF
Ga0318552_1064675223300031782SoilFGTFFNPQSTVAIAIPNVLEDHRTVTPAQPLSVYVGMRAKL
Ga0318564_1002136143300031831SoilFDPQSTVANAIPNVLFDHRTVTPAQPLSVYVGMRAKL
Ga0306919_1069999413300031879SoilNNLFNRKFATFGTFFNPQSTVAIAIPNVLEDHRMVTPAQPLSVYVGIHAKL
Ga0310912_1101509823300031941SoilFFDTHSTVAIAIPNVLTDPRMVTPAQPLSVYVGMRAKL
Ga0306926_1113305033300031954SoilTFFDPQSTVAVAIPNTLFDHRTVTPAQPLSIYIGMRAKL
Ga0318507_1002841733300032025SoilFFDPQSTVANAIPNVLFDHRTVTPAQPLSVYVGMRAKL
Ga0318549_1024313213300032041SoilKFATFGTFFDPQSTVAVAIPNVLFDHRTVTPAQPLSVYVGMRAKL
Ga0318558_1012237313300032044SoilNLFNRKFATFGTFFDPQSTVAIAIPNVLFDHRMVTPAQPLSVYVGMRAKL
Ga0306924_1181812013300032076SoilTFGTFFNPQSTVAIAIPNVLEDHRMVTPAQPLSVYVGIHAKL
Ga0318518_1072501123300032090SoilFATFGTFFNPQSTVAIAIPNVLEDHRTVTPAQPLSVYVGMRAKL
Ga0318577_1013959023300032091SoilFDPQSTVAVAIPNVLFDHRTITPAQPLSVYVGMHAKL
Ga0318540_1033988613300032094SoilFNRKFATFGTFFDPQSTVALAIPNVLFDHRTITPAQPLSVYVGMHAKL
Ga0307470_1012791513300032174Hardwood Forest SoilTFGTFFDTQSTVAVAIPNVLNDPRTVTPAQPLSVYVGMRAKL
Ga0307471_10348995413300032180Hardwood Forest SoilKFATFGTFYDTQSTIAVAIPNVLNDPRTVTPAQPLSVYVGMRAKL
Ga0306920_10404518313300032261SoilKFATFGTFFNPQSTVAIAIPNVLEDHRTVTPAQPLSVYVGMRAKL
Ga0310914_1078722913300033289SoilKFATFGTFFDTHSTVAIAIPNVLTDPRMVTPAQPLSVYVGMRAKL


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.