Basic Information | |
---|---|
Family ID | F077736 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 117 |
Average Sequence Length | 39 residues |
Representative Sequence | MRRSYQYRKLERHSRKPAELLLVPMIDIFTVLVTFLLM |
Number of Associated Samples | 102 |
Number of Associated Scaffolds | 117 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 83.76 % |
% of genes near scaffold ends (potentially truncated) | 99.15 % |
% of genes from short scaffolds (< 2000 bps) | 86.32 % |
Associated GOLD sequencing projects | 97 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.32 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (77.778 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (12.821 % of family members) |
Environment Ontology (ENVO) | Unclassified (24.786 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (41.026 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 50.00% β-sheet: 0.00% Coil/Unstructured: 50.00% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.32 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 117 Family Scaffolds |
---|---|---|
PF01618 | MotA_ExbB | 88.03 |
PF13432 | TPR_16 | 4.27 |
PF14559 | TPR_19 | 2.56 |
PF13414 | TPR_11 | 1.71 |
PF13428 | TPR_14 | 0.85 |
PF07719 | TPR_2 | 0.85 |
PF02472 | ExbD | 0.85 |
COG ID | Name | Functional Category | % Frequency in 117 Family Scaffolds |
---|---|---|---|
COG0848 | Biopolymer transport protein ExbD | Intracellular trafficking, secretion, and vesicular transport [U] | 0.85 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 77.78 % |
Unclassified | root | N/A | 22.22 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300002245|JGIcombinedJ26739_100571851 | Not Available | 1007 | Open in IMG/M |
3300002245|JGIcombinedJ26739_100678192 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 908 | Open in IMG/M |
3300004242|Ga0066601_10394361 | All Organisms → cellular organisms → Bacteria | 552 | Open in IMG/M |
3300004635|Ga0062388_100960274 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 827 | Open in IMG/M |
3300005174|Ga0066680_10224361 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1191 | Open in IMG/M |
3300005338|Ga0068868_101597317 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 613 | Open in IMG/M |
3300005363|Ga0008090_15247284 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1288 | Open in IMG/M |
3300005545|Ga0070695_101080287 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 656 | Open in IMG/M |
3300005548|Ga0070665_100013754 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiales genera incertae sedis → Methylibium | 8144 | Open in IMG/M |
3300005610|Ga0070763_10560786 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 659 | Open in IMG/M |
3300005617|Ga0068859_100754853 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1062 | Open in IMG/M |
3300005617|Ga0068859_101803711 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 676 | Open in IMG/M |
3300005712|Ga0070764_10376117 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 835 | Open in IMG/M |
3300005764|Ga0066903_103507047 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 845 | Open in IMG/M |
3300005841|Ga0068863_100003562 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 15367 | Open in IMG/M |
3300005841|Ga0068863_102267608 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 553 | Open in IMG/M |
3300005844|Ga0068862_100318112 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1436 | Open in IMG/M |
3300005989|Ga0075154_10716328 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 538 | Open in IMG/M |
3300005993|Ga0080027_10193383 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 792 | Open in IMG/M |
3300005995|Ga0066790_10001597 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiales genera incertae sedis → Methylibium | 9655 | Open in IMG/M |
3300006172|Ga0075018_10104790 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1259 | Open in IMG/M |
3300006173|Ga0070716_101627644 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 531 | Open in IMG/M |
3300006804|Ga0079221_10296609 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 946 | Open in IMG/M |
3300006804|Ga0079221_11000487 | Not Available | 627 | Open in IMG/M |
3300006918|Ga0079216_11435393 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 573 | Open in IMG/M |
3300007004|Ga0079218_12853971 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 580 | Open in IMG/M |
3300009093|Ga0105240_11384573 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 740 | Open in IMG/M |
3300009551|Ga0105238_10208142 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1932 | Open in IMG/M |
3300009697|Ga0116231_10720684 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 543 | Open in IMG/M |
3300009701|Ga0116228_10367819 | Not Available | 998 | Open in IMG/M |
3300010373|Ga0134128_12101464 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 622 | Open in IMG/M |
3300010376|Ga0126381_101103544 | Not Available | 1146 | Open in IMG/M |
3300010379|Ga0136449_101241582 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1169 | Open in IMG/M |
3300010396|Ga0134126_10051243 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 5166 | Open in IMG/M |
3300010396|Ga0134126_12944126 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 515 | Open in IMG/M |
3300010885|Ga0133913_13449151 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1033 | Open in IMG/M |
3300012212|Ga0150985_115330969 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 725 | Open in IMG/M |
3300012362|Ga0137361_10112273 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2390 | Open in IMG/M |
3300012924|Ga0137413_11503700 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 547 | Open in IMG/M |
3300012944|Ga0137410_10891899 | Not Available | 752 | Open in IMG/M |
3300015052|Ga0137411_1272998 | Not Available | 1047 | Open in IMG/M |
3300015264|Ga0137403_10058341 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3952 | Open in IMG/M |
3300015264|Ga0137403_10111186 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2741 | Open in IMG/M |
3300017973|Ga0187780_10868042 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 654 | Open in IMG/M |
3300018025|Ga0187885_10119832 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1264 | Open in IMG/M |
3300018481|Ga0190271_11717681 | Not Available | 741 | Open in IMG/M |
3300020034|Ga0193753_10015409 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 4674 | Open in IMG/M |
3300020070|Ga0206356_10240361 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 683 | Open in IMG/M |
3300020581|Ga0210399_10158428 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1874 | Open in IMG/M |
3300020581|Ga0210399_11098390 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 636 | Open in IMG/M |
3300021170|Ga0210400_11422145 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 552 | Open in IMG/M |
3300021407|Ga0210383_10358748 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1257 | Open in IMG/M |
3300021432|Ga0210384_11013173 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 732 | Open in IMG/M |
3300021861|Ga0213853_10478593 | Not Available | 870 | Open in IMG/M |
3300022515|Ga0224546_1006150 | Not Available | 836 | Open in IMG/M |
3300025900|Ga0207710_10025437 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 2554 | Open in IMG/M |
3300025903|Ga0207680_11157244 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 552 | Open in IMG/M |
3300025929|Ga0207664_11506277 | All Organisms → cellular organisms → Bacteria | 594 | Open in IMG/M |
3300025939|Ga0207665_11291608 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 582 | Open in IMG/M |
3300025940|Ga0207691_11513815 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 548 | Open in IMG/M |
3300026142|Ga0207698_11383093 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 719 | Open in IMG/M |
3300026322|Ga0209687_1228383 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 574 | Open in IMG/M |
3300027002|Ga0209110_1034425 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 611 | Open in IMG/M |
3300027645|Ga0209117_1122392 | Not Available | 695 | Open in IMG/M |
3300027725|Ga0209178_1398969 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 522 | Open in IMG/M |
3300027727|Ga0209328_10057107 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Woeseiaceae → Woeseia → Woeseia oceani | 1198 | Open in IMG/M |
3300027855|Ga0209693_10061491 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1849 | Open in IMG/M |
3300027884|Ga0209275_10542440 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 665 | Open in IMG/M |
3300027905|Ga0209415_10295482 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1403 | Open in IMG/M |
3300028379|Ga0268266_10088237 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 2714 | Open in IMG/M |
3300028379|Ga0268266_10735773 | Not Available | 951 | Open in IMG/M |
3300028775|Ga0302231_10269174 | Not Available | 713 | Open in IMG/M |
3300028780|Ga0302225_10371143 | Not Available | 674 | Open in IMG/M |
3300028789|Ga0302232_10132340 | Not Available | 1264 | Open in IMG/M |
3300028789|Ga0302232_10273375 | Not Available | 836 | Open in IMG/M |
3300028801|Ga0302226_10123346 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1140 | Open in IMG/M |
3300028813|Ga0302157_10083326 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2071 | Open in IMG/M |
3300028869|Ga0302263_10151509 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 925 | Open in IMG/M |
3300028906|Ga0308309_10624238 | Not Available | 936 | Open in IMG/M |
3300028906|Ga0308309_11807937 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 517 | Open in IMG/M |
3300029883|Ga0311327_10069265 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2704 | Open in IMG/M |
3300029910|Ga0311369_10740683 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 802 | Open in IMG/M |
3300029984|Ga0311332_10270081 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1296 | Open in IMG/M |
3300029989|Ga0311365_10537644 | Not Available | 1013 | Open in IMG/M |
3300030007|Ga0311338_11037059 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 793 | Open in IMG/M |
3300030010|Ga0302299_10316693 | Not Available | 809 | Open in IMG/M |
3300030013|Ga0302178_10003700 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Woeseiaceae → Woeseia → Woeseia oceani | 11384 | Open in IMG/M |
3300030503|Ga0311370_11058460 | Not Available | 897 | Open in IMG/M |
3300030520|Ga0311372_11187616 | Not Available | 979 | Open in IMG/M |
3300031057|Ga0170834_104812462 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 537 | Open in IMG/M |
3300031184|Ga0307499_10319317 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 517 | Open in IMG/M |
3300031236|Ga0302324_100534615 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1701 | Open in IMG/M |
3300031344|Ga0265316_10585076 | Not Available | 792 | Open in IMG/M |
3300031525|Ga0302326_10684803 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1503 | Open in IMG/M |
3300031525|Ga0302326_12244598 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 695 | Open in IMG/M |
3300031595|Ga0265313_10191223 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 855 | Open in IMG/M |
3300031723|Ga0318493_10424659 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 729 | Open in IMG/M |
3300031753|Ga0307477_10668750 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 696 | Open in IMG/M |
3300031754|Ga0307475_10606038 | Not Available | 876 | Open in IMG/M |
3300031754|Ga0307475_11310165 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 561 | Open in IMG/M |
3300031765|Ga0318554_10190584 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Woeseiaceae → Woeseia → Woeseia oceani | 1166 | Open in IMG/M |
3300031765|Ga0318554_10416148 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 762 | Open in IMG/M |
3300031771|Ga0318546_10328226 | Not Available | 1062 | Open in IMG/M |
3300031860|Ga0318495_10167268 | Not Available | 991 | Open in IMG/M |
3300031897|Ga0318520_10152983 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1338 | Open in IMG/M |
3300031912|Ga0306921_11220650 | Not Available | 836 | Open in IMG/M |
3300031941|Ga0310912_10193597 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Woeseiaceae → Woeseia → Woeseia oceani | 1552 | Open in IMG/M |
3300031947|Ga0310909_10009451 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Woeseiaceae → Woeseia → Woeseia oceani | 6582 | Open in IMG/M |
3300032009|Ga0318563_10377277 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 767 | Open in IMG/M |
3300032094|Ga0318540_10439490 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 630 | Open in IMG/M |
3300032783|Ga0335079_10753333 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1013 | Open in IMG/M |
3300032783|Ga0335079_11140042 | Not Available | 787 | Open in IMG/M |
3300032783|Ga0335079_11295143 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 728 | Open in IMG/M |
3300032805|Ga0335078_10090104 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Woeseiaceae → Woeseia → Woeseia oceani | 4446 | Open in IMG/M |
3300033158|Ga0335077_11848342 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 566 | Open in IMG/M |
3300034125|Ga0370484_0006707 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2349 | Open in IMG/M |
3300034129|Ga0370493_0045590 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1354 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 12.82% |
Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 11.11% |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 5.13% |
Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 5.13% |
Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 4.27% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 4.27% |
Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 4.27% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 4.27% |
Fen | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen | 3.42% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 3.42% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 2.56% |
Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 2.56% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 2.56% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 2.56% |
Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 1.71% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 1.71% |
Untreated Peat Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil | 1.71% |
Bog | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Bog | 1.71% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 1.71% |
Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere | 1.71% |
Host-Associated | Host-Associated → Plants → Peat Moss → Unclassified → Unclassified → Host-Associated | 1.71% |
Watersheds | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Watersheds | 0.85% |
Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 0.85% |
Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 0.85% |
Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 0.85% |
Freshwater | Environmental → Aquatic → Freshwater → Pond → Sediment → Freshwater | 0.85% |
Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 0.85% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 0.85% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 0.85% |
Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 0.85% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 0.85% |
Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 0.85% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Soil | 0.85% |
Prmafrost Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Prmafrost Soil | 0.85% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 0.85% |
Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 0.85% |
Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Soil | 0.85% |
Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere | 0.85% |
Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.85% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 0.85% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.85% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 0.85% |
Wastewater Effluent | Engineered → Wastewater → Nutrient Removal → Unclassified → Unclassified → Wastewater Effluent | 0.85% |
Tropical Rainforest Soil | Environmental → Terrestrial → Soil → Unclassified → Tropical Rainforest → Tropical Rainforest Soil | 0.85% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300002245 | Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027) | Environmental | Open in IMG/M |
3300004242 | Freshwater pond sediment microbial communities from the University of Edinburgh, under environmental carbon perturbations - Medium cellulose week 11 | Environmental | Open in IMG/M |
3300004635 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3 | Environmental | Open in IMG/M |
3300005174 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_129 | Environmental | Open in IMG/M |
3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Host-Associated | Open in IMG/M |
3300005363 | Tropical rainforest soil microbial communities from the Amazon Forest, Brazil, analyzing deforestation - Metatranscriptome F II A100 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Environmental | Open in IMG/M |
3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Host-Associated | Open in IMG/M |
3300005610 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 | Environmental | Open in IMG/M |
3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Host-Associated | Open in IMG/M |
3300005712 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 4 | Environmental | Open in IMG/M |
3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Host-Associated | Open in IMG/M |
3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Host-Associated | Open in IMG/M |
3300005989 | Wastewater effluent complex algal communities from Wisconsin, to seasonally profile nutrient transformation and Carbon sequestration - JI 7/17/14 B DNA | Engineered | Open in IMG/M |
3300005993 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 1 DNA2013-046 | Environmental | Open in IMG/M |
3300005995 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 3 DNA2013-050 | Environmental | Open in IMG/M |
3300006172 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2014 | Environmental | Open in IMG/M |
3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Environmental | Open in IMG/M |
3300006804 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 | Environmental | Open in IMG/M |
3300006918 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC AS100 | Environmental | Open in IMG/M |
3300007004 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC Compost | Environmental | Open in IMG/M |
3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Host-Associated | Open in IMG/M |
3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Host-Associated | Open in IMG/M |
3300009697 | Host-associated microbial communities from peat moss isolated from Minnesota, USA - S1T2_Fd - Sphagnum magellanicum MG | Host-Associated | Open in IMG/M |
3300009701 | Host-associated microbial communities from peat moss isolated from Minnesota, USA - S1T2_Fc - Sphagnum fallax MG | Host-Associated | Open in IMG/M |
3300010373 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4 | Environmental | Open in IMG/M |
3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
3300010379 | Sb_50d combined assembly | Environmental | Open in IMG/M |
3300010396 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2 | Environmental | Open in IMG/M |
3300010885 | northern Canada Lakes Co-assembly | Environmental | Open in IMG/M |
3300012212 | Combined assembly of Hopland grassland soil | Host-Associated | Open in IMG/M |
3300012362 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG | Environmental | Open in IMG/M |
3300012924 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012944 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300015052 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
3300015264 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
3300017973 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_20_MG | Environmental | Open in IMG/M |
3300018025 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_20_100 | Environmental | Open in IMG/M |
3300018481 | Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 356 T | Environmental | Open in IMG/M |
3300020034 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H1c2 | Environmental | Open in IMG/M |
3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
3300021170 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-M | Environmental | Open in IMG/M |
3300021407 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-O | Environmental | Open in IMG/M |
3300021432 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M | Environmental | Open in IMG/M |
3300021861 | Metatranscriptome of freshwater sediment microbial communities from post-fracked creek in Pennsylvania, United States - ABR_2016 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300022515 | Peat soil microbial communities from Stordalen Mire, Sweden - 717 P2 1-5 | Environmental | Open in IMG/M |
3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026322 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_136 (SPAdes) | Environmental | Open in IMG/M |
3300027002 | Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM2H0_O1 (SPAdes) | Environmental | Open in IMG/M |
3300027645 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M2 (SPAdes) | Environmental | Open in IMG/M |
3300027725 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 (SPAdes) | Environmental | Open in IMG/M |
3300027727 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM3H0_M1 (SPAdes) | Environmental | Open in IMG/M |
3300027855 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 (SPAdes) | Environmental | Open in IMG/M |
3300027884 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 (SPAdes) | Environmental | Open in IMG/M |
3300027905 | Peat soil microbial communities from Weissenstadt, Germany - SII-SIP-2007 (SPAdes) | Environmental | Open in IMG/M |
3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300028775 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N2_2 | Environmental | Open in IMG/M |
3300028780 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E3_2 | Environmental | Open in IMG/M |
3300028789 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N2_3 | Environmental | Open in IMG/M |
3300028801 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E3_3 | Environmental | Open in IMG/M |
3300028813 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_N3_3 | Environmental | Open in IMG/M |
3300028869 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Fen_N1_4 | Environmental | Open in IMG/M |
3300028906 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2) | Environmental | Open in IMG/M |
3300029883 | I_Bog_E2 coassembly | Environmental | Open in IMG/M |
3300029910 | III_Palsa_E2 coassembly | Environmental | Open in IMG/M |
3300029984 | I_Fen_E1 coassembly | Environmental | Open in IMG/M |
3300029989 | III_Fen_N1 coassembly | Environmental | Open in IMG/M |
3300030007 | I_Palsa_E1 coassembly | Environmental | Open in IMG/M |
3300030010 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Fen_N3_4 | Environmental | Open in IMG/M |
3300030013 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E1_3 | Environmental | Open in IMG/M |
3300030503 | III_Palsa_E3 coassembly | Environmental | Open in IMG/M |
3300030520 | III_Palsa_N2 coassembly | Environmental | Open in IMG/M |
3300031057 | Oak Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
3300031184 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 13_S | Environmental | Open in IMG/M |
3300031236 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_1 | Environmental | Open in IMG/M |
3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Host-Associated | Open in IMG/M |
3300031525 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_3 | Environmental | Open in IMG/M |
3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Host-Associated | Open in IMG/M |
3300031723 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f23 | Environmental | Open in IMG/M |
3300031753 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_515 | Environmental | Open in IMG/M |
3300031754 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515 | Environmental | Open in IMG/M |
3300031765 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f22 | Environmental | Open in IMG/M |
3300031771 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f19 | Environmental | Open in IMG/M |
3300031860 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f25 | Environmental | Open in IMG/M |
3300031897 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f16 | Environmental | Open in IMG/M |
3300031912 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2) | Environmental | Open in IMG/M |
3300031941 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX080 | Environmental | Open in IMG/M |
3300031947 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.T000H | Environmental | Open in IMG/M |
3300032009 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f19 | Environmental | Open in IMG/M |
3300032094 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f25 | Environmental | Open in IMG/M |
3300032783 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.3 | Environmental | Open in IMG/M |
3300032805 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.2 | Environmental | Open in IMG/M |
3300033158 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.1 | Environmental | Open in IMG/M |
3300034125 | Peat soil microbial communities from wetlands in Alaska, United States - Sheep_creek_tus_01_15 | Environmental | Open in IMG/M |
3300034129 | Peat soil microbial communities from wetlands in Alaska, United States - Sheep_creek_fen_01D_16 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
JGIcombinedJ26739_1005718513 | 3300002245 | Forest Soil | MRRSYQSRKLERHSRKPEQLLLVPMIDIFTVLVTFLLM |
JGIcombinedJ26739_1006781922 | 3300002245 | Forest Soil | MRHHYETKKLLRHKRKPAELILVPMIDIFTVLVTFLLMTAV |
Ga0066601_103943611 | 3300004242 | Freshwater | MRRNYSMRKLERRARKPSELMLVPMIDIFTVLVTFLLMTA |
Ga0062388_1009602742 | 3300004635 | Bog Forest Soil | MRRSYSVRKVMRHNRKPAELLLVPMIDIFTVLVTFLLMTAV |
Ga0066680_102243613 | 3300005174 | Soil | MRRPYQIRKLERHSRKPAELLLVPMIDIFTVLVTFLLMTA |
Ga0068868_1015973171 | 3300005338 | Miscanthus Rhizosphere | MRRSFATKKIARKMRKPAELLLVPMIDIFTVLVTFLLMTA |
Ga0008090_152472841 | 3300005363 | Tropical Rainforest Soil | MRRSYQYRKLERHSRKPATLLLVPMIDIFTVLVTFLLMTAVF |
Ga0070695_1010802872 | 3300005545 | Corn, Switchgrass And Miscanthus Rhizosphere | MARRSYAAKKLARHTRKPAELLLVPMIDIFTVLVTFLLMT |
Ga0070665_1000137541 | 3300005548 | Switchgrass Rhizosphere | MRRSFQTRKLARHNRRPAELLLVPMIDIFTVLVTFLLM |
Ga0070763_105607861 | 3300005610 | Soil | MRRSYDAKKLARRNRRPAELLLVPMIDIFTVLVTFL |
Ga0068859_1007548531 | 3300005617 | Switchgrass Rhizosphere | MRRSFATKKIARKMRKPAELLLVPMIDIFTVLVTFLLMTAV |
Ga0068859_1018037112 | 3300005617 | Switchgrass Rhizosphere | MRRSYQSRKLARHARKPAELLLVPMIDIFTVLVTFLLMT |
Ga0070764_103761172 | 3300005712 | Soil | MRRSYQYRKLERHSRRPAELLLVPMIDIFTVLVTFLLMTA |
Ga0066903_1035070471 | 3300005764 | Tropical Forest Soil | MRRSYQYRKLERRTRKPAELLLVPMIDIFTVLVTFLLM |
Ga0068863_10000356212 | 3300005841 | Switchgrass Rhizosphere | MRRSYANKKIARRMKKPAELLLVPMIDIFTVLVTFLL |
Ga0068863_1022676082 | 3300005841 | Switchgrass Rhizosphere | MKRSYAAKKLARHTRKPAELMLVPMIDIFTVLVTFLLMT |
Ga0068862_1003181121 | 3300005844 | Switchgrass Rhizosphere | MRRSYASKKLARHMRKPAELLLVPMIDIFTVLVTFLLM |
Ga0075154_107163282 | 3300005989 | Wastewater Effluent | VRRSYAMRKLERKHRRSAELLLVPMIDIFTVLVTFLLM |
Ga0080027_101933831 | 3300005993 | Prmafrost Soil | MRRSQALRKLLRKQRRPSELTLVSMIDIFTVLVVFLLMTAIFSRTVVL |
Ga0066790_100015971 | 3300005995 | Soil | MRRSYQVRKLLRHQRKPAELLLVPMIDIFTVLVTF |
Ga0075018_101047903 | 3300006172 | Watersheds | MGRNQVARKLKRRYRKPGELLLVPMIDIFTVLVTFLLMT |
Ga0070716_1016276441 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | MRRSYQARKLARHTRRPAELLLVPMIDIFTVLVTFL |
Ga0079221_102966091 | 3300006804 | Agricultural Soil | MRRSYQARKLLRHQRKAGELMLVSMIDIFTVLVTFLLMT |
Ga0079221_110004871 | 3300006804 | Agricultural Soil | MRRSYQARKLLRHQRKPAELMLVSMIDIFTVLVTF |
Ga0079216_114353931 | 3300006918 | Agricultural Soil | VRRNYAMRKLQRRHRKPAELLLVPMIDIFTVLVTFLL |
Ga0079218_128539711 | 3300007004 | Agricultural Soil | MRRSFSAKKLARHSRRPAELLLVPMIDIFTVLVTFLLMTA |
Ga0105240_113845731 | 3300009093 | Corn Rhizosphere | MRRSYQARKLLRHQRKAGELMLVSMIDIFTVLVTFLLM |
Ga0105238_102081421 | 3300009551 | Corn Rhizosphere | MRRSYQTRKLERHNRKPAELLLVPMIDIFTVLVTFLLMT |
Ga0116231_107206842 | 3300009697 | Host-Associated | MRNSFEAKKLARRYKKPAELLLVPMIDIFTVLVTFL |
Ga0116228_103678191 | 3300009701 | Host-Associated | MRNSYEAKKLARRHRKPAELLLVPMIDIFTVLVTFLLM |
Ga0134128_121014641 | 3300010373 | Terrestrial Soil | MRRSYRVKQLMRRQHKSGELLLVPMIDIFTVLVTFLLMTA |
Ga0126381_1011035441 | 3300010376 | Tropical Forest Soil | MRRSSFETRKLARRKRRPTELILVPMIDIFTVLVTFL |
Ga0136449_1012415823 | 3300010379 | Peatlands Soil | MRRSYSVRKLMRRQRKPSELLLVSMIDIFTVLVTFLLMTAVFS |
Ga0134126_100512435 | 3300010396 | Terrestrial Soil | MRRSYLARKLLRHQRKPAELMLVSMIDIFTVLVTFLL |
Ga0134126_129441261 | 3300010396 | Terrestrial Soil | MRRSYQTRKLERHNRKPDELLLVPMIDIFTVLVTFLL |
Ga0133913_134491513 | 3300010885 | Freshwater Lake | MRRNQILRKLMRRQKKPGELMLVPMIDIFTVLVTFLLMTAV |
Ga0150985_1153309692 | 3300012212 | Avena Fatua Rhizosphere | MRRSFATKEIVRKMRKPAELLLVPMIDIFTVLVTF |
Ga0137361_101122731 | 3300012362 | Vadose Zone Soil | MRRSYQSRKLERHSRKPAELLLVPMIDIFTVLVTFL |
Ga0137413_115037001 | 3300012924 | Vadose Zone Soil | MRRSYQTRKLERHHKRPAELLLVPMIDIFTVLVTFLLMTAVF |
Ga0137410_108918992 | 3300012944 | Vadose Zone Soil | MRRSYANKKLARHARRPAELLLVPMIDIFTVLVTFLLM |
Ga0137411_12729982 | 3300015052 | Vadose Zone Soil | MRRSYQARKLLRHSRKPAELLLVPMIDIFTVLVTFLL |
Ga0137403_100583411 | 3300015264 | Vadose Zone Soil | MRRPYQIRKLERHSRKPAELLLVPMIDIFTVLVTFL |
Ga0137403_101111861 | 3300015264 | Vadose Zone Soil | MRRSYQARKLLRHSRKPAELLLVPMIDIFTVLVTFL |
Ga0187780_108680421 | 3300017973 | Tropical Peatland | MRRSYQYRKLERHSRKPAELLLVTMIDIFTVLVTFLLMTAVF |
Ga0187885_101198321 | 3300018025 | Peatland | MRRSPSVRRLQRHHYRPSELMLVSMIDIFTVLVTF |
Ga0190271_117176811 | 3300018481 | Soil | MRRSYAMRKLERRHRKPAELLLVPMIDIFTVLVTFL |
Ga0193753_100154094 | 3300020034 | Soil | MRRNFKVRKLARRFRRPSELLLVPMIDIFTVLVTFLLMTAV |
Ga0206356_102403613 | 3300020070 | Corn, Switchgrass And Miscanthus Rhizosphere | MRRSYQARKLLRHQRKAGELMLVSMIDIFTVLVTFLLMTAVFSH |
Ga0210399_101584284 | 3300020581 | Soil | MRRSQALRKLLRRQRRPSELTLVSMIDIFTVLVTFLLMTAIFSRTVVL |
Ga0210399_110983902 | 3300020581 | Soil | MRRSYQSRKLERHSRRPPELLLVPMIDIFTVLVTFL |
Ga0210400_114221451 | 3300021170 | Soil | MRRSYDARKLARRNRRPAELLLVPMIDIFTVLVTFL |
Ga0210383_103587481 | 3300021407 | Soil | MRRSYQTRKLERHHKRPAELLLVPMIDIFTVLVTFLLMTAV |
Ga0210384_110131732 | 3300021432 | Soil | VRRSYSVRKIQRHQRRPSDLTLVSMIDIFTVLVTFLLMTAVF |
Ga0213853_104785931 | 3300021861 | Watersheds | MRRSQAIRKLMRRQRRPSELQLVSMIDIFTVLVTFLLMTAIF |
Ga0224546_10061502 | 3300022515 | Soil | MRRAYQYRKLARHSRKPAELLLVPMIDIFTVLVTFLLMT |
Ga0207710_100254374 | 3300025900 | Switchgrass Rhizosphere | MRRSYANKKIARRMKKPAELLLVPMIDIFTVLVTFLLMTA |
Ga0207680_111572442 | 3300025903 | Switchgrass Rhizosphere | MRRSQALRKMLRRQRKPADLQLVSMIDIFTVLVTFLL |
Ga0207664_115062772 | 3300025929 | Agricultural Soil | MRRSYANKKLLRHARRPAELLLVPMIDIFTVLVTFLLMTAV |
Ga0207665_112916082 | 3300025939 | Corn, Switchgrass And Miscanthus Rhizosphere | MRRSYQTRKLERHNRRPAELLLVPMIDIFTVLVTFLLM |
Ga0207691_115138152 | 3300025940 | Miscanthus Rhizosphere | MRRSQALRKMLRRQRKPADLQLVSMIDIFTVLVTF |
Ga0207698_113830932 | 3300026142 | Corn Rhizosphere | MRRSYQYRKLERHSRKPAELLLVPMIDIFTVLVTFLLMTAV |
Ga0209687_12283832 | 3300026322 | Soil | MRRSYQTRKLERHSRKPAELLLVPMIDIFTVLVTFLLMTAV |
Ga0209110_10344251 | 3300027002 | Forest Soil | MRRSYANKKIARRMKKPAELLLVPMIDIFTVLVTF |
Ga0209117_11223922 | 3300027645 | Forest Soil | MRRSPSVRRLQRHHYRPSELMLVSMIDIFTVLVTFLLMTAVF |
Ga0209178_13989692 | 3300027725 | Agricultural Soil | MRRSYQARKLLRHQRKAGELMLVSMIDIFTVLVTF |
Ga0209328_100571073 | 3300027727 | Forest Soil | MRRSYANKKLARHARRPAELLLVPMIDIFTVLVTFLLMTA |
Ga0209693_100614911 | 3300027855 | Soil | MRRSYQYRKLARHSRKPDELLLVPMIDIFTVLVTFLLMTAV |
Ga0209275_105424401 | 3300027884 | Soil | MRRSYQYRKLERHSRKPAELLLVPMIDIFTVLVTFLLM |
Ga0209415_102954823 | 3300027905 | Peatlands Soil | MRRSRSVRRITRHQHRPSQLMLVSMIDIFTVLVTFLLMTAVF |
Ga0268266_100882371 | 3300028379 | Switchgrass Rhizosphere | MRRSFQTRKLARHNRRPAELLLVPMIDIFTVLVTFLLMTA |
Ga0268266_107357732 | 3300028379 | Switchgrass Rhizosphere | MRRSQALRKMLRRQRKPADLQLVSMIDIFTVLVTFL |
Ga0302231_102691741 | 3300028775 | Palsa | VRRARNVRRITRHQHRPSQLMLVSMIDIFTVLVTFLLMTAVFSRTVI |
Ga0302225_103711432 | 3300028780 | Palsa | VRRRSYIVRKLERRMRKPTELLLVPMIDIFTVLVTFLLMTA |
Ga0302232_101323403 | 3300028789 | Palsa | VRRARNVRRITRHQHRPSQLMLVSMIDIFTVLVTFLLMTAVF |
Ga0302232_102733752 | 3300028789 | Palsa | MRRSYENRKLARHNRRPAELLLVPMIDIFTVLVTFLLM |
Ga0302226_101233463 | 3300028801 | Palsa | MRRRAYIVRKLERRQRKPAELLLVPMIDIFTVLVTFLLMTAV |
Ga0302157_100833261 | 3300028813 | Bog | MRRRSYQVRKLLRHHRKPAELLLVPMIDIFTVLVTFLLMTAV |
Ga0302263_101515091 | 3300028869 | Fen | MRRSKALKKAMRRQRRPSELQLVSMIDIFTVLVTFLLMTAI |
Ga0308309_106242382 | 3300028906 | Soil | MRRSYQSRKLERHSRKPEQLLLVPMIDIFTVLVTFLLMTA |
Ga0308309_118079371 | 3300028906 | Soil | MRRSHSVRRAMRHQRRPAELLLVPMIDIFTVLVTFLL |
Ga0311327_100692651 | 3300029883 | Bog | MRRAHSVRRIRRHQHRDSQLMLVSMIDIFTVLVTFL |
Ga0311369_107406831 | 3300029910 | Palsa | MRRTYDAKKLARHKRKPAELLLVPMIDIFTVLVTFLL |
Ga0311332_102700813 | 3300029984 | Fen | MRRSAAVRKLMRRQRKPSELQLVSMIDIFTVLVTFLL |
Ga0311365_105376442 | 3300029989 | Fen | MRRSQALKKLMRRQKKPSELQLISMIDIFTVLVTFLLMTAIFSRTVVL |
Ga0311338_110370591 | 3300030007 | Palsa | MRRSYDARKLARRNRRPAELLLVPMIDIFTVLVTFLLMTAV |
Ga0302299_103166931 | 3300030010 | Fen | MGRNQVARKLMRRYKKPGELMLVPMIDIFTVLVTFLLMTA |
Ga0302178_100037001 | 3300030013 | Palsa | MRRRAYIVRKLERRQRKPAELLLVPMIDIFTVLVTF |
Ga0311370_110584602 | 3300030503 | Palsa | MRRSYQVRKLLRHQRKPAELILVPMIDIFTVLVTFL |
Ga0311372_111876163 | 3300030520 | Palsa | MRRAHSVRRIQRHQHRPSQLMLVSMIDIFTVLVTFLL |
Ga0170834_1048124622 | 3300031057 | Forest Soil | MRRSYQSRRMERHARKPAELLLVPMIDIFTVLVTFLLM |
Ga0307499_103193171 | 3300031184 | Soil | MRRGYAMRKLERKNRRPAELLLVPMIDIFTVLVTFLLM |
Ga0302324_1005346151 | 3300031236 | Palsa | MRRSRNVRRITRHQHRPSQLMLVSMIDIFTVLVTFLLMTAVFSRT |
Ga0265316_105850761 | 3300031344 | Rhizosphere | MMRRSYAAKKVLRRHRRPAELLLVPMIDIFTVLVTFL |
Ga0302326_106848033 | 3300031525 | Palsa | MRRAHSVRRIQRHQHRDSQLMLVSMIDIFTVLVTFLLMTAVFSRTVIL |
Ga0302326_122445981 | 3300031525 | Palsa | MRRSYANKKLARKARRPAELLLVPMIDIFTVLVTFLLMTAVF |
Ga0265313_101912232 | 3300031595 | Rhizosphere | MRRSYDAKKLARHKRKPTELLLVPMIDIFTVLVTFLLMT |
Ga0318493_104246591 | 3300031723 | Soil | MRRSYQYRKLERHTRRPAELLLVPMIDIFTVLVTFLLMS |
Ga0307477_106687502 | 3300031753 | Hardwood Forest Soil | MRRSYQYRKLERRTRKPAELLLVPMIDIFTVLVTFLLMTAV |
Ga0307475_106060382 | 3300031754 | Hardwood Forest Soil | MRRSYQTRKLERHSRKPAELLLVPMIDIFTVLVTFL |
Ga0307475_113101651 | 3300031754 | Hardwood Forest Soil | MRRSYQTRKLERHNRRPAELLLVPMIDIFTVLVTFLLMT |
Ga0318554_101905841 | 3300031765 | Soil | MRRSYQYRKLERHSRKPAQLLLVPMIDIFTVLVTFLLMTAVF |
Ga0318554_104161482 | 3300031765 | Soil | MRRSYQYRKLERHSRKPAQLLLVPMIDIFTVLVTFLLMT |
Ga0318546_103282261 | 3300031771 | Soil | MRRSYQYRKLERRTRKPAELLLVPMIDIFTVLVTFL |
Ga0318495_101672682 | 3300031860 | Soil | MRRSYQYRKLERHTRKPAELLLVPMIDIFTVLVTF |
Ga0318520_101529832 | 3300031897 | Soil | MRRSYQYRKLERHSRKPAQLLLVPMIDIFTVLVTFLLMTAVFPAR |
Ga0306921_112206502 | 3300031912 | Soil | MRRSYQYRKLERHTRKPAQLLLVPMIDIFTVLVTF |
Ga0310912_101935973 | 3300031941 | Soil | MRRSYQYRKLERHTRKPAELLLVPMIDIFTVLVTFLL |
Ga0310909_100094516 | 3300031947 | Soil | MRRSYQYRKLERRTRKPAELLLVPMIDIFTVLVTF |
Ga0318563_103772771 | 3300032009 | Soil | MRRSYQYRKLERHTRKPAELLLVPMIDIFTVLVTFLLMT |
Ga0318540_104394901 | 3300032094 | Soil | MRRSYQYRKLERHSRKPAQLLLVPMIDIFTVLVTFLL |
Ga0335079_107533334 | 3300032783 | Soil | VRRSYSVRRIQRHQRKPSELQLVSMIDIFTVLVTFLLMTA |
Ga0335079_111400422 | 3300032783 | Soil | MRRSYQNRKLERHSRKPAELLLVPMIDIFTVLVTFLLMT |
Ga0335079_112951431 | 3300032783 | Soil | MRRSYDARKLARRHRRPAELLLVPMIDIFTVLVTFL |
Ga0335078_100901045 | 3300032805 | Soil | MRRSYQNRKLERHSRKPAELLLVPMIDIFTVLVTFLLMTA |
Ga0335077_118483422 | 3300033158 | Soil | MRRSYDVKKLARRRRQPAELLLVPMIDIFTVLVTFLL |
Ga0370484_0006707_2225_2347 | 3300034125 | Untreated Peat Soil | MRRTYDAKKLARHTRRPTELLLVPMIDIFTVLVTFLLMTAV |
Ga0370493_0045590_1250_1354 | 3300034129 | Untreated Peat Soil | MRRSYSVKKLIRRQRKPAELMLVPMIDIFTVLVTF |
⦗Top⦘ |