Basic Information | |
---|---|
Family ID | F077601 |
Family Type | Metagenome |
Number of Sequences | 117 |
Average Sequence Length | 46 residues |
Representative Sequence | LRDRRIRQVVGAILTALLVLAVWKFIDWRMTPPPPPNSIATPAAKP |
Number of Associated Samples | 101 |
Number of Associated Scaffolds | 117 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | No |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 78.45 % |
% of genes near scaffold ends (potentially truncated) | 33.33 % |
% of genes from short scaffolds (< 2000 bps) | 84.62 % |
Associated GOLD sequencing projects | 91 |
AlphaFold2 3D model prediction | No |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (84.615 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil (26.496 % of family members) |
Environment Ontology (ENVO) | Unclassified (41.880 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (47.009 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 56.52% β-sheet: 0.00% Coil/Unstructured: 43.48% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 117 Family Scaffolds |
---|---|---|
PF01329 | Pterin_4a | 71.79 |
PF16798 | DUF5069 | 18.80 |
PF09594 | GT87 | 2.56 |
COG ID | Name | Functional Category | % Frequency in 117 Family Scaffolds |
---|---|---|---|
COG2154 | Pterin-4a-carbinolamine dehydratase | Coenzyme transport and metabolism [H] | 71.79 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 84.62 % |
Unclassified | root | N/A | 15.38 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
2065487018|GPINP_F5MS3JC02J3EDG | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 513 | Open in IMG/M |
2170459010|GIO7OMY02F1UPG | All Organisms → cellular organisms → Bacteria | 522 | Open in IMG/M |
3300000956|JGI10216J12902_118421991 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Chthoniobacter → Chthoniobacter flavus | 1082 | Open in IMG/M |
3300005167|Ga0066672_10467276 | All Organisms → cellular organisms → Bacteria | 822 | Open in IMG/M |
3300005171|Ga0066677_10028272 | All Organisms → cellular organisms → Bacteria | 2661 | Open in IMG/M |
3300005176|Ga0066679_10425449 | All Organisms → cellular organisms → Bacteria | 870 | Open in IMG/M |
3300005181|Ga0066678_10962173 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 555 | Open in IMG/M |
3300005186|Ga0066676_10182093 | All Organisms → cellular organisms → Bacteria | 1340 | Open in IMG/M |
3300005187|Ga0066675_10273344 | All Organisms → cellular organisms → Bacteria | 1214 | Open in IMG/M |
3300005289|Ga0065704_10031638 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Candidatus Udaeobacter | 1135 | Open in IMG/M |
3300005354|Ga0070675_101487353 | All Organisms → cellular organisms → Bacteria | 625 | Open in IMG/M |
3300005434|Ga0070709_10251903 | All Organisms → cellular organisms → Bacteria | 1272 | Open in IMG/M |
3300005436|Ga0070713_101443024 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 667 | Open in IMG/M |
3300005439|Ga0070711_102082411 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 500 | Open in IMG/M |
3300005536|Ga0070697_100541314 | All Organisms → cellular organisms → Bacteria | 1020 | Open in IMG/M |
3300005539|Ga0068853_100208153 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1782 | Open in IMG/M |
3300005540|Ga0066697_10212539 | All Organisms → cellular organisms → Bacteria | 1149 | Open in IMG/M |
3300005543|Ga0070672_100699594 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 887 | Open in IMG/M |
3300005560|Ga0066670_10308725 | Not Available | 963 | Open in IMG/M |
3300005566|Ga0066693_10116204 | All Organisms → cellular organisms → Bacteria | 979 | Open in IMG/M |
3300005566|Ga0066693_10378861 | Not Available | 572 | Open in IMG/M |
3300005569|Ga0066705_10642969 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 646 | Open in IMG/M |
3300005586|Ga0066691_10340677 | All Organisms → cellular organisms → Bacteria | 887 | Open in IMG/M |
3300005614|Ga0068856_100543530 | All Organisms → cellular organisms → Bacteria | 1183 | Open in IMG/M |
3300006034|Ga0066656_10680921 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria | 662 | Open in IMG/M |
3300006175|Ga0070712_100266912 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 1373 | Open in IMG/M |
3300006237|Ga0097621_101088996 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales | 750 | Open in IMG/M |
3300006794|Ga0066658_10243258 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Oxalobacteraceae → Herbaspirillum → unclassified Herbaspirillum → Herbaspirillum sp. | 961 | Open in IMG/M |
3300006794|Ga0066658_10901122 | Not Available | 509 | Open in IMG/M |
3300006800|Ga0066660_10107946 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 1986 | Open in IMG/M |
3300006800|Ga0066660_10124326 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Oxalobacteraceae → Herbaspirillum → unclassified Herbaspirillum → Herbaspirillum sp. | 1870 | Open in IMG/M |
3300007788|Ga0099795_10147786 | All Organisms → cellular organisms → Bacteria | 960 | Open in IMG/M |
3300009143|Ga0099792_10486349 | All Organisms → cellular organisms → Bacteria | 770 | Open in IMG/M |
3300009792|Ga0126374_10660022 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 781 | Open in IMG/M |
3300010159|Ga0099796_10159209 | All Organisms → cellular organisms → Bacteria | 894 | Open in IMG/M |
3300012202|Ga0137363_11141969 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Candidatus Udaeobacter | 663 | Open in IMG/M |
3300012202|Ga0137363_11622928 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 539 | Open in IMG/M |
3300012203|Ga0137399_10465239 | All Organisms → cellular organisms → Bacteria | 1058 | Open in IMG/M |
3300012205|Ga0137362_10282222 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Candidatus Udaeobacter → Candidatus Udaeobacter copiosus | 1436 | Open in IMG/M |
3300012208|Ga0137376_11167642 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 658 | Open in IMG/M |
3300012210|Ga0137378_10928811 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Candidatus Udaeobacter | 783 | Open in IMG/M |
3300012349|Ga0137387_10257167 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Candidatus Udaeobacter | 1259 | Open in IMG/M |
3300012361|Ga0137360_10334469 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 1265 | Open in IMG/M |
3300012582|Ga0137358_10511512 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 809 | Open in IMG/M |
3300012582|Ga0137358_10708937 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 673 | Open in IMG/M |
3300012917|Ga0137395_10144446 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Candidatus Udaeobacter → Candidatus Udaeobacter copiosus | 1624 | Open in IMG/M |
3300012918|Ga0137396_10826940 | Not Available | 681 | Open in IMG/M |
3300012924|Ga0137413_10121031 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Candidatus Udaeobacter → Candidatus Udaeobacter copiosus | 1667 | Open in IMG/M |
3300012927|Ga0137416_10344400 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Candidatus Udaeobacter | 1248 | Open in IMG/M |
3300012930|Ga0137407_10089527 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Candidatus Udaeobacter → Candidatus Udaeobacter copiosus | 2613 | Open in IMG/M |
3300012951|Ga0164300_10237830 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Candidatus Udaeobacter → Candidatus Udaeobacter copiosus | 916 | Open in IMG/M |
3300012951|Ga0164300_10614958 | All Organisms → cellular organisms → Bacteria | 644 | Open in IMG/M |
3300012955|Ga0164298_10055272 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 1928 | Open in IMG/M |
3300012955|Ga0164298_10217522 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Candidatus Udaeobacter → Candidatus Udaeobacter copiosus | 1129 | Open in IMG/M |
3300012958|Ga0164299_11659667 | Not Available | 506 | Open in IMG/M |
3300012960|Ga0164301_10432486 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Candidatus Udaeobacter → Candidatus Udaeobacter copiosus | 930 | Open in IMG/M |
3300012960|Ga0164301_10692673 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Candidatus Udaeobacter → Candidatus Udaeobacter copiosus | 765 | Open in IMG/M |
3300012961|Ga0164302_10013586 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Candidatus Udaeobacter → Candidatus Udaeobacter copiosus | 3303 | Open in IMG/M |
3300012961|Ga0164302_10960661 | Not Available | 662 | Open in IMG/M |
3300012977|Ga0134087_10255455 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 805 | Open in IMG/M |
3300012984|Ga0164309_10039511 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae | 2661 | Open in IMG/M |
3300012985|Ga0164308_10789424 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Candidatus Udaeobacter → Candidatus Udaeobacter copiosus | 827 | Open in IMG/M |
3300012988|Ga0164306_10439545 | All Organisms → cellular organisms → Bacteria | 990 | Open in IMG/M |
3300013100|Ga0157373_11396023 | Not Available | 532 | Open in IMG/M |
3300013308|Ga0157375_11271245 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Candidatus Udaeobacter → Candidatus Udaeobacter copiosus | 865 | Open in IMG/M |
3300013308|Ga0157375_12510001 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Candidatus Udaeobacter → Candidatus Udaeobacter copiosus | 615 | Open in IMG/M |
3300015077|Ga0173483_10128338 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 1093 | Open in IMG/M |
3300015242|Ga0137412_10121680 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Candidatus Udaeobacter → Candidatus Udaeobacter copiosus | 2114 | Open in IMG/M |
3300017997|Ga0184610_1218447 | Not Available | 637 | Open in IMG/M |
3300018000|Ga0184604_10065072 | All Organisms → cellular organisms → Bacteria | 1048 | Open in IMG/M |
3300018051|Ga0184620_10013531 | Not Available | 1903 | Open in IMG/M |
3300018054|Ga0184621_10014808 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 2314 | Open in IMG/M |
3300018076|Ga0184609_10271226 | Not Available | 794 | Open in IMG/M |
3300018433|Ga0066667_10203955 | All Organisms → cellular organisms → Bacteria | 1456 | Open in IMG/M |
3300018482|Ga0066669_10590229 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Candidatus Udaeobacter → Candidatus Udaeobacter copiosus | 972 | Open in IMG/M |
3300019356|Ga0173481_10665143 | Not Available | 557 | Open in IMG/M |
3300019865|Ga0193748_1023010 | Not Available | 587 | Open in IMG/M |
3300019866|Ga0193756_1006128 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Candidatus Udaeobacter → Candidatus Udaeobacter copiosus | 1482 | Open in IMG/M |
3300019874|Ga0193744_1001333 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Candidatus Udaeobacter → Candidatus Udaeobacter copiosus | 4534 | Open in IMG/M |
3300019877|Ga0193722_1049227 | All Organisms → cellular organisms → Bacteria | 1069 | Open in IMG/M |
3300019880|Ga0193712_1075329 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Candidatus Udaeobacter → Candidatus Udaeobacter copiosus | 737 | Open in IMG/M |
3300019881|Ga0193707_1006983 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae | 3900 | Open in IMG/M |
3300019885|Ga0193747_1029632 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Candidatus Udaeobacter → Candidatus Udaeobacter copiosus | 1357 | Open in IMG/M |
3300019887|Ga0193729_1007853 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Candidatus Udaeobacter → Candidatus Udaeobacter copiosus | 4940 | Open in IMG/M |
3300019887|Ga0193729_1028342 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae | 2381 | Open in IMG/M |
3300019888|Ga0193751_1131566 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Candidatus Udaeobacter → Candidatus Udaeobacter copiosus | 920 | Open in IMG/M |
3300019996|Ga0193693_1007081 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 2378 | Open in IMG/M |
3300020140|Ga0179590_1017253 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Candidatus Udaeobacter → Candidatus Udaeobacter copiosus | 1653 | Open in IMG/M |
3300020170|Ga0179594_10279315 | Not Available | 631 | Open in IMG/M |
3300021413|Ga0193750_1008247 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 2676 | Open in IMG/M |
3300021413|Ga0193750_1025458 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 1381 | Open in IMG/M |
3300021413|Ga0193750_1044517 | Not Available | 954 | Open in IMG/M |
3300021413|Ga0193750_1064985 | Not Available | 724 | Open in IMG/M |
3300025903|Ga0207680_10121575 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Chthoniobacter → Chthoniobacter flavus | 1708 | Open in IMG/M |
3300025915|Ga0207693_10167488 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 1730 | Open in IMG/M |
3300025960|Ga0207651_10131696 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Chthoniobacter → Chthoniobacter flavus | 1915 | Open in IMG/M |
3300025960|Ga0207651_11512167 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Chthoniobacter → Chthoniobacter flavus | 605 | Open in IMG/M |
3300026078|Ga0207702_10451944 | All Organisms → cellular organisms → Bacteria | 1247 | Open in IMG/M |
3300026305|Ga0209688_1020214 | All Organisms → cellular organisms → Bacteria | 1287 | Open in IMG/M |
3300026312|Ga0209153_1189884 | All Organisms → cellular organisms → Bacteria | 731 | Open in IMG/M |
3300026325|Ga0209152_10168135 | Not Available | 825 | Open in IMG/M |
3300026333|Ga0209158_1200350 | All Organisms → cellular organisms → Bacteria | 698 | Open in IMG/M |
3300026524|Ga0209690_1022364 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Chthoniobacter → Chthoniobacter flavus | 3170 | Open in IMG/M |
3300026527|Ga0209059_1315644 | Not Available | 529 | Open in IMG/M |
3300026528|Ga0209378_1151008 | All Organisms → cellular organisms → Bacteria | 926 | Open in IMG/M |
3300026530|Ga0209807_1015990 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 3677 | Open in IMG/M |
3300026550|Ga0209474_10017237 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Chthoniobacter → Chthoniobacter flavus | 5650 | Open in IMG/M |
3300026552|Ga0209577_10019326 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Chthoniobacter → Chthoniobacter flavus | 6052 | Open in IMG/M |
3300026552|Ga0209577_10644401 | All Organisms → cellular organisms → Bacteria | 614 | Open in IMG/M |
3300027457|Ga0207625_102590 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 798 | Open in IMG/M |
3300027514|Ga0208338_1002528 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 777 | Open in IMG/M |
3300028536|Ga0137415_10013356 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Chthoniobacter → Chthoniobacter flavus | 8144 | Open in IMG/M |
3300028778|Ga0307288_10152450 | All Organisms → cellular organisms → Bacteria | 871 | Open in IMG/M |
3300028881|Ga0307277_10201885 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 871 | Open in IMG/M |
3300031474|Ga0170818_106087861 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Chthoniobacter → Chthoniobacter flavus | 712 | Open in IMG/M |
3300031954|Ga0306926_11310478 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 845 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 26.50% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 25.64% |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 18.80% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 5.13% |
Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 4.27% |
Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 2.56% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 2.56% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 1.71% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.71% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 1.71% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 0.85% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 0.85% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.85% |
Grass Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grass Soil | 0.85% |
Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 0.85% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 0.85% |
Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.85% |
Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 0.85% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.85% |
Miscanthus Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere | 0.85% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.85% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
2065487018 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
2170459010 | Grass soil microbial communities from Rothamsted Park, UK - December 2009 direct MP BIO1O1 lysis 0-9cm (no DNA from 10 to 21cm!!!) | Environmental | Open in IMG/M |
3300000956 | Soil microbial communities from Great Prairies - Kansas, Native Prairie soil | Environmental | Open in IMG/M |
3300005167 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_121 | Environmental | Open in IMG/M |
3300005171 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_126 | Environmental | Open in IMG/M |
3300005176 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_128 | Environmental | Open in IMG/M |
3300005181 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_127 | Environmental | Open in IMG/M |
3300005186 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_125 | Environmental | Open in IMG/M |
3300005187 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124 | Environmental | Open in IMG/M |
3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 | Host-Associated | Open in IMG/M |
3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Host-Associated | Open in IMG/M |
3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Environmental | Open in IMG/M |
3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Environmental | Open in IMG/M |
3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Environmental | Open in IMG/M |
3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Environmental | Open in IMG/M |
3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Host-Associated | Open in IMG/M |
3300005540 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_146 | Environmental | Open in IMG/M |
3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Host-Associated | Open in IMG/M |
3300005560 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_119 | Environmental | Open in IMG/M |
3300005566 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_142 | Environmental | Open in IMG/M |
3300005569 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_154 | Environmental | Open in IMG/M |
3300005586 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_140 | Environmental | Open in IMG/M |
3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Host-Associated | Open in IMG/M |
3300006032 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145 | Environmental | Open in IMG/M |
3300006034 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_105 | Environmental | Open in IMG/M |
3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Environmental | Open in IMG/M |
3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) | Host-Associated | Open in IMG/M |
3300006794 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107 | Environmental | Open in IMG/M |
3300006800 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 | Environmental | Open in IMG/M |
3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Environmental | Open in IMG/M |
3300009143 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 | Environmental | Open in IMG/M |
3300009792 | Tropical forest soil microbial communities from Panama - MetaG Plot_12 | Environmental | Open in IMG/M |
3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Environmental | Open in IMG/M |
3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
3300012205 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG | Environmental | Open in IMG/M |
3300012208 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaG | Environmental | Open in IMG/M |
3300012210 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaG | Environmental | Open in IMG/M |
3300012349 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Sage2_R_115_16 metaG | Environmental | Open in IMG/M |
3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
3300012582 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_20_16 metaG | Environmental | Open in IMG/M |
3300012917 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaG | Environmental | Open in IMG/M |
3300012918 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaG | Environmental | Open in IMG/M |
3300012924 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012927 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012930 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012951 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_226_MG | Environmental | Open in IMG/M |
3300012955 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_216_MG | Environmental | Open in IMG/M |
3300012958 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_221_MG | Environmental | Open in IMG/M |
3300012960 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MG | Environmental | Open in IMG/M |
3300012961 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_202_MG | Environmental | Open in IMG/M |
3300012977 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_20cm_5_24_1 metaG | Environmental | Open in IMG/M |
3300012984 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_247_MG | Environmental | Open in IMG/M |
3300012985 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_246_MG | Environmental | Open in IMG/M |
3300012988 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_242_MG | Environmental | Open in IMG/M |
3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Host-Associated | Open in IMG/M |
3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Host-Associated | Open in IMG/M |
3300015077 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S178-409R-2 (version 2) | Environmental | Open in IMG/M |
3300015242 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
3300017997 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_100_coex | Environmental | Open in IMG/M |
3300018000 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_5_coex | Environmental | Open in IMG/M |
3300018051 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_5_b1 | Environmental | Open in IMG/M |
3300018054 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_30_b1 | Environmental | Open in IMG/M |
3300018076 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_60_coex | Environmental | Open in IMG/M |
3300018433 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116 | Environmental | Open in IMG/M |
3300018482 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118 | Environmental | Open in IMG/M |
3300019356 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S073-202C-2 (version 2) | Environmental | Open in IMG/M |
3300019865 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L1s1 | Environmental | Open in IMG/M |
3300019866 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H1m1 | Environmental | Open in IMG/M |
3300019874 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L1a1 | Environmental | Open in IMG/M |
3300019877 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2m1 | Environmental | Open in IMG/M |
3300019880 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H3a1 | Environmental | Open in IMG/M |
3300019881 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U3c2 | Environmental | Open in IMG/M |
3300019885 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L1m2 | Environmental | Open in IMG/M |
3300019887 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1c2 | Environmental | Open in IMG/M |
3300019888 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L1c2 | Environmental | Open in IMG/M |
3300019996 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L3a2 | Environmental | Open in IMG/M |
3300020140 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300020170 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad1_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300021413 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L1c1 | Environmental | Open in IMG/M |
3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026305 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_142 (SPAdes) | Environmental | Open in IMG/M |
3300026312 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_120 (SPAdes) | Environmental | Open in IMG/M |
3300026325 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107 (SPAdes) | Environmental | Open in IMG/M |
3300026333 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_140 (SPAdes) | Environmental | Open in IMG/M |
3300026524 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_150 (SPAdes) | Environmental | Open in IMG/M |
3300026527 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_151 (SPAdes) | Environmental | Open in IMG/M |
3300026528 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156 (SPAdes) | Environmental | Open in IMG/M |
3300026530 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_154 (SPAdes) | Environmental | Open in IMG/M |
3300026550 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145 (SPAdes) | Environmental | Open in IMG/M |
3300026552 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 (SPAdes) | Environmental | Open in IMG/M |
3300027457 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-ROWE17-D (SPAdes) | Environmental | Open in IMG/M |
3300027514 | Forest soil microbial communities from Browns Valley, California, USA, that are Nitrogen fertilized - NN91 (SPAdes) | Environmental | Open in IMG/M |
3300028536 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
3300028778 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_142 | Environmental | Open in IMG/M |
3300028881 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_116 | Environmental | Open in IMG/M |
3300031474 | Fir Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
3300031954 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2) | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
GPINP_00176980 | 2065487018 | Soil | LRDRRTRQVVAAILTALLVLAVWKFIDWRMTPPPPPNSIVTPAAKP |
F62_00427120 | 2170459010 | Grass Soil | RSGSTRFRSSLLRDRRIRQVVGAILAALLVLAVWKFIDWRMTPPPPANSTATPAAKP |
JGI10216J12902_1184219913 | 3300000956 | Soil | LVAAIITALLVLAVWKFIDWRMAPPLPPNEIASPVPTP* |
Ga0066672_104672761 | 3300005167 | Soil | LRDRRIRQVVGAILAALLVLAVWKYIDWRMTPPPPPNSVATPAAKP* |
Ga0066677_100282723 | 3300005171 | Soil | VRERRTRQVVAAILTALLVLAVWKFIDWRMTPPPPPNSIATPAAKP* |
Ga0066679_104254493 | 3300005176 | Soil | LHDRRIRQVVGAILTALLVLAIWKFIDWRMTPPPPPNSVATPAAKP* |
Ga0066678_109621731 | 3300005181 | Soil | LRDRRIRQVVSAILTALLVLAVWKLIDWRMTPPPPANSIATPAAKQ* |
Ga0066676_101820933 | 3300005186 | Soil | LRDRRIRQVVSAILTALLVLAVWKFIDWRMTAPPPPNSVATPAAKP* |
Ga0066675_102733441 | 3300005187 | Soil | LRDRRIRQVVGAILAALLVLAVWKYIDWRMTPPPPPNSVATPAAK |
Ga0065704_100316381 | 3300005289 | Switchgrass Rhizosphere | LRDRRIRQVVGAILTALLVLAVWKFIDWRMTPPPPPNSFATPAAKP* |
Ga0070675_1014873532 | 3300005354 | Miscanthus Rhizosphere | VRTRQLVAAIITALLVLAVWKFIDWRMTPPPPPNAVSTPTATP* |
Ga0070709_102519033 | 3300005434 | Corn, Switchgrass And Miscanthus Rhizosphere | STRFRSSLLRDRRIRQVVGAILTALLVLGVWKFIDWRMTPPPPPNSIATPAAKP* |
Ga0070713_1014430241 | 3300005436 | Corn, Switchgrass And Miscanthus Rhizosphere | TRFRSSLLRDRRIRQVVGAILTALLVLAVWKFIDWRMTPPPPPNSVATPAAKP* |
Ga0070711_1020824112 | 3300005439 | Corn, Switchgrass And Miscanthus Rhizosphere | PISILRWRSGSTRFRSSLLRDRRTRQVVAAILTALLVLAVWKFIDWRMTPPPPPNSIATPAAKP* |
Ga0070697_1005413142 | 3300005536 | Corn, Switchgrass And Miscanthus Rhizosphere | LRDRRIRQVVGAILTALLVLAVWKFIDWRMTPPPPANSIATPAAKP* |
Ga0068853_1002081531 | 3300005539 | Corn Rhizosphere | LRDRRIREVVGAILTALLVLAVWKFIDWRMTPPPPPNSFATPAAKP* |
Ga0066697_102125391 | 3300005540 | Soil | FRSSLLRDRRIRQVVGAILAALLVLAVWKYIDWRMTPPPPPNSVATPAAKP* |
Ga0070672_1006995943 | 3300005543 | Miscanthus Rhizosphere | ISILRWRSGSTRFRSSLLRDRRIRQVVGAILTALLVLAVWKFIDWRMTPPPPPNSFATPAAKP* |
Ga0066670_103087252 | 3300005560 | Soil | LTSTRQLVAAIITALLVLAVWKFIDWRMTPPLPPNRNTAPAKQ* |
Ga0066693_101162042 | 3300005566 | Soil | LTSTRQLVAAIITALLVLAVWKFIDWRMTPPPPPIRNTAPAKQ* |
Ga0066693_103788611 | 3300005566 | Soil | LRDRRIRQVVGAILTALLVLAVWKFIDWRMTPPPPPNSVASPAAKP* |
Ga0066705_106429691 | 3300005569 | Soil | AILTALLVLAVWKFIDWRMTPPPPPNSVATPAAKP* |
Ga0066691_103406772 | 3300005586 | Soil | LRDRRIRQVVGAILAALLVLAVWKYIDWRMTPPPPPNSVATRAAKP* |
Ga0068856_1005435301 | 3300005614 | Corn Rhizosphere | LRDRRIRQVVGAILTALLALAVWKFIDWRMTPPPPPNSFATPAAKP* |
Ga0066696_102075843 | 3300006032 | Soil | LVAAIITALLVLAVWKFIDWRMTPPPPPIRNTAPAKQ* |
Ga0066656_106809211 | 3300006034 | Soil | VRERRTRQVVAAILTALLVLAVWKFIDWRMTPPPPPNSIA |
Ga0070712_1002669123 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | PISILRWRSGSTRFRSSQLRDRRIRQVVGAILTALLVLAVWKFIDWRMTPPPPPNSIATPAAKP* |
Ga0097621_1010889962 | 3300006237 | Miscanthus Rhizosphere | LRETRTRQIVAAILTALLVLAVWKFIDWRMTPPPPPNSFATPAAKP* |
Ga0066658_102432582 | 3300006794 | Soil | LRDRRIRQVVGAILAALLVLAVWKYIDWRMTPPPPPNSVAAPAAKP* |
Ga0066658_109011221 | 3300006794 | Soil | VRERRTRQVVAAILTALLVLAVWKFIDWRMTPPPPPNS |
Ga0066660_101079463 | 3300006800 | Soil | TRFRSSLLRDRRIRQVVGAILAALLVLAVWKYIDWRMTPPTPPNSVATPAAKP* |
Ga0066660_101243263 | 3300006800 | Soil | LRDRRIRQVVGAILTALLVLAVWKFIDWRMTPPPPPNSVA |
Ga0099795_101477863 | 3300007788 | Vadose Zone Soil | LRDRRIRQLVGAILTALLVLAVWKFIDWRMTPPPPPNSIATPAAKP* |
Ga0099792_104863491 | 3300009143 | Vadose Zone Soil | LRDRRIRQVVGAILTALLVLAIWKFIDWRMTPPPPANSIATPAAKP* |
Ga0126374_106600223 | 3300009792 | Tropical Forest Soil | LTSTRQLVAAIITALLVLAVWKFIDWRMTPPLPPNGITTPTATP* |
Ga0099796_101592093 | 3300010159 | Vadose Zone Soil | LRDRRIRQVVGAILTALLVLAVWKFIDWRMTPPRPANSIATPAAKP* |
Ga0137363_111419692 | 3300012202 | Vadose Zone Soil | LRDRRTRQVVAAILTALLVLAVWKFIDWRMTPPPPPNSIATPAAKP* |
Ga0137363_116229282 | 3300012202 | Vadose Zone Soil | LRDRRIRQVVGAILTALLVLAVWKLIDWRMTPPPPANSIATPAAKP* |
Ga0137399_104652394 | 3300012203 | Vadose Zone Soil | LRDRRIRQVVGAILTALLVLAVWKFIDWRMTPPPPTNSIATPAAKP* |
Ga0137362_102822223 | 3300012205 | Vadose Zone Soil | LRERRIRQVVAAILTALLVLAVWKFIDWRMTSPPPPNSIATPAAKP* |
Ga0137376_111676422 | 3300012208 | Vadose Zone Soil | RIRQVVGAILAALLVLAVWKYIDWRMTPPPPPNSVATPAAKP* |
Ga0137378_109288112 | 3300012210 | Vadose Zone Soil | LRDRRIRQVVGAILTALLVLAVWKFIDWRMTPPPPPNSVATPAAKP* |
Ga0137387_102571673 | 3300012349 | Vadose Zone Soil | MRTRQVVGAILTALLVLAVWKLIDWRMTPPPPANSIATPAAKP* |
Ga0137360_103344692 | 3300012361 | Vadose Zone Soil | LRDRRIRQVVGAILTALLVLAVWKFIDWRMTPPPPPNSIATPAAKP* |
Ga0137358_105115121 | 3300012582 | Vadose Zone Soil | LRDRRIRQVVGAILTALLVLAVWKFIDWRMTPPRPANSIAIPAAKP* |
Ga0137358_107089372 | 3300012582 | Vadose Zone Soil | LRDRRIRQVVGAILTALFVLAVWKFIDWRMTQPPPPNSVATPAAKP* |
Ga0137395_101444462 | 3300012917 | Vadose Zone Soil | LRDRRIRQVVGAILAALLVLAVWKFIDWRMTPPPPPNSVATPAEKP* |
Ga0137396_108269402 | 3300012918 | Vadose Zone Soil | LHDRRIRQVVGAILTALLVLAVWKFIDWRMTPPRPANSIATPAAKP* |
Ga0137413_101210312 | 3300012924 | Vadose Zone Soil | LRDRRTRQVVAAILTALLVLAVWKFIDWRMTPPPPPNAVATPAAKP* |
Ga0137416_103444001 | 3300012927 | Vadose Zone Soil | LRDRRTRQVVAAILTALLVLVVWKFIDWRMTAPPPPNSIATPAAKP* |
Ga0137407_100895273 | 3300012930 | Vadose Zone Soil | LRDRRIRQVVGAILAALLVLAVWKFIDWRMTPPPPPNSVASPAAKP* |
Ga0164300_102378302 | 3300012951 | Soil | VRTRQLVAAIITALLVLGVWKFIDWRMTPPPPPNALATPTATP* |
Ga0164300_106149582 | 3300012951 | Soil | SSLLRDRRIRQVVGAILTALLVLAVWKFIDWRMTPPPPPNSFATPAAKP* |
Ga0164298_100552723 | 3300012955 | Soil | VGAILTALLVLAVWKFIDWRMTPPPPPNSFATPAAKP* |
Ga0164298_102175223 | 3300012955 | Soil | LRDRRIRQIVGAILTALLVLAVWKFIDWRMTPPPPPNSIATPAAKP* |
Ga0164299_116596672 | 3300012958 | Soil | LRDRRIRQVVGAILTALLVLAVWKFIDWRMTPPPPPNS |
Ga0164301_104324861 | 3300012960 | Soil | LRDRRTRQVVAAILTALLVLAVWKFIDWRMTPPPP |
Ga0164301_106926732 | 3300012960 | Soil | VRTRQLVAAIITALLVLGVWKFIDWRMTPPPPPNAVAIPTATP* |
Ga0164302_100135863 | 3300012961 | Soil | LVAAIITGLLVLAVWKFIDWRMTPPPPPNAVAIPTATP* |
Ga0164302_109606611 | 3300012961 | Soil | LRDRRIRQIVGAILTALLVLAVWKFIDWRMTPPPPPNSFATP |
Ga0134087_102554551 | 3300012977 | Grasslands Soil | TSTRQLVAAIITALLVLAVWKFIDWRMTPPPTPIRNTAPAKQ* |
Ga0164309_100395114 | 3300012984 | Soil | RWRSGSTRFRSSLLRDRRIRQVVGAILTALLVLAVWKFIDWRMTPPPPPNSVATPAAKP* |
Ga0164308_107894242 | 3300012985 | Soil | LRDRRTRQVVAAILTALLVLAVWKFIDWRMTPPPPPNSFATPAAKP* |
Ga0164306_104395452 | 3300012988 | Soil | LRDRRIRQVVGAILTALLVLAVWKFIDWRMTPPPPVNSIATPAAKP* |
Ga0157373_113960231 | 3300013100 | Corn Rhizosphere | LRDRRIRQVVSAILTALLVLAVWKFIDWRMTPPPPANSIATPAAKP* |
Ga0157375_112712452 | 3300013308 | Miscanthus Rhizosphere | LRDRRIRQLVGAILTALLVLAVWKFIDWRMTPPPPPNSFATPAAKP* |
Ga0157375_125100012 | 3300013308 | Miscanthus Rhizosphere | LRDRRIRQVVGAILTALLALAVWKFIDWRMTPPPPPNSIATPAAKP* |
Ga0173483_101283383 | 3300015077 | Soil | GSTRFRSSLLRDRRIRQVVGAILTALLVLAVWKFIDWRMTPPPPPNSFATPAAKP* |
Ga0137412_101216802 | 3300015242 | Vadose Zone Soil | LRDRRIRQVVGAILAALLVLAVWKFIDWRMTPPPPPNAVATPAAKP* |
Ga0184610_12184471 | 3300017997 | Groundwater Sediment | LRDRRIRPVVGAILTALLGLAVWKFIDWRMTPPPPANSIATPAA |
Ga0184604_100650722 | 3300018000 | Groundwater Sediment | VREWRTRQVVAAIITALLVLAVWKFIDWRMTPPPPPNSIATPAAKP |
Ga0184620_100135312 | 3300018051 | Groundwater Sediment | LRDRRIRQVVGAILTALLVLAIWKFIDWRMTPPPPPNSIATPAAKP |
Ga0184621_100148081 | 3300018054 | Groundwater Sediment | VRERRTRQVVAAIITALLVLVVWKFIDWRMTPPPPPNSITTPAAKP |
Ga0184609_102712262 | 3300018076 | Groundwater Sediment | LRDRRIRQVVSAILTALLVLAIWKFIDWRMTPPPPPNSIATPAAKP |
Ga0066667_102039552 | 3300018433 | Grasslands Soil | LRDRRIRQVVGAILAALLVLAVWKYIDWRMTPPPPPNSVATPAAKP |
Ga0066669_105902292 | 3300018482 | Grasslands Soil | LTSTRQLVAAIITALLVLAVWKFIDWRMTPPPPPNRIAAPTAAP |
Ga0173481_106651432 | 3300019356 | Soil | LRDRRIRQVVGAILTALLVLAVWKFIDWRMTPPPPPNSFATPAAKP |
Ga0193748_10230103 | 3300019865 | Soil | LRDRRIRQVVGAILTALLVLAIWKFIDWRMTPPPPPN |
Ga0193756_10061281 | 3300019866 | Soil | LRDRRIRQVVGAILTALLVLAVWKFIDWRMTPPPPANSIATPAAKP |
Ga0193744_10013333 | 3300019874 | Soil | LRDRRIRQVVGAILTALLVLAIWKFIDLRMTPPPPPNSIATPVAKP |
Ga0193722_10492272 | 3300019877 | Soil | LRDRRIRQVVGAILTALLVLAVWKFIDWRITPPPPPNSIATPAAKP |
Ga0193712_10753291 | 3300019880 | Soil | LRDRRIRQVVGAILTALLVLAVWKFIDWRMTPPPPPNSVATPAAKP |
Ga0193707_10069832 | 3300019881 | Soil | LRDRRIRQVVGAILTALLVLAIWKFIDWRMTPPPPPNSIATPVAKP |
Ga0193747_10296323 | 3300019885 | Soil | LRDRRIRQVVGAILTALLVLAVWKFIDWRMTPPPPPNSIATPAAKP |
Ga0193729_10078534 | 3300019887 | Soil | LRDRRTRQVVAAILTALLVLAVWKFIDWRMTPPPPPNSIATPAAKP |
Ga0193729_10283423 | 3300019887 | Soil | LRDRRTRQVVAAILTALLVLVVWKFIDWRMTAPPPPNSIATPAAKP |
Ga0193751_11315661 | 3300019888 | Soil | LRDRRIRQVVGAILTALLVLAIWKFIDLRMTPPPPPNSIASPAAKP |
Ga0193693_10070811 | 3300019996 | Soil | LRDRRIRQVVGAILTALLVLAIWKFIDWRMTPPPPPNSIATPV |
Ga0179590_10172531 | 3300020140 | Vadose Zone Soil | LRDRRIRQVVGAILTALLVLVIWKFIDWRMTPPPPPKSIGTPAAKP |
Ga0179594_102793151 | 3300020170 | Vadose Zone Soil | LRDRRIRQVVGAILAALLVLAVWKFIDWRMTPPPPPNSVASPAAKP |
Ga0193750_10082472 | 3300021413 | Soil | LRERRIRQVVGAILTALLVLAVWKFIDWRMTPPPPANSIATPAAKP |
Ga0193750_10254581 | 3300021413 | Soil | SGSTRFRSSLLRDRRIRQVVGAILTALLVLAIWKFIEWRMTPPPPPNSIATPAAKP |
Ga0193750_10445173 | 3300021413 | Soil | LRDRRIRQVVGAILTALLVLAVWKFIDWRMTPPPPPNSIAIPAAKR |
Ga0193750_10649852 | 3300021413 | Soil | LRDRRIRQVVGAILTALLVLAIWKFIDLRMTPPPPPNSIATPAAKP |
Ga0207680_101215753 | 3300025903 | Switchgrass Rhizosphere | VGAILTALLVLAVWKFIDWRMTPPPPPNSFATPAAKP |
Ga0207693_101674883 | 3300025915 | Corn, Switchgrass And Miscanthus Rhizosphere | PISILRWRSGSTRFRSSQLRDRRIRQVVGAILTALLVLAVWKFIDWRMTPPPPPNSIATPAAKP |
Ga0207651_101316961 | 3300025960 | Switchgrass Rhizosphere | FRSSLLRDRRIRQVVGAILTALLVLAVWKFIDWRMTPPPPPNSFATPAAKP |
Ga0207651_115121672 | 3300025960 | Switchgrass Rhizosphere | LVAAIITALLVLAVWKFIDWRMTPPPPPNAVSTPTATP |
Ga0207702_104519441 | 3300026078 | Corn Rhizosphere | LRDRRIRQVVGAILTALLALAVWKFIDWRMTPPPPPNSIATPAAKP |
Ga0209688_10202141 | 3300026305 | Soil | VRETRTRQVVAAILTALLVLVVWKFIDWRMTAPPPPNRIST |
Ga0209153_11898841 | 3300026312 | Soil | VRETRTRQVVAAIFTALLLLVVWKFIDWRMTPPPP |
Ga0209152_101681352 | 3300026325 | Soil | LRDRRIRQVVGAILAALLVLAVWKYIDWRMTPPPPPNSVAARAAKP |
Ga0209158_12003501 | 3300026333 | Soil | LRDRRIRQVVGAILAALLVLAVWKYIDWRMTPPPPPNSVA |
Ga0209690_10223645 | 3300026524 | Soil | VRETRTRQVVAAVITALLVLVVWKFIDWRMTPPPPPNNLASPVAKP |
Ga0209059_13156442 | 3300026527 | Soil | LRDRRTRQVVAAILTALLVLAVWKFIDWRMTPPPPPNSVASPAAKP |
Ga0209378_11510081 | 3300026528 | Soil | VRERRTRQVVAAILTALLVLAVWKFIDWRMTPPPPPNSIATPAAKP |
Ga0209807_10159903 | 3300026530 | Soil | LTSTRQLVAAIITALLVLAVWKFIDWRMTPPLPPNRNTAPAKQ |
Ga0209474_100172376 | 3300026550 | Soil | QVVSAILTALLVLAVWKFIDWRMTPPPPPNSVATPAAKP |
Ga0209577_100193264 | 3300026552 | Soil | LRDRRIRQVVGAILTALLVLAVWKFIDWRMTPPPPPNSVASPAAKP |
Ga0209577_106444011 | 3300026552 | Soil | RDRRIRQVVGAILAALLVLAVWKYIDWRMTPPPPPNSVATPAAKP |
Ga0207625_1025901 | 3300027457 | Soil | SSLLRDRRIRQVVGAILTALLVLAVWKFIDWRMTPPPPPNSFATPAAKP |
Ga0208338_10025281 | 3300027514 | Soil | FRSSLLRDRRIRQVVGAILTALLVLAVWKFIDWRMTPPPPPNSVATPAAKP |
Ga0137415_100133565 | 3300028536 | Vadose Zone Soil | LRDRRIRQLVGAILTALLVLAVWKFIDWRMTPPPPPNSVATPAEKP |
Ga0307288_101524503 | 3300028778 | Soil | LTSTRQVVAAIITALLVLAVWKFIDWRMTPPPPPNSIATPAAKP |
Ga0307277_102018852 | 3300028881 | Soil | LRDRRIRQVVGAILTALLVLAIWKFIDWRMTPPPPPNSVATPAAKP |
Ga0170818_1060878612 | 3300031474 | Forest Soil | LRDRRTRQVVAAILTALLVLAVWKFIDWRMTPPPPPNSFATPAAKP |
Ga0306926_113104783 | 3300031954 | Soil | LVAAIITALLVLAVWKFIDWRMTPPPPPNGIATPTATP |
⦗Top⦘ |