NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F077624

Metagenome / Metatranscriptome Family F077624

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F077624
Family Type Metagenome / Metatranscriptome
Number of Sequences 117
Average Sequence Length 46 residues
Representative Sequence MPKLPIFRLRNSEPPSRPDLQYYGLTLAFSDLQLGVDNLRYDVFL
Number of Associated Samples 108
Number of Associated Scaffolds 117

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 82.91 %
% of genes near scaffold ends (potentially truncated) 99.15 %
% of genes from short scaffolds (< 2000 bps) 81.20 %
Associated GOLD sequencing projects 103
AlphaFold2 3D model prediction Yes
3D model pTM-score0.13

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (96.581 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland
(16.239 % of family members)
Environment Ontology (ENVO) Unclassified
(45.299 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(41.026 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 4.11%    β-sheet: 0.00%    Coil/Unstructured: 95.89%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  		pTM-score: 0.13
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 117 Family Scaffolds
PF00578AhpC-TSA 27.35
PF04389Peptidase_M28 26.50
PF00730HhH-GPD 4.27
PF14534DUF4440 1.71
PF14815NUDIX_4 0.85
PF13414TPR_11 0.85
PF00106adh_short 0.85
PF04321RmlD_sub_bind 0.85
PF00135COesterase 0.85
PF06537DHOR 0.85
PF13439Glyco_transf_4 0.85
PF01230HIT 0.85

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 117 Family Scaffolds
COG1194Adenine-specific DNA glycosylase, acts on AG and A-oxoG pairsReplication, recombination and repair [L] 4.27
COG22313-Methyladenine DNA glycosylase, HhH-GPD/Endo3 superfamilyReplication, recombination and repair [L] 4.27
COG01223-methyladenine DNA glycosylase/8-oxoguanine DNA glycosylaseReplication, recombination and repair [L] 4.27
COG0177Endonuclease IIIReplication, recombination and repair [L] 4.27
COG1059Thermostable 8-oxoguanine DNA glycosylaseReplication, recombination and repair [L] 4.27
COG0451Nucleoside-diphosphate-sugar epimeraseCell wall/membrane/envelope biogenesis [M] 1.71
COG0702Uncharacterized conserved protein YbjT, contains NAD(P)-binding and DUF2867 domainsGeneral function prediction only [R] 1.71
COG1086NDP-sugar epimerase, includes UDP-GlcNAc-inverting 4,6-dehydratase FlaA1 and capsular polysaccharide biosynthesis protein EpsCCell wall/membrane/envelope biogenesis [M] 1.71
COG1089GDP-D-mannose dehydrataseCell wall/membrane/envelope biogenesis [M] 0.85
COG1090NAD dependent epimerase/dehydratase family enzymeGeneral function prediction only [R] 0.85
COG1091dTDP-4-dehydrorhamnose reductaseCell wall/membrane/envelope biogenesis [M] 0.85
COG2272Carboxylesterase type BLipid transport and metabolism [I] 0.85
COG3488Uncharacterized conserved protein with two CxxC motifs, DUF1111 familyGeneral function prediction only [R] 0.85
COG1087UDP-glucose 4-epimeraseCell wall/membrane/envelope biogenesis [M] 0.85
COG1088dTDP-D-glucose 4,6-dehydrataseCell wall/membrane/envelope biogenesis [M] 0.85

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms96.58 %
UnclassifiedrootN/A3.42 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300001154|JGI12636J13339_1025509All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → unclassified Terriglobales → Terriglobales bacterium807Open in IMG/M
3300001356|JGI12269J14319_10037784All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis3077Open in IMG/M
3300001593|JGI12635J15846_10771684All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → unclassified Terriglobales → Terriglobales bacterium552Open in IMG/M
3300001632|JGI20235J16296_1008511All Organisms → cellular organisms → Bacteria → Acidobacteria541Open in IMG/M
3300004080|Ga0062385_10937384All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → unclassified Terriglobales → Terriglobales bacterium577Open in IMG/M
3300005445|Ga0070708_100916117All Organisms → cellular organisms → Bacteria → Acidobacteria823Open in IMG/M
3300005537|Ga0070730_10104126All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → unclassified Terriglobales → Terriglobales bacterium1961Open in IMG/M
3300005602|Ga0070762_10020849All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium3420Open in IMG/M
3300005938|Ga0066795_10003625All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae3873Open in IMG/M
3300006052|Ga0075029_100045428All Organisms → cellular organisms → Bacteria → Acidobacteria2532Open in IMG/M
3300006162|Ga0075030_101546259All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium519Open in IMG/M
3300006174|Ga0075014_100669402All Organisms → cellular organisms → Bacteria → Acidobacteria601Open in IMG/M
3300007258|Ga0099793_10352373All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → unclassified Terriglobales → Terriglobales bacterium719Open in IMG/M
3300009143|Ga0099792_10827791All Organisms → cellular organisms → Bacteria608Open in IMG/M
3300009525|Ga0116220_10272601All Organisms → cellular organisms → Bacteria → Acidobacteria741Open in IMG/M
3300009630|Ga0116114_1067171All Organisms → cellular organisms → Bacteria → Acidobacteria987Open in IMG/M
3300009636|Ga0116112_1209630All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium541Open in IMG/M
3300009643|Ga0116110_1024030All Organisms → cellular organisms → Bacteria → Acidobacteria2332Open in IMG/M
3300009665|Ga0116135_1144112All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → unclassified Terriglobales → Terriglobales bacterium887Open in IMG/M
3300009683|Ga0116224_10263650All Organisms → cellular organisms → Bacteria → Acidobacteria821Open in IMG/M
3300009683|Ga0116224_10494344All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → unclassified Terriglobales → Terriglobales bacterium583Open in IMG/M
3300009698|Ga0116216_10090116All Organisms → cellular organisms → Bacteria → Acidobacteria1887Open in IMG/M
3300009764|Ga0116134_1022085All Organisms → cellular organisms → Bacteria → Acidobacteria2587Open in IMG/M
3300009839|Ga0116223_10554734All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → unclassified Terriglobales → Terriglobales bacterium666Open in IMG/M
3300010341|Ga0074045_10019623All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae5334Open in IMG/M
3300011270|Ga0137391_11282023All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → unclassified Terriglobales → Terriglobales bacterium580Open in IMG/M
3300012205|Ga0137362_10922408All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → unclassified Terriglobales → Terriglobales bacterium745Open in IMG/M
3300012210|Ga0137378_11203279All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → unclassified Terriglobales → Terriglobales bacterium673Open in IMG/M
3300012917|Ga0137395_11137397All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → unclassified Terriglobales → Terriglobales bacterium551Open in IMG/M
3300014153|Ga0181527_1419476All Organisms → cellular organisms → Bacteria → Acidobacteria510Open in IMG/M
3300014156|Ga0181518_10071572All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae1999Open in IMG/M
3300014159|Ga0181530_10440539All Organisms → cellular organisms → Bacteria → Acidobacteria657Open in IMG/M
3300014167|Ga0181528_10269183All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → unclassified Terriglobales → Terriglobales bacterium920Open in IMG/M
3300014489|Ga0182018_10239511All Organisms → cellular organisms → Bacteria → Acidobacteria1002Open in IMG/M
3300014638|Ga0181536_10025019All Organisms → cellular organisms → Bacteria4659Open in IMG/M
3300014657|Ga0181522_10750416All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium597Open in IMG/M
3300016750|Ga0181505_10288301All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → unclassified Terriglobales → Terriglobales bacterium2341Open in IMG/M
3300017929|Ga0187849_1187389All Organisms → cellular organisms → Bacteria → Acidobacteria814Open in IMG/M
3300017934|Ga0187803_10483508All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium505Open in IMG/M
3300017938|Ga0187854_10240600All Organisms → cellular organisms → Bacteria → Acidobacteria788Open in IMG/M
3300017955|Ga0187817_10026657All Organisms → cellular organisms → Bacteria3480Open in IMG/M
3300017975|Ga0187782_10218310All Organisms → cellular organisms → Bacteria1429Open in IMG/M
3300018003|Ga0187876_1170940All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium746Open in IMG/M
3300018009|Ga0187884_10076911All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae1492Open in IMG/M
3300018009|Ga0187884_10221141All Organisms → cellular organisms → Bacteria → Acidobacteria776Open in IMG/M
3300018009|Ga0187884_10274011All Organisms → cellular organisms → Bacteria → Acidobacteria684Open in IMG/M
3300018023|Ga0187889_10388806All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium605Open in IMG/M
3300018025|Ga0187885_10324074All Organisms → cellular organisms → Bacteria → Acidobacteria695Open in IMG/M
3300018030|Ga0187869_10465041All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → unclassified Terriglobales → Terriglobales bacterium601Open in IMG/M
3300018035|Ga0187875_10386657All Organisms → cellular organisms → Bacteria → Acidobacteria749Open in IMG/M
3300018038|Ga0187855_10074828All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → unclassified Terriglobales → Terriglobales bacterium2068Open in IMG/M
3300018040|Ga0187862_10892389All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium509Open in IMG/M
3300018042|Ga0187871_10038097All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae2962Open in IMG/M
3300018042|Ga0187871_10187152Not Available1160Open in IMG/M
3300018042|Ga0187871_10650729All Organisms → cellular organisms → Bacteria → Acidobacteria586Open in IMG/M
3300018043|Ga0187887_10848412All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium540Open in IMG/M
3300018047|Ga0187859_10422655All Organisms → cellular organisms → Bacteria → Acidobacteria734Open in IMG/M
3300018057|Ga0187858_10171794All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → unclassified Terriglobales → Terriglobales bacterium1431Open in IMG/M
3300018062|Ga0187784_10949506All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium684Open in IMG/M
3300018064|Ga0187773_10619853All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → unclassified Terriglobales → Terriglobales bacterium664Open in IMG/M
3300018085|Ga0187772_10146758All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae1557Open in IMG/M
3300019787|Ga0182031_1341750All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1793Open in IMG/M
3300021178|Ga0210408_10725191All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → unclassified Terriglobales → Terriglobales bacterium782Open in IMG/M
3300021405|Ga0210387_10574122All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → unclassified Terriglobales → Terriglobales bacterium1002Open in IMG/M
3300021560|Ga0126371_13808232All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → unclassified Terriglobales → Terriglobales bacterium508Open in IMG/M
3300021861|Ga0213853_10100930All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae2425Open in IMG/M
3300023101|Ga0224557_1104170All Organisms → cellular organisms → Bacteria → Acidobacteria1138Open in IMG/M
3300024271|Ga0224564_1088675All Organisms → cellular organisms → Bacteria → Acidobacteria624Open in IMG/M
3300025406|Ga0208035_1064813All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium557Open in IMG/M
3300025412|Ga0208194_1073162Not Available522Open in IMG/M
3300025444|Ga0208189_1023432All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae1303Open in IMG/M
3300025453|Ga0208455_1053954All Organisms → cellular organisms → Bacteria → Acidobacteria848Open in IMG/M
3300025501|Ga0208563_1066819All Organisms → cellular organisms → Bacteria → Acidobacteria734Open in IMG/M
3300025507|Ga0208188_1015342All Organisms → cellular organisms → Bacteria → Acidobacteria2354Open in IMG/M
3300025612|Ga0208691_1155217Not Available516Open in IMG/M
3300025915|Ga0207693_11176093All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → unclassified Terriglobales → Terriglobales bacterium579Open in IMG/M
3300026318|Ga0209471_1157176All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → unclassified Terriglobales → Terriglobales bacterium931Open in IMG/M
3300026322|Ga0209687_1124941All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → unclassified Terriglobales → Terriglobales bacterium828Open in IMG/M
3300026325|Ga0209152_10440984All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → unclassified Terriglobales → Terriglobales bacterium522Open in IMG/M
3300026489|Ga0257160_1092307All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → unclassified Terriglobales → Terriglobales bacterium543Open in IMG/M
3300026557|Ga0179587_10413763All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → unclassified Terriglobales → Terriglobales bacterium880Open in IMG/M
3300027610|Ga0209528_1001112All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis5153Open in IMG/M
3300027662|Ga0208565_1048578All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae1370Open in IMG/M
3300027674|Ga0209118_1013038All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis2781Open in IMG/M
3300027678|Ga0209011_1129112All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → unclassified Terriglobales → Terriglobales bacterium720Open in IMG/M
3300027698|Ga0209446_1183697All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium538Open in IMG/M
3300027737|Ga0209038_10084542All Organisms → cellular organisms → Bacteria → Acidobacteria954Open in IMG/M
3300027745|Ga0209908_10198699All Organisms → cellular organisms → Bacteria → Acidobacteria548Open in IMG/M
3300027745|Ga0209908_10240380All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium508Open in IMG/M
3300027857|Ga0209166_10461696All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → unclassified Terriglobales → Terriglobales bacterium655Open in IMG/M
3300027882|Ga0209590_10670248All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → unclassified Terriglobales → Terriglobales bacterium665Open in IMG/M
3300027910|Ga0209583_10400035All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → unclassified Terriglobales → Terriglobales bacterium654Open in IMG/M
3300028746|Ga0302233_10212968All Organisms → cellular organisms → Bacteria → Acidobacteria737Open in IMG/M
3300028776|Ga0302303_10089962All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1136Open in IMG/M
3300029701|Ga0222748_1056539All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium685Open in IMG/M
3300029817|Ga0247275_1168056All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium544Open in IMG/M
3300029939|Ga0311328_10024644All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis5693Open in IMG/M
3300029951|Ga0311371_10772811All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → unclassified Terriglobales → Terriglobales bacterium1189Open in IMG/M
3300029951|Ga0311371_12238994All Organisms → cellular organisms → Bacteria → Acidobacteria568Open in IMG/M
3300029955|Ga0311342_10330022All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → unclassified Terriglobales → Terriglobales bacterium1367Open in IMG/M
3300029999|Ga0311339_11313748All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → unclassified Terriglobales → Terriglobales bacterium655Open in IMG/M
3300030041|Ga0302274_10396283All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → unclassified Terriglobales → Terriglobales bacterium617Open in IMG/M
3300030047|Ga0302286_10090486All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1578Open in IMG/M
3300030114|Ga0311333_10027411All Organisms → cellular organisms → Bacteria3952Open in IMG/M
3300030520|Ga0311372_11387341All Organisms → cellular organisms → Bacteria → Acidobacteria878Open in IMG/M
3300030580|Ga0311355_10206562All Organisms → cellular organisms → Bacteria2051Open in IMG/M
3300030580|Ga0311355_10612500All Organisms → cellular organisms → Bacteria → Acidobacteria1026Open in IMG/M
3300030706|Ga0310039_10163428All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → unclassified Terriglobales → Terriglobales bacterium894Open in IMG/M
3300030991|Ga0073994_12373794All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → unclassified Terriglobales → Terriglobales bacterium727Open in IMG/M
3300031028|Ga0302180_10061311All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium2237Open in IMG/M
3300031233|Ga0302307_10044783All Organisms → cellular organisms → Bacteria → Acidobacteria2379Open in IMG/M
3300031711|Ga0265314_10130895All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → unclassified Terriglobales → Terriglobales bacterium1565Open in IMG/M
3300031823|Ga0307478_10537497All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → unclassified Terriglobales → Terriglobales bacterium976Open in IMG/M
3300031823|Ga0307478_11237330All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium621Open in IMG/M
3300032892|Ga0335081_10151090All Organisms → cellular organisms → Bacteria → Acidobacteria3320Open in IMG/M
3300033158|Ga0335077_11193487Not Available745Open in IMG/M
3300033561|Ga0371490_1047986All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → unclassified Terriglobales → Terriglobales bacterium1279Open in IMG/M


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Peatland16.24%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland10.26%
PalsaEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa8.55%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil6.84%
Peatlands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil6.84%
BogEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog5.13%
Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil5.13%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil4.27%
WatershedsEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds3.42%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland3.42%
Bog Forest SoilEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil2.56%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil2.56%
BogEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Bog2.56%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment1.71%
Surface SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil1.71%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil1.71%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil1.71%
Thawing PermafrostEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Thawing Permafrost1.71%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere1.71%
FenEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Fen1.71%
WatershedsEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Watersheds0.85%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil0.85%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil0.85%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil0.85%
Bog Forest SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil0.85%
BogEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Bog0.85%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Soil0.85%
PalsaEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Palsa0.85%
SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Soil0.85%
SoilEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Soil0.85%
Peat SoilEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil0.85%
RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere0.85%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300001154Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_M1EnvironmentalOpen in IMG/M
3300001356Peat soil microbial communities from Weissenstadt, Germany - SII-SIP-2007EnvironmentalOpen in IMG/M
3300001593Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M2EnvironmentalOpen in IMG/M
3300001632Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF001EnvironmentalOpen in IMG/M
3300004080Coassembly of ECP04_OM1, ECP04_OM2, ECP04_OM3EnvironmentalOpen in IMG/M
3300005445Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaGEnvironmentalOpen in IMG/M
3300005537Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen01_05102014_R1EnvironmentalOpen in IMG/M
3300005602Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2EnvironmentalOpen in IMG/M
3300005938Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Permafrost soil replicate 2 DNA2013-191EnvironmentalOpen in IMG/M
3300006052Freshwater sediment microbial communities from North America - Little Laurel Run_MetaG_LLR_2013EnvironmentalOpen in IMG/M
3300006162Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012EnvironmentalOpen in IMG/M
3300006174Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2014EnvironmentalOpen in IMG/M
3300007258Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3EnvironmentalOpen in IMG/M
3300009143Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2EnvironmentalOpen in IMG/M
3300009525Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_7_NC metaGEnvironmentalOpen in IMG/M
3300009630Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_10_40EnvironmentalOpen in IMG/M
3300009636Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_8_150EnvironmentalOpen in IMG/M
3300009643Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_8_40EnvironmentalOpen in IMG/M
3300009665Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_20_10EnvironmentalOpen in IMG/M
3300009683Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_b_LC metaGEnvironmentalOpen in IMG/M
3300009698Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_3_AS metaGEnvironmentalOpen in IMG/M
3300009764Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_19_40EnvironmentalOpen in IMG/M
3300009839Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_a_PC metaGEnvironmentalOpen in IMG/M
3300010341Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM2EnvironmentalOpen in IMG/M
3300011270Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaGEnvironmentalOpen in IMG/M
3300012205Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaGEnvironmentalOpen in IMG/M
3300012210Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaGEnvironmentalOpen in IMG/M
3300012917Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaGEnvironmentalOpen in IMG/M
3300014153Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin06_60_metaGEnvironmentalOpen in IMG/M
3300014156Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin01_60_metaGEnvironmentalOpen in IMG/M
3300014159Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin10_60_metaGEnvironmentalOpen in IMG/M
3300014167Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin10_10_metaGEnvironmentalOpen in IMG/M
3300014489Permafrost microbial communities from Stordalen Mire, Sweden - 812P2M metaGEnvironmentalOpen in IMG/M
3300014638Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin17_60_metaGEnvironmentalOpen in IMG/M
3300014657Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_10_metaGEnvironmentalOpen in IMG/M
3300016750Metatranscriptome of peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_30_metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300017929Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_4_100EnvironmentalOpen in IMG/M
3300017934Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_3EnvironmentalOpen in IMG/M
3300017938Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_6_150EnvironmentalOpen in IMG/M
3300017955Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_2EnvironmentalOpen in IMG/M
3300017975Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP15_20_MGEnvironmentalOpen in IMG/M
3300018003Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_17_40EnvironmentalOpen in IMG/M
3300018009Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_20_40EnvironmentalOpen in IMG/M
3300018023Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_7_100EnvironmentalOpen in IMG/M
3300018025Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_20_100EnvironmentalOpen in IMG/M
3300018030Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_13_100EnvironmentalOpen in IMG/M
3300018035Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_17_10EnvironmentalOpen in IMG/M
3300018038Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_10EnvironmentalOpen in IMG/M
3300018040Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_10_150EnvironmentalOpen in IMG/M
3300018042Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_16_10EnvironmentalOpen in IMG/M
3300018043Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_7_10EnvironmentalOpen in IMG/M
3300018047Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_10_10EnvironmentalOpen in IMG/M
3300018057Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_150EnvironmentalOpen in IMG/M
3300018062Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP15_20_MGEnvironmentalOpen in IMG/M
3300018064Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP05_10_MGEnvironmentalOpen in IMG/M
3300018085Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_20_MGEnvironmentalOpen in IMG/M
3300019787Permafrost microbial communities from Stordalen Mire, Sweden - 812S3M metaG (PacBio error correction)EnvironmentalOpen in IMG/M
3300021178Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-MEnvironmentalOpen in IMG/M
3300021405Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-OEnvironmentalOpen in IMG/M
3300021560Tropical forest soil microbial communities from Panama - MetaG Plot_4EnvironmentalOpen in IMG/M
3300021861Metatranscriptome of freshwater sediment microbial communities from post-fracked creek in Pennsylvania, United States - ABR_2016 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300023101Peat soil microbial communities from Stordalen Mire, Sweden - 717 S3 10-14EnvironmentalOpen in IMG/M
3300024271Soil microbial communities from Bohemian Forest, Czech Republic ? CSU5EnvironmentalOpen in IMG/M
3300025406Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_11_10 (SPAdes)EnvironmentalOpen in IMG/M
3300025412Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_19_10 (SPAdes)EnvironmentalOpen in IMG/M
3300025444Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_10_40 (SPAdes)EnvironmentalOpen in IMG/M
3300025453Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_4_40 (SPAdes)EnvironmentalOpen in IMG/M
3300025501Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_17_150 (SPAdes)EnvironmentalOpen in IMG/M
3300025507Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_8_40 (SPAdes)EnvironmentalOpen in IMG/M
3300025612Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_20_10 (SPAdes)EnvironmentalOpen in IMG/M
3300025915Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300026318Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_128 (SPAdes)EnvironmentalOpen in IMG/M
3300026322Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_136 (SPAdes)EnvironmentalOpen in IMG/M
3300026325Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107 (SPAdes)EnvironmentalOpen in IMG/M
3300026489Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NL-11-AEnvironmentalOpen in IMG/M
3300026557Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungalEnvironmentalOpen in IMG/M
3300027610Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M3 (SPAdes)EnvironmentalOpen in IMG/M
3300027662Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_2_FS metaG (SPAdes)EnvironmentalOpen in IMG/M
3300027674Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_M1 (SPAdes)EnvironmentalOpen in IMG/M
3300027678Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM1_M3 (SPAdes)EnvironmentalOpen in IMG/M
3300027698Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP04_OM2 (SPAdes)EnvironmentalOpen in IMG/M
3300027737Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP03_OM3 (SPAdes)EnvironmentalOpen in IMG/M
3300027745Thawing permafrost microbial communities from the Arctic, studying carbon transformations - Permafrost 812P2MEnvironmentalOpen in IMG/M
3300027857Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen01_05102014_R1 (SPAdes)EnvironmentalOpen in IMG/M
3300027882Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300027910Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2014 (SPAdes)EnvironmentalOpen in IMG/M
3300028746Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N3_1EnvironmentalOpen in IMG/M
3300028776Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_E2_1EnvironmentalOpen in IMG/M
3300029701Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-O (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300029817Soil microbial communities from Marcell Experimental Forest, Minnesota, USA - Bog25EnvironmentalOpen in IMG/M
3300029939I_Bog_E3 coassemblyEnvironmentalOpen in IMG/M
3300029951III_Palsa_N1 coassemblyEnvironmentalOpen in IMG/M
3300029955II_Bog_E2 coassemblyEnvironmentalOpen in IMG/M
3300029999I_Palsa_E3 coassemblyEnvironmentalOpen in IMG/M
3300030041Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Bog_N2_1EnvironmentalOpen in IMG/M
3300030047Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Fen_E2_3EnvironmentalOpen in IMG/M
3300030114I_Fen_E2 coassemblyEnvironmentalOpen in IMG/M
3300030520III_Palsa_N2 coassemblyEnvironmentalOpen in IMG/M
3300030580II_Palsa_N1 coassemblyEnvironmentalOpen in IMG/M
3300030706Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_6_BS metaG (v2)EnvironmentalOpen in IMG/M
3300030991Metatranscriptome of forest soil microbial communities from Montana, USA - Site 5 -Soil GP-1A (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031028Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E3_2EnvironmentalOpen in IMG/M
3300031233Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_E3_2EnvironmentalOpen in IMG/M
3300031711Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaGHost-AssociatedOpen in IMG/M
3300031823Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05EnvironmentalOpen in IMG/M
3300032892Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.5EnvironmentalOpen in IMG/M
3300033158Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.1EnvironmentalOpen in IMG/M
3300033561Lab enriched peat soil microbial communities from McLean, Ithaca, NY, United States - MB28FN SIP fractionEnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
JGI12636J13339_102550923300001154Forest SoilMPKLPIFRLRNTEPPSRPDLQYYGLTLAFTDLKLGV
JGI12269J14319_1003778413300001356Peatlands SoilMPKLPIFRLRSSEPPSRPDLQYYGLKLAFSDLQLGVDNLRYDVFLSPRITADLSFHLGRY
JGI12635J15846_1077168413300001593Forest SoilMPKLPIFRLRNTEPPSRPDLQYYGLTLAFTDLKLGVDNLR
JGI20235J16296_100851113300001632Forest SoilMPKLPVFRLRSSEPPTLPDLQYRAIALALSNLQLGVD
Ga0062385_1093738423300004080Bog Forest SoilMPKLPIFRLRGFEPPSRPDLQYYGLKLAFSDLQLGVDNLRYDVFLSPRITAD
Ga0070708_10091611723300005445Corn, Switchgrass And Miscanthus RhizosphereMPKLPIFRLRSSEPPSRPDLQYYGPTLTLSDLQLGVDNLRYDVFLS
Ga0070730_1010412623300005537Surface SoilMPKLPILRLRNFEPPSKPDLLYQAPSLAFSDLQLGVDNLRYDV
Ga0070762_1002084913300005602SoilMPKLPIFRLRSTEPPSLPDLRYYGITLAFGGLQLGVDNLRYD
Ga0066795_1000362543300005938SoilMPKLPILRLRNSEPPSRPDLQYYGLTLTFSDLQLGVDNLRYDVFLSPRI
Ga0075029_10004542843300006052WatershedsMPKFPIFRLRNTEPLSRPDLRYHRLTLAFSDLQLGVDNLRYDVFLSARITADLSFHL
Ga0075030_10154625913300006162WatershedsMPKLPIFRLRTSEPPARPDLRYYKPVLAFTDLQLGVDNLRYDVLLSARITADL
Ga0075014_10066940213300006174WatershedsMPKLPIFRLRNTEPLSRPDLRYHRVTLAFSDLQLGVDNLRYDAFL
Ga0099793_1035237313300007258Vadose Zone SoilMPKLPIFRLRSSEPPSRPDLQYYGLSLAFTDLKLGVDNLRYDVFLSPRI
Ga0099792_1082779123300009143Vadose Zone SoilMPKLPIFRLRNTEPPSRPDLQYYGPTLAFSDLKLGVDNLRYDVFLSPRITADLSF
Ga0116220_1027260113300009525Peatlands SoilMPKLPVFRLRNSEPPSRPDLQYYGLTLAFSDLQLGVDNLRYDVFLSLRITAD
Ga0116114_106717113300009630PeatlandMPKLPVFRLRNSEPPSRPDLQYYGLTLAFSDLQLGVDNLRYDVF
Ga0116112_120963023300009636PeatlandMPKLPVFRLRSSEPPSRPNLQYHGLTLTFSDLQLGVDNLRYDVFLSPRITEDLSFH
Ga0116110_102403013300009643PeatlandMPKLPIFRLRNSERPSRPDLLYYGTTLAFSNLQLGVDNLRYDV
Ga0116135_114411223300009665PeatlandMPKLPIFRLRTSEPPSRPDLLYYGPALAFSNLQLGVDNLRYD
Ga0116224_1026365013300009683Peatlands SoilMPKVPIFRLRTSEPPSRPDLQYYGPTLAFADLRLGVDNLRYDVFLSPRI
Ga0116224_1049434423300009683Peatlands SoilMPKLPIFRLRSSEPPSRPDLQYYGLKLAFSDLQLGVDNLRYDVFL
Ga0116216_1009011633300009698Peatlands SoilMPKLPVFRLRNSEPPTRPDLQYFGPALAFSDLQLGVDNLRCDVFLSPRITADLSF
Ga0116134_102208513300009764PeatlandMPKLPVFRLRNSEPPSRPDLRYYGLTLAFSDLQLGVDNLRYDVFFSRRIAADLSF
Ga0116223_1055473423300009839Peatlands SoilMPKLPIFRLRSSEPPSRPDLQYYGLKLAFSDLQLGVDNLRYDVFLSPRI
Ga0074045_1001962313300010341Bog Forest SoilMPKLPVFRLRNSEPPSRPDLQYYGLTLAFSDLQLGVDNLRYDV
Ga0137391_1128202323300011270Vadose Zone SoilMPKLPVFRLRNSEPLSRPDLQYYGLTLAFSDLQLGVDNL
Ga0137362_1092240823300012205Vadose Zone SoilMPKLPIFRLRSSEPPSRPDLQYYGLSLAFTDLKLGVDNLRYDVFLSPRIAADL
Ga0137378_1120327913300012210Vadose Zone SoilMPKLPIFRLRSSEPPSRPDLQYYGLTLAFTDLKLGVDNLRYDV
Ga0137395_1113739723300012917Vadose Zone SoilMPKLPIFRLRSSEPPSRPDLQYYGLSLAFTDLKLGVDNL
Ga0181527_141947613300014153BogMPKLPIFRLRNSEPPSRPDLQYYGLTLVFSDLQLGVDNLRYDVFL
Ga0181518_1007157213300014156BogMPKLPVFRLRNSEPPSRPDLQYYGLTLAFSDLQLGVDNLRYDVFFSRR
Ga0181530_1044053923300014159BogMPKVPIFRLRNTEPLSRPDLRYHRVTLAFSDLQLG
Ga0181528_1026918323300014167BogMPKLPIFRLRNSDPPTRPDLLYHGPTLAFNDLQLGVDNLRYDVFLSPRITADLSF
Ga0182018_1023951113300014489PalsaMPKVPIFRLRNIAPLSRPDLRYNGVKLAFSDLQLGVDNLRYDVFLSPRITSDLS
Ga0181536_1002501953300014638BogMPKLPVFRLRNSEPPSRPDLQYYGLTLAFSDLQLGVDNLRYDVFFSRRMVAELSFHLARY
Ga0181522_1075041613300014657BogMPKLPIFRLRSSEPPTLPDLQYHRITLALSDLQLGVDNLRYDVFLSSRITAG
Ga0181505_1028830133300016750PeatlandMPKLPIFRLRNFEPPIRPDLQYYGLKLAFSDLQLGV
Ga0187849_118738913300017929PeatlandMPKLPIFRLRSFEPPSRPDLQYYGPTLAFNDLQLGVDNLRYDV
Ga0187803_1048350813300017934Freshwater SedimentMPKLPIFRLRSSEPPSRPDLQYYGPTLAFNDLQLGVDNLRYDVFLSPRITADLS
Ga0187854_1024060013300017938PeatlandMPKLPVFRLRNSEPPSRPDLQYYGLTLAFSDLQLGVDNLRYDVFFSRLIAADLSFH
Ga0187817_1002665753300017955Freshwater SedimentMPKFPIFRLRNSEPLNRPELHFCGFVLSFSGLQLGVDNLRYDVFLSPRVTD
Ga0187782_1021831013300017975Tropical PeatlandMPKLPIFRLRSSEPPPSLPDLRYYAPVLAFSDLQLGVDNLRFDVLLSPRFT
Ga0187876_117094013300018003PeatlandMPKLPVFRLRNSEPPSRPDLQYYGLTLAFSDLQLGVDNLRYDVFFSRRMVAE
Ga0187884_1007691133300018009PeatlandMPKLPIFRLRNSERPSRPDLLYYGTTLAFSNLQLGVDNLR
Ga0187884_1022114123300018009PeatlandMPKLPVFRLRNSEPPSRPDLQCYGLTLAFSDLQLGVDNLRYDVFFSRRIAADL
Ga0187884_1027401123300018009PeatlandMPKLPVFRLRNSEPPSRPDLQYYGLTLAFSDLQLGVD
Ga0187889_1038880613300018023PeatlandMPKLPIFRLRNSERPSRPDLLYYGTTLAFSNLQLGVDNLRYDVFLSPSITAD
Ga0187885_1032407413300018025PeatlandMPKLPVFRLRNSEPPSRPDLQYYGLTLAFSDLQLGVDNLRYDVFFSRLIAAD
Ga0187869_1046504123300018030PeatlandMPKLPIFRLRGFEPPSRPDLQYYGLKLAFSDLQLGVDN
Ga0187875_1038665723300018035PeatlandMPKLPIFRLRSSEPPRRPDLQYQEITLAFRALQLGVDNLRYDVFL
Ga0187855_1007482813300018038PeatlandMPRLPIFRLRSTEPLSLPDLQYHGVTLSLSDLQLGVDNLRYDVFLSPRITADLSFHL
Ga0187862_1089238923300018040PeatlandMPKLPVFRLRNSEPPSRPDLQYYGLTLAFSDLQLGVDNLRYDVFFSR
Ga0187871_1003809753300018042PeatlandMPRLPIFRLRSSEPPTLPDLQYHGITLALSDLQLGVDNLRYDVFLSPRI
Ga0187871_1018715213300018042PeatlandMPKLPIFRLRNTEPPSLPDLQYYGITLALSDLQLGVDNLR
Ga0187871_1065072923300018042PeatlandMPKLPIFRLRNTEPSSLPELRYYGITLSFTDLQLGVDNLRYDVFLSPRI
Ga0187887_1084841213300018043PeatlandMPRLPIFRLRSTEPLSLPDLQYHGVTLSLSDLQLGVDNLRYDVFL
Ga0187859_1042265513300018047PeatlandMPKVPIFRLRTSDSLNCPDLRRYQPALGFSDLQLGVDNLRYDVF
Ga0187858_1017179423300018057PeatlandMPKLPIFRLRSSEPPSRPDVQYYGPTLAFNDLQLGVDNLRYDVFLSPRIT
Ga0187784_1094950613300018062Tropical PeatlandMPKLPIIWLRSGEPPSLPDLLYHRPALSLTNLQLGVDNLRHDVALSPSIVKDL
Ga0187773_1061985323300018064Tropical PeatlandMPKLPIFRLRNAEPTTRPELHFYGLVLSFSGLQLGVDNLRYDVFLSP
Ga0187772_1014675813300018085Tropical PeatlandMPKLPVFRLRNSEPPSRPDLQYYGLKLTFSDLQLGVDNLRYDVFLSRRIT
Ga0182031_134175033300019787BogMPKLPIFRLRNTEPSSLPELRYYGITLSFTDLQLGVDNLRYDVFLSPRITPI
Ga0210408_1072519123300021178SoilMPKLPIFRLRNSEPPSRPDLQYYGPTLAFTDLKLGVDNLRYDVFLSPR
Ga0210387_1057412223300021405SoilMPKLPIFRLRTSEPPSRPDLLYHGPTLAFSDLQLGVDNLRFDVFLS
Ga0126371_1380823213300021560Tropical Forest SoilMPKLPIFRLRNAEPTARPDLLFYAHTLSFTGLQLGVDNLRYDV
Ga0213853_1010093033300021861WatershedsMPKLPIFRLRNSEPLSRPELHFYGLVLSFSGLQLGVDNLRFDVFLS
Ga0224557_110417013300023101SoilMPKLPIIWLRTGEAPSLPDLIYHRPALSLSGLQLGVDNLRHD
Ga0224564_108867523300024271SoilMPKLPVFRLRSSEPPTLPDLQYHGITLALSNLQLGVDNLRYDVF
Ga0208035_106481313300025406PeatlandMPKVPIFRLRTSDSLNCPDLRRYQPALGFSDLQLGVDNLRYDVFLGAR
Ga0208194_107316223300025412PeatlandMPKLPIFRLRNSERPSRPDLLYYGTTLAFSNLQLGVDNLRYDVFL
Ga0208189_102343233300025444PeatlandMPKLPVFRLRNSEPPSRPDLQYYGLTLVFSDLQLGVDNLRYDVFLSPRIAADLSFHLA
Ga0208455_105395423300025453PeatlandMPKVPIFRLRNTEPLSRPDLRYHRVTLAFSDLQLGVDNLRYDV
Ga0208563_106681923300025501PeatlandMPKLPIFRLRNSERPSRPDLLYYGTTLAFSNLQLGVDN
Ga0208188_101534213300025507PeatlandMPKLPIFRLRNSERPSRPDLLYYGTTLAFSNLQLGVDNL
Ga0208691_115521723300025612PeatlandMPKLPIFRLRNSEPPTRPDLQYHKITLAFSGLQLGVDNLRYDVFL
Ga0207693_1117609313300025915Corn, Switchgrass And Miscanthus RhizosphereMPKLPIFRLRSSEPPTLPDLQYYGPALSFTDLQLGVDNLRYDVFLSPRITADLS
Ga0209471_115717623300026318SoilMPKLPIFRLRSSEPPSRPDLQYYGLSLAFTDLKLGV
Ga0209687_112494113300026322SoilMPKLPIFRLRSSEPPSRPDLQYYGLTLAFTDLKLGVDNLRYDVFLSPRITA
Ga0209152_1044098423300026325SoilMPKLPIFRLRSSEPPSRPDLQYYGLTLAFTDLKLGV
Ga0257160_109230713300026489SoilMPKLPIFRLRSSEPPTLPDLQYYGPALSFTDLQLGVDN
Ga0179587_1041376313300026557Vadose Zone SoilMPKLPIFRLRSSEPPSRPDLQYYGLTLAFTDLKLGVDNLR
Ga0209528_100111273300027610Forest SoilMPKLPIFRLRSSEPPSRPDLQYYGPTLAFTDLKLGVDNLRYDVFLSPRITADLSFH
Ga0208565_104857813300027662Peatlands SoilMPKLPVFRLRNSEPSSRPDLQYHGPTLAFSDLQLGVDNLRYD
Ga0209118_101303813300027674Forest SoilMPKLPIFRLRNTEPPSRPDLQYYGLTLAFTDLKLGVDNLRY
Ga0209011_112911223300027678Forest SoilMPKLPIFRLRNFEPPSRPDLQYYGLTLAFTDLKLGVDNLRYDVFLSPRITADLSFHL
Ga0209446_118369713300027698Bog Forest SoilMPKLPIFRLRNSEPPARPDLLYYGPTLAFSDLQLGVDNLRYDVFLSPRITAELSFHL
Ga0209038_1008454213300027737Bog Forest SoilMPKVPIFRLRNSAPLSRPDLRYHGVTLAFSDLQLGVDNLRYDVFLSPR
Ga0209908_1019869923300027745Thawing PermafrostMPKVPIFRLRNSAPLSRPDLRYHGVKLTFSDLQLGVDN
Ga0209908_1024038013300027745Thawing PermafrostMPKVPIFRLRNSEPSSRPDLKYHGLTLAFSDLQLGVDNLRYDVFLSPRITADLSFH
Ga0209166_1046169613300027857Surface SoilMPKLPILRLRNFEPPSKPDLLYQAPSLAFSDLQLGV
Ga0209590_1067024813300027882Vadose Zone SoilMPKLPIFRLRSSEPPSRPDLQYHGLTLAFTDLKLG
Ga0209583_1040003513300027910WatershedsMPKLPIFRLRNSEPPSRPDLQYYGPTLAFSDLQLGVDNLRYDVLLSPRI
Ga0302233_1021296823300028746PalsaMPKLPIFRLRNSEPPNRPDLQYFGATLALSGLQLGVDNLRYDVF
Ga0302303_1008996233300028776PalsaMPKLPVFRLRSSEPPTLPDLQYRAIALALSNLQLGVDNLRYDVFLSSRVT
Ga0222748_105653913300029701SoilMPKLPIFRLRSTEPPSLPDLRYYGITLAFGGLQLGVDNLRYDVF
Ga0247275_116805613300029817SoilMPKVPIFRLRNTEPLSRPDLRYHRVTLAFSDLQLGVDNLRYDVLLSSRITAD
Ga0311328_1002464413300029939BogMPKLPIFRLRNTEPSSLPELRYYGITLSFTDLQLGVDNLR
Ga0311371_1077281113300029951PalsaMPKVPIFRLRNSEPSSRPDLKYHGLTLAFSDLQLGVD
Ga0311371_1223899423300029951PalsaMPKVPIFRLRNSAPLSRPDLRYHGITLAFSDLQLGVDNLRYDVFL
Ga0311342_1033002213300029955BogMPKLPIFRLRTSEPPSRPDLLYYGPALAFSNLQLGVDNL
Ga0311339_1131374823300029999PalsaMPKLPIFRLRSSEPQSLPELQYHGVTLSFNDLQLGVDNLRYD
Ga0302274_1039628313300030041BogMPKLPIFRLRTSEPPSRPDLLYYGPALAFSNLQLGVDNLRYDVFLSPRITTDLSFH
Ga0302286_1009048613300030047FenMPKLPIFRLRSSDPPIRPDLRYHSPVLALSDLQLGVDNLRYDVLLSPRITADLSFHLAR
Ga0311333_1002741113300030114FenMPKLPIFRLRSSEPPSRPDLRYHSPVLALSDLQLGVDNLRYDVLLSPRITADLSFHLA
Ga0311372_1138734113300030520PalsaMPKLPIVRLRNSAPLTRPDLRYHAVKLAFSDLQLGVDNLRYDVFLSSRITAELS
Ga0311355_1020656233300030580PalsaMPKLPIFRLRNSEPPNRPDLQYFGATLALSGLQLGVDNLRYDVFLSPRLS
Ga0311355_1061250013300030580PalsaMPKVPIFRLRNSAPLSRPDLRYHGITLAFSDLQLGVDN
Ga0310039_1016342813300030706Peatlands SoilMPKLPIFRLRSSEPPSRPDLQYYGLKLAFSDLQLGVDNLRYDVFLSPRITADLSFHL
Ga0073994_1237379413300030991SoilMPKLPIFRLRSSEPPSRPDLQYYGPTLAFTDLKLGVDNLRYDVFLSPR
Ga0302180_1006131113300031028PalsaMPKVPIFRLRNSEPSSRPDLKYHGLTLAFSDLQLGVDNLRYDVFL
Ga0302307_1004478343300031233PalsaMPKLPIFRLRNSEPPNRPDLQYFGATLALSGLQLGVDNL
Ga0265314_1013089513300031711RhizosphereMPKLPIFRLRSSEPPSRPDLKYHAPVLAFSDLQLG
Ga0307478_1053749713300031823Hardwood Forest SoilMPKLPIFRLRSSEPPTLPDLQYYGPALSFTDLQLGVDNLRYDVFLSPRITA
Ga0307478_1123733023300031823Hardwood Forest SoilMPKLPIFRLRPTEAPPPPDLRRYKPALSFSDLQLGVDNLRYDVFLGTRF
Ga0335081_1015109013300032892SoilMPKLPIFRLRSSEPPPSLPDLRYYAPVLAFSDLQLGVD
Ga0335077_1119348723300033158SoilMPKLPIFRLRPTEAPPPPDLRRYKPALSFADLQLGVDNLRYDVFLGQR
Ga0371490_104798623300033561Peat SoilMPKLPIFRLRNSEPPSRPDLQYYGLTLAFSDLQLGVDNLRYDVFL

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.