NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F077823

Metagenome / Metatranscriptome Family F077823

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F077823
Family Type Metagenome / Metatranscriptome
Number of Sequences 117
Average Sequence Length 40 residues
Representative Sequence DVVARSVYALGGKIGVSTNPGKFTRFKIVLPAAEAASTAVA
Number of Associated Samples 110
Number of Associated Scaffolds 117

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 0.00 %
% of genes near scaffold ends (potentially truncated) 100.00 %
% of genes from short scaffolds (< 2000 bps) 95.73 %
Associated GOLD sequencing projects 108
AlphaFold2 3D model prediction Yes
3D model pTM-score0.48

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (100.000 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil
(24.786 % of family members)
Environment Ontology (ENVO) Unclassified
(24.786 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(33.333 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 11.59%    β-sheet: 20.29%    Coil/Unstructured: 68.12%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  		pTM-score: 0.48
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 117 Family Scaffolds
PF00072Response_reg 82.91
PF13690CheX 11.97
PF00486Trans_reg_C 3.42
PF00583Acetyltransf_1 0.85
PF00528BPD_transp_1 0.85


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms100.00 %
UnclassifiedrootN/A0.00 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2088090014|GPIPI_17373632All Organisms → cellular organisms → Bacteria → Proteobacteria1438Open in IMG/M
3300001545|JGI12630J15595_10028549All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria1158Open in IMG/M
3300002067|JGI24735J21928_10108938All Organisms → cellular organisms → Bacteria → Proteobacteria796Open in IMG/M
3300002245|JGIcombinedJ26739_101855266All Organisms → cellular organisms → Bacteria → Proteobacteria504Open in IMG/M
3300003330|Ga0006571J49611_1051102All Organisms → cellular organisms → Bacteria → Proteobacteria1649Open in IMG/M
3300003331|Ga0006572J49612_1114371All Organisms → cellular organisms → Bacteria → Proteobacteria1080Open in IMG/M
3300004120|Ga0058901_1406968All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria1198Open in IMG/M
3300005260|Ga0074072_1132671All Organisms → cellular organisms → Bacteria → Proteobacteria616Open in IMG/M
3300005330|Ga0070690_100522880All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Alteromonadales → Alteromonadaceae891Open in IMG/M
3300005332|Ga0066388_102471231All Organisms → cellular organisms → Bacteria → Proteobacteria944Open in IMG/M
3300005347|Ga0070668_100701001All Organisms → cellular organisms → Bacteria893Open in IMG/M
3300005467|Ga0070706_100517360All Organisms → cellular organisms → Bacteria → Proteobacteria1110Open in IMG/M
3300005518|Ga0070699_100892775All Organisms → cellular organisms → Bacteria → Proteobacteria814Open in IMG/M
3300005538|Ga0070731_10575403All Organisms → cellular organisms → Bacteria → Proteobacteria750Open in IMG/M
3300005563|Ga0068855_100266331All Organisms → cellular organisms → Bacteria → Proteobacteria1907Open in IMG/M
3300005610|Ga0070763_10298546All Organisms → cellular organisms → Bacteria → Proteobacteria885Open in IMG/M
3300005718|Ga0068866_11024093All Organisms → cellular organisms → Bacteria588Open in IMG/M
3300005921|Ga0070766_10409967All Organisms → cellular organisms → Bacteria → Proteobacteria889Open in IMG/M
3300006047|Ga0075024_100604928All Organisms → cellular organisms → Bacteria → Proteobacteria590Open in IMG/M
3300006163|Ga0070715_10850665All Organisms → cellular organisms → Bacteria → Proteobacteria558Open in IMG/M
3300006173|Ga0070716_101541990All Organisms → cellular organisms → Bacteria → Proteobacteria544Open in IMG/M
3300006854|Ga0075425_100946085All Organisms → cellular organisms → Bacteria → Proteobacteria984Open in IMG/M
3300009093|Ga0105240_10298887All Organisms → cellular organisms → Bacteria → Proteobacteria1842Open in IMG/M
3300009093|Ga0105240_11438592All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Alteromonadales724Open in IMG/M
3300009098|Ga0105245_11939822All Organisms → cellular organisms → Bacteria642Open in IMG/M
3300009146|Ga0105091_10388644All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Steroidobacteraceae → Steroidobacter → Steroidobacter denitrificans693Open in IMG/M
3300009174|Ga0105241_11624144All Organisms → cellular organisms → Bacteria626Open in IMG/M
3300009551|Ga0105238_10985350All Organisms → cellular organisms → Bacteria → Proteobacteria863Open in IMG/M
3300010043|Ga0126380_10923847All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Alteromonadales727Open in IMG/M
3300010048|Ga0126373_10642012All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Alteromonadales → Alteromonadaceae → unclassified Alteromonadaceae → Alteromonadaceae bacterium1117Open in IMG/M
3300010359|Ga0126376_10662069All Organisms → cellular organisms → Bacteria → Proteobacteria998Open in IMG/M
3300010359|Ga0126376_11619353All Organisms → cellular organisms → Bacteria680Open in IMG/M
3300012349|Ga0137387_10803387All Organisms → cellular organisms → Bacteria681Open in IMG/M
3300012362|Ga0137361_10408882All Organisms → cellular organisms → Bacteria → Proteobacteria1247Open in IMG/M
3300012927|Ga0137416_10362824All Organisms → cellular organisms → Bacteria → Proteobacteria1218Open in IMG/M
3300012929|Ga0137404_10633407All Organisms → cellular organisms → Bacteria → Proteobacteria963Open in IMG/M
3300012930|Ga0137407_12190772All Organisms → cellular organisms → Bacteria528Open in IMG/M
3300012957|Ga0164303_11284742All Organisms → cellular organisms → Bacteria540Open in IMG/M
3300012971|Ga0126369_12479063All Organisms → cellular organisms → Bacteria604Open in IMG/M
3300012975|Ga0134110_10200705All Organisms → cellular organisms → Bacteria → Proteobacteria837Open in IMG/M
3300014489|Ga0182018_10203838All Organisms → cellular organisms → Bacteria → Proteobacteria1105Open in IMG/M
3300014968|Ga0157379_11735309All Organisms → cellular organisms → Bacteria612Open in IMG/M
3300015052|Ga0137411_1056593All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria1060Open in IMG/M
3300015373|Ga0132257_102634552All Organisms → cellular organisms → Bacteria654Open in IMG/M
3300016404|Ga0182037_11737975All Organisms → cellular organisms → Bacteria556Open in IMG/M
3300017947|Ga0187785_10668631All Organisms → cellular organisms → Bacteria542Open in IMG/M
3300017993|Ga0187823_10163048All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Steroidobacteraceae → Steroidobacter → Steroidobacter denitrificans711Open in IMG/M
3300018422|Ga0190265_12430031All Organisms → cellular organisms → Bacteria624Open in IMG/M
3300019270|Ga0181512_1328043All Organisms → cellular organisms → Bacteria801Open in IMG/M
3300020027|Ga0193752_1313627All Organisms → cellular organisms → Bacteria → Proteobacteria541Open in IMG/M
3300020199|Ga0179592_10012560All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria3686Open in IMG/M
3300020583|Ga0210401_10902016All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Steroidobacteraceae → Steroidobacter → Steroidobacter denitrificans743Open in IMG/M
3300021086|Ga0179596_10200517All Organisms → cellular organisms → Bacteria → Proteobacteria971Open in IMG/M
3300021384|Ga0213876_10418726All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Steroidobacteraceae → Steroidobacter → Steroidobacter denitrificans712Open in IMG/M
3300021402|Ga0210385_10321705All Organisms → cellular organisms → Bacteria → Proteobacteria1150Open in IMG/M
3300021474|Ga0210390_10453364All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria1082Open in IMG/M
3300021477|Ga0210398_10981909All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Steroidobacteraceae → Steroidobacter → Steroidobacter denitrificans674Open in IMG/M
3300021560|Ga0126371_11064852All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Steroidobacteraceae → Steroidobacter → Steroidobacter denitrificans949Open in IMG/M
3300022527|Ga0242664_1020502All Organisms → cellular organisms → Bacteria → Proteobacteria1035Open in IMG/M
3300022726|Ga0242654_10101596All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria904Open in IMG/M
3300024288|Ga0179589_10359693All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Steroidobacteraceae → Steroidobacter → Steroidobacter denitrificans662Open in IMG/M
3300025572|Ga0207864_1063272All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Steroidobacteraceae → Steroidobacter → Steroidobacter denitrificans882Open in IMG/M
3300025914|Ga0207671_10181329All Organisms → cellular organisms → Bacteria1639Open in IMG/M
3300025914|Ga0207671_11099518All Organisms → cellular organisms → Bacteria624Open in IMG/M
3300025929|Ga0207664_11063114All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Steroidobacteraceae → Steroidobacter → Steroidobacter denitrificans724Open in IMG/M
3300025941|Ga0207711_10489311All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Steroidobacteraceae → Steroidobacter → Steroidobacter denitrificans1146Open in IMG/M
3300026035|Ga0207703_10472637All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria1174Open in IMG/M
3300026078|Ga0207702_10910276All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria872Open in IMG/M
3300026359|Ga0257163_1044954All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Steroidobacteraceae → Steroidobacter → Steroidobacter denitrificans702Open in IMG/M
3300027537|Ga0209419_1000894All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium lablabi3438Open in IMG/M
3300027575|Ga0209525_1139222All Organisms → cellular organisms → Bacteria559Open in IMG/M
3300027603|Ga0209331_1094200All Organisms → cellular organisms → Bacteria735Open in IMG/M
3300027643|Ga0209076_1123315All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Steroidobacteraceae → Steroidobacter → Steroidobacter denitrificans731Open in IMG/M
3300027676|Ga0209333_1141205All Organisms → cellular organisms → Bacteria649Open in IMG/M
3300027727|Ga0209328_10179092All Organisms → cellular organisms → Bacteria642Open in IMG/M
3300027869|Ga0209579_10039844All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria2530Open in IMG/M
3300028380|Ga0268265_10705192All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Steroidobacteraceae → Steroidobacter → Steroidobacter denitrificans975Open in IMG/M
3300029951|Ga0311371_10681443All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria1297Open in IMG/M
3300030514|Ga0268253_10144995All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Steroidobacteraceae → Steroidobacter → Steroidobacter denitrificans732Open in IMG/M
3300030520|Ga0311372_11618785All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Steroidobacteraceae → Steroidobacter → Steroidobacter denitrificans787Open in IMG/M
3300030596|Ga0210278_1136579All Organisms → cellular organisms → Bacteria → Proteobacteria590Open in IMG/M
3300030743|Ga0265461_13285036All Organisms → cellular organisms → Bacteria546Open in IMG/M
3300031057|Ga0170834_109886666All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Steroidobacteraceae → Steroidobacter → Steroidobacter denitrificans726Open in IMG/M
3300031099|Ga0308181_1175049All Organisms → cellular organisms → Bacteria → Proteobacteria516Open in IMG/M
3300031122|Ga0170822_15284526All Organisms → cellular organisms → Bacteria630Open in IMG/M
3300031231|Ga0170824_101918965All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Steroidobacteraceae → Steroidobacter → Steroidobacter denitrificans684Open in IMG/M
3300031231|Ga0170824_126284789All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Steroidobacteraceae → Steroidobacter → Steroidobacter denitrificans1069Open in IMG/M
3300031474|Ga0170818_112406220All Organisms → cellular organisms → Bacteria565Open in IMG/M
3300031546|Ga0318538_10205672All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Steroidobacteraceae → Steroidobacter → Steroidobacter denitrificans1052Open in IMG/M
3300031546|Ga0318538_10287869All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Steroidobacteraceae → Steroidobacter → Steroidobacter denitrificans884Open in IMG/M
3300031616|Ga0307508_10526361All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Steroidobacteraceae → Steroidobacter → Steroidobacter denitrificans779Open in IMG/M
3300031682|Ga0318560_10224870All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Steroidobacteraceae → Steroidobacter → Steroidobacter denitrificans1005Open in IMG/M
3300031724|Ga0318500_10449448All Organisms → cellular organisms → Bacteria644Open in IMG/M
3300031748|Ga0318492_10815062All Organisms → cellular organisms → Bacteria → Proteobacteria503Open in IMG/M
3300031751|Ga0318494_10515295All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Steroidobacteraceae → Steroidobacter → Steroidobacter denitrificans697Open in IMG/M
3300031754|Ga0307475_11040748All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Steroidobacteraceae → Steroidobacter → Steroidobacter denitrificans642Open in IMG/M
3300031764|Ga0318535_10199909All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Steroidobacteraceae → Steroidobacter → Steroidobacter denitrificans894Open in IMG/M
3300031765|Ga0318554_10568271All Organisms → cellular organisms → Bacteria640Open in IMG/M
3300031778|Ga0318498_10275838All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Steroidobacteraceae → Steroidobacter → Steroidobacter denitrificans756Open in IMG/M
3300031797|Ga0318550_10423177All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria644Open in IMG/M
3300031798|Ga0318523_10277322All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Steroidobacteraceae → Steroidobacter → Steroidobacter denitrificans837Open in IMG/M
3300031831|Ga0318564_10179291All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Steroidobacteraceae → Steroidobacter → Steroidobacter denitrificans944Open in IMG/M
3300031832|Ga0318499_10406479All Organisms → cellular organisms → Bacteria521Open in IMG/M
3300031835|Ga0318517_10414222All Organisms → cellular organisms → Bacteria609Open in IMG/M
3300031894|Ga0318522_10110045All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Steroidobacteraceae → Steroidobacter → Steroidobacter denitrificans1024Open in IMG/M
3300031912|Ga0306921_10178952All Organisms → cellular organisms → Bacteria → Proteobacteria2486Open in IMG/M
3300031959|Ga0318530_10240085All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Steroidobacteraceae → Steroidobacter → Steroidobacter denitrificans746Open in IMG/M
3300031959|Ga0318530_10377681All Organisms → cellular organisms → Bacteria587Open in IMG/M
3300032044|Ga0318558_10435454All Organisms → cellular organisms → Bacteria653Open in IMG/M
3300032065|Ga0318513_10358558All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria710Open in IMG/M
3300032089|Ga0318525_10703626All Organisms → cellular organisms → Bacteria514Open in IMG/M
3300032126|Ga0307415_101190194All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Steroidobacteraceae → Steroidobacter → Steroidobacter denitrificans718Open in IMG/M
3300032180|Ga0307471_101050628All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Steroidobacteraceae → Steroidobacter → Steroidobacter denitrificans981Open in IMG/M
3300032261|Ga0306920_104446894All Organisms → cellular organisms → Bacteria502Open in IMG/M
3300032515|Ga0348332_10408076All Organisms → cellular organisms → Bacteria594Open in IMG/M
3300032893|Ga0335069_10125580All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria3207Open in IMG/M
3300032893|Ga0335069_12709986All Organisms → cellular organisms → Bacteria509Open in IMG/M


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil24.79%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil8.55%
Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil6.84%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil5.13%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere5.13%
Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil4.27%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil3.42%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere3.42%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil2.56%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere2.56%
Ionic Liquid And High Solid EnrichedEngineered → Lab Enrichment → Defined Media → Unclassified → Unclassified → Ionic Liquid And High Solid Enriched2.56%
Surface SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil1.71%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil1.71%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil1.71%
SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Soil1.71%
PalsaEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa1.71%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere1.71%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment0.85%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Peatland0.85%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment0.85%
WatershedsEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds0.85%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil0.85%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil0.85%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil0.85%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland0.85%
PalsaEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Palsa0.85%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil0.85%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere0.85%
Agricultural SoilEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil0.85%
Plant LitterEnvironmental → Terrestrial → Plant Litter → Unclassified → Unclassified → Plant Litter0.85%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere0.85%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere0.85%
Plant RootsHost-Associated → Plants → Roots → Unclassified → Unclassified → Plant Roots0.85%
EctomycorrhizaHost-Associated → Plants → Roots → Unclassified → Unclassified → Ectomycorrhiza0.85%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere0.85%
RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere0.85%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere0.85%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.85%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere0.85%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere0.85%
AgaveHost-Associated → Plants → Phylloplane → Unclassified → Unclassified → Agave0.85%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
2088090014Soil microbial communities from Great Prairies - Iowa, Native Prairie soilEnvironmentalOpen in IMG/M
3300001545Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M1EnvironmentalOpen in IMG/M
3300002067Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1Host-AssociatedOpen in IMG/M
3300002245Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027)EnvironmentalOpen in IMG/M
3300003330Ionic liquid and high solid enriched microbial communities from the Joint BioEnergy Institute, USA - AR20-1-R (Metagenome Metatranscriptome, Counting Only)EngineeredOpen in IMG/M
3300003331Ionic liquid and high solid enriched microbial communities from the Joint BioEnergy Institute, USA - AR20-2-R (Metagenome Metatranscriptome, Counting Only)EngineeredOpen in IMG/M
3300004120Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaT HF238 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300005260Microbial communities on the surface of kaolinite enhanced biochar from soil with fertiliser in Sydney, AustraliaEnvironmentalOpen in IMG/M
3300005330Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaGEnvironmentalOpen in IMG/M
3300005332Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300005347Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaGHost-AssociatedOpen in IMG/M
3300005467Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaGEnvironmentalOpen in IMG/M
3300005518Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaGEnvironmentalOpen in IMG/M
3300005538Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1EnvironmentalOpen in IMG/M
3300005563Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2Host-AssociatedOpen in IMG/M
3300005610Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3EnvironmentalOpen in IMG/M
3300005718Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2Host-AssociatedOpen in IMG/M
3300005921Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6EnvironmentalOpen in IMG/M
3300006047Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2013EnvironmentalOpen in IMG/M
3300006163Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaGEnvironmentalOpen in IMG/M
3300006173Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaGEnvironmentalOpen in IMG/M
3300006854Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4Host-AssociatedOpen in IMG/M
3300009093Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaGHost-AssociatedOpen in IMG/M
3300009098Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaGHost-AssociatedOpen in IMG/M
3300009146Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 10-12cm March2015EnvironmentalOpen in IMG/M
3300009174Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaGHost-AssociatedOpen in IMG/M
3300009551Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaGHost-AssociatedOpen in IMG/M
3300010043Tropical forest soil microbial communities from Panama - MetaG Plot_26EnvironmentalOpen in IMG/M
3300010048Tropical forest soil microbial communities from Panama - MetaG Plot_11EnvironmentalOpen in IMG/M
3300010359Tropical forest soil microbial communities from Panama - MetaG Plot_15EnvironmentalOpen in IMG/M
3300012349Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Sage2_R_115_16 metaGEnvironmentalOpen in IMG/M
3300012362Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaGEnvironmentalOpen in IMG/M
3300012927Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012929Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012930Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012957Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_207_MGEnvironmentalOpen in IMG/M
3300012971Tropical forest soil microbial communities from Panama - MetaG Plot_1EnvironmentalOpen in IMG/M
3300012975Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_11112015EnvironmentalOpen in IMG/M
3300014489Permafrost microbial communities from Stordalen Mire, Sweden - 812P2M metaGEnvironmentalOpen in IMG/M
3300014968Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaGHost-AssociatedOpen in IMG/M
3300015052Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (PacBio error correction)EnvironmentalOpen in IMG/M
3300015373Combined assembly of cpr5 rhizosphereHost-AssociatedOpen in IMG/M
3300016404Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082EnvironmentalOpen in IMG/M
3300017947Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0815_BV2_4_20_MGEnvironmentalOpen in IMG/M
3300017993Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_3EnvironmentalOpen in IMG/M
3300018422Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 124 TEnvironmentalOpen in IMG/M
3300019270Metatranscriptome of peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin17_10_metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300020027Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H1c1EnvironmentalOpen in IMG/M
3300020199Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300020583Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-MEnvironmentalOpen in IMG/M
3300021086Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_1_08_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300021384Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9Host-AssociatedOpen in IMG/M
3300021402Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-OEnvironmentalOpen in IMG/M
3300021474Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-OEnvironmentalOpen in IMG/M
3300021477Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-OEnvironmentalOpen in IMG/M
3300021560Tropical forest soil microbial communities from Panama - MetaG Plot_4EnvironmentalOpen in IMG/M
3300022527Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-4-O (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300022726Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-30-M (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300024288Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_08_16fungalEnvironmentalOpen in IMG/M
3300025572Ionic liquid and high solid enriched microbial communities from the Joint BioEnergy Institute, USA - AR20-2-D (SPAdes)EngineeredOpen in IMG/M
3300025914Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025929Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025941Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026035Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026078Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026359Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NR-06-AEnvironmentalOpen in IMG/M
3300027537Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM1H0_M3 (SPAdes)EnvironmentalOpen in IMG/M
3300027575Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O1 (SPAdes)EnvironmentalOpen in IMG/M
3300027603Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM3H0_M3 (SPAdes)EnvironmentalOpen in IMG/M
3300027643Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3 (SPAdes)EnvironmentalOpen in IMG/M
3300027676Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_O3 (SPAdes)EnvironmentalOpen in IMG/M
3300027727Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM3H0_M1 (SPAdes)EnvironmentalOpen in IMG/M
3300027869Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1 (SPAdes)EnvironmentalOpen in IMG/M
3300028380Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300029951III_Palsa_N1 coassemblyEnvironmentalOpen in IMG/M
3300030514Agave microbial communities from Guanajuato, Mexico - Mg.Ma.rz (v2)Host-AssociatedOpen in IMG/M
3300030520III_Palsa_N2 coassemblyEnvironmentalOpen in IMG/M
3300030596Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO135-VCO085SO (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030743Forest Soil Metatranscriptomes Boreal Montmorency Forest, Quebec, Canada VCO Co-assemblyEnvironmentalOpen in IMG/M
3300031057Oak Coassembly Site 11 - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031099Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_152 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031122Oak Spring Coassembly Site 11 - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031231Coassembly Site 11 (all samples) - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031474Fir Coassembly Site 11 - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031546Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f23EnvironmentalOpen in IMG/M
3300031616Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EMHost-AssociatedOpen in IMG/M
3300031682Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f22EnvironmentalOpen in IMG/M
3300031724Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f20EnvironmentalOpen in IMG/M
3300031748Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f22EnvironmentalOpen in IMG/M
3300031751Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f24EnvironmentalOpen in IMG/M
3300031754Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515EnvironmentalOpen in IMG/M
3300031764Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f27EnvironmentalOpen in IMG/M
3300031765Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f22EnvironmentalOpen in IMG/M
3300031778Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f24EnvironmentalOpen in IMG/M
3300031797Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f23EnvironmentalOpen in IMG/M
3300031798Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f19EnvironmentalOpen in IMG/M
3300031831Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f20EnvironmentalOpen in IMG/M
3300031832Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f25EnvironmentalOpen in IMG/M
3300031835Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f21EnvironmentalOpen in IMG/M
3300031894Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f18EnvironmentalOpen in IMG/M
3300031912Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2)EnvironmentalOpen in IMG/M
3300031959Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f24EnvironmentalOpen in IMG/M
3300032044Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f20EnvironmentalOpen in IMG/M
3300032065Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f20EnvironmentalOpen in IMG/M
3300032089Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f23EnvironmentalOpen in IMG/M
3300032126Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2Host-AssociatedOpen in IMG/M
3300032180Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515EnvironmentalOpen in IMG/M
3300032261Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2)EnvironmentalOpen in IMG/M
3300032515FICUS49499 Metatranscriptome Czech Republic combined assembly (additional data)EnvironmentalOpen in IMG/M
3300032893Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.1EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
GPIPI_035572802088090014SoilGVGMDVVARSVYALGGKIGVSTHPGKFTRFKIVLPAAEPVSTAVA
JGI12630J15595_1002854943300001545Forest SoilYALGGKIGVSTHPGRFTRFKILLPAAAQAVSTAVA*
JGI24735J21928_1010893833300002067Corn RhizosphereDVVARSVYALGGKIGVSTNPGKFTRFKIVLPAAEAANSGAAAAAV*
JGIcombinedJ26739_10185526613300002245Forest SoilRSVYALGGKIGVSTHPGRFTRFKILLPAAHAVSTAVA*
Ga0006571J49611_105110213300003330Ionic Liquid And High Solid EnrichedVVARSIYALGGRIGVSTQPGRYTRFKIALPATEEHASTAVA*
Ga0006572J49612_111437113300003331Ionic Liquid And High Solid EnrichedDVVARSIYALGGRIGVSTQPGRYTRFKIALPATEEHASTAVA*
Ga0058901_140696813300004120Forest SoilMDVVARSVYALGGKIGVSTHPGRYTRFKISLPAGAASSAVA*
Ga0074072_113267113300005260SoilVARSVYALGGKIGVSTNPGKFTRFKIVLPAAEAANSGAAAAAV*
Ga0070690_10052288013300005330Switchgrass RhizosphereVVARSVYALGGKIGVSTNPGKFTRFKIVLPAAEAANSGAAAAAV*
Ga0066388_10247123133300005332Tropical Forest SoilGVGMDVVARSVYALGGKIGVSTHPGRFTRFKIVLPVSDAVGSTAVA*
Ga0070668_10070100113300005347Switchgrass RhizosphereVAKSVYAIGGKIGVTTNPGKFTRFKVSLPASSEEASTAVA*
Ga0070706_10051736013300005467Corn, Switchgrass And Miscanthus RhizosphereVAKSVYAIGGKIGVTTNPGKFTRFKVSLPATEEANTAVA*
Ga0070699_10089277533300005518Corn, Switchgrass And Miscanthus RhizosphereVGMDVVARSVYALGGKIGVSTHPGKFTRFKIVLPSAEAVSTAVA*
Ga0070731_1057540333300005538Surface SoilALGGKIGVSTHPGRFTRFKIVLPVSETLGSTAVA*
Ga0068855_10026633163300005563Corn RhizosphereSVYALGGKIGVSTHPGKFTRFKIVLPATDAVGSTAVA*
Ga0070763_1029854613300005610SoilYALGGKIGVSTNPGKFTRFKIVLPAAEATSSTAVA*
Ga0068866_1102409323300005718Miscanthus RhizosphereSVYAIGGKIGVTTNPGKFTRFKVSLPASSEEASTAVA*
Ga0070766_1040996733300005921SoilRSVYALGGKIGVSTHPGKYTRFKISLPGGQAAGNSAVA*
Ga0075024_10060492823300006047WatershedsVYALGGKIGVSTHPGKYTRFKIVLPAADAVGSTAVA*
Ga0070715_1085066513300006163Corn, Switchgrass And Miscanthus RhizosphereVYALGGKIGVSTHPGKFTRFKIVLPSAEAVSTAVA*
Ga0070716_10154199013300006173Corn, Switchgrass And Miscanthus RhizosphereDVVARSVYALGGKIGVSTNPGKFTRFKIVLPAAESANAAVAV*
Ga0075425_10094608513300006854Populus RhizosphereGMDVVARSVYALGGKIGVSTHPGKFTRFKIVLPATDAVGSTAVA*
Ga0105240_1029888713300009093Corn RhizosphereRSVYALGGKIGVSTNPGKFTRFKIVLPAAEAASTAVA*
Ga0105240_1143859233300009093Corn RhizosphereVGMDVVARSVHALGGKIGVSTNPGKFTRFKIALPAAEAANTAVA*
Ga0105245_1193982223300009098Miscanthus RhizosphereSVYALGGKIGVSTNPGKFTRFKIVLPAAEAASTAVA*
Ga0105091_1038864413300009146Freshwater SedimentRSVYAAGGRIGVATGLGKFTRFKITLPAIAAAANTAVA*
Ga0105241_1162414413300009174Corn RhizosphereMDVVARSIYALGGKIGVSTNPGKFTRFKIVLPAAEAASTAVA*
Ga0105238_1098535013300009551Corn RhizosphereSVYALGGKIGVSTNPGKFTRFKIVLPAAESPSAAVAV*
Ga0126380_1092384733300010043Tropical Forest SoilVARSVYALGGKIGVSTHPGKFTRFKIVLPAAEPVSTAVA*
Ga0126373_1064201233300010048Tropical Forest SoilMDVVARNIYALGGRIGVSTSPGKFTRFKITLPLSPERADTAVA*
Ga0126376_1066206933300010359Tropical Forest SoilYALGGKVGVSTHPGKFTRFRIVLPATEAVSTAVA*
Ga0126376_1161935313300010359Tropical Forest SoilDVVAKSVYAIGGKIGVTTNPGKFTRFKVSLPATEEANTAVA*
Ga0137387_1080338713300012349Vadose Zone SoilGMDVVARSVYALGGKIGVSTNPGKFTRFKIVLPAAESANAAVAV*
Ga0137361_1040888243300012362Vadose Zone SoilGVGMDVVARSVYKLGGKIGVSTNPGKYTRFKILLPAAGAASTAVA*
Ga0137416_1036282443300012927Vadose Zone SoilMDVVARSVYSLGGKIGVSTHPGRFTRFKILLPAVQAVSSAVA*
Ga0137404_1063340733300012929Vadose Zone SoilGVGMDVVARSVYALGGKIGVSTNPGKFTRFKIVLPAAEAANNAAVAV*
Ga0137407_1219077213300012930Vadose Zone SoilYALGGKIGVSTNPGKFTRFKIVLPAAEAANNAAVAV*
Ga0164303_1128474213300012957SoilSVYALGGKIGVSTHPGKRTRFKIVLPAAEAVSTAVA*
Ga0126369_1247906313300012971Tropical Forest SoilVGMDVVARSVYALGGKIGVSTHPGRFTRFKIVLPVSDAVGSTAVA*
Ga0134110_1020070533300012975Grasslands SoilVYALGGRIGVSTHPGRFTRFKILLPAAQAVSSAVA*
Ga0182018_1020383843300014489PalsaSVANLGGKIGVSTHPGKFTRFRVVLPGVDADSAAVA*
Ga0157379_1173530913300014968Switchgrass RhizosphereRSVYALGGKIGVSTNPGKFTRFKIVLPAAESANAAMAV*
Ga0137411_105659313300015052Vadose Zone SoilALGGKIDALGGKIGVSTHPGRFTRFKILLPAAAQAVSTAVA*
Ga0132257_10263455233300015373Arabidopsis RhizosphereKSVYAIGGKIGVTTNTGKFTRFKVSLPASSEEASTAVA*
Ga0182037_1173797513300016404SoilMDVVARSVYALGGKIGVSTHPGKFTRFKIVLPAAEPVSTAVA
Ga0187785_1066863123300017947Tropical PeatlandVARSVYALGGKIGVSTHPGKFTRFKIVLPATDSVSSTAVA
Ga0187823_1016304813300017993Freshwater SedimentVGMDVIARSVYALGGKIGVSTHPGKYTRFKISLPAGQASSSAVA
Ga0190265_1243003113300018422SoilMDVVARSVYGAGGRIGVATGLGKFTRFKITLPAIAAVANTAVA
Ga0181512_132804313300019270PeatlandRGVGMDVVARSVYALGGKIGVSTNPGKFTRFKIVLPAAEAANSGAAVAAV
Ga0193752_131362723300020027SoilGVGMDVVAKSVHAIGGKIGVTTNPGKFTRFKVSLPATEEANTAVA
Ga0179592_1001256093300020199Vadose Zone SoilRSVYSLGGKIGVSTHPGRFTRFKILLPAAQAVSSAVA
Ga0210401_1090201633300020583SoilVYALGGKIGVSTHPGKFTRFKIVLPAVDAAGSSAVA
Ga0179596_1020051713300021086Vadose Zone SoilDVVARSVYALGGKIGVSTNPGKFTRFKIVLPAAEAASTAVA
Ga0213876_1041872633300021384Plant RootsVVARSVYALGGKIGVSTNPGKFTRFKIVLPAAEAPSAAVAV
Ga0210385_1032170543300021402SoilVYALGGKIGVSTHPGRFTRFKIVLPAVEAARTAVA
Ga0210390_1045336413300021474SoilVVARSVYALGGKIGVSTHPGRYTRFKISLPAGAASSAVA
Ga0210398_1098190933300021477SoilVGMDVVARSVYALGGKIGVSTNPGKFTRFKIVLPAAESANTAVAV
Ga0126371_1106485233300021560Tropical Forest SoilGVGMDVVARSVYALGGKIGVSTHPGKFTRFKIVLPAAEAVSTAVA
Ga0242664_102050213300022527SoilRGVGMDVVARSVYALGGKIGVSTNPGKFTRFKIVLPAAEASSSTAVA
Ga0242654_1010159633300022726SoilEVVARSVYALGGKIGVSTHPGRYTRFKISLPAGAASSAVA
Ga0179589_1035969333300024288Vadose Zone SoilYALGGKIGVSTNPGKFTRFKIVLPAAEAANSGAAVAV
Ga0207864_106327213300025572Ionic Liquid And High Solid EnrichedVAKSVYAIGGKIGVTTNPGKFTRFKVSLPASEETSTAVA
Ga0207671_1018132943300025914Corn RhizosphereRSVYALGGKIGVSTNPGKFTRFKIVLPAAEAASTAVA
Ga0207671_1109951813300025914Corn RhizosphereGMDVVARSIYALGGKIGVATNPGKFTRFKIALPAVRQETSTAVA
Ga0207664_1106311433300025929Agricultural SoilVGMDVVARSVYALGGKIGVSTNPGKFTRFKIVLPAAEEASTAVA
Ga0207711_1048931133300025941Switchgrass RhizosphereYALGGKIGVSTNPGKFTRFKIVLPAAEAANSGAAAAAV
Ga0207703_1047263713300026035Switchgrass RhizosphereVVARSIYALSGKIGVATNPGKFTRFKIALPAVRQETSTAVA
Ga0207702_1091027613300026078Corn RhizosphereRSVYALGGKIGVSTNPGKFTRFKIVLPAAEEASAVA
Ga0257163_104495433300026359SoilDVVARSVYALGGKIGVSTHPGRFTRFKILLPAAAQAVSSAVA
Ga0209419_100089413300027537Forest SoilMDVVARSVYALGGKIGVSTHPGRFTRFKILLPAAQAVSTAVA
Ga0209525_113922223300027575Forest SoilGVGMDVVARSVYALGGKIGVSTHPGRFTRFKILLPAAQAVSTAVA
Ga0209331_109420033300027603Forest SoilRSVYALGGKIGVSTNPGKFTRFKIVLPAAEPANAAVAV
Ga0209076_112331513300027643Vadose Zone SoilARSVYSLGGKIGVSTHPGRFTRFKILLPAVQAVSSAVA
Ga0209333_114120523300027676Forest SoilMDVVARSVHALGGKIGVSTHPGKFTRFKIVLPAVEAARTAVA
Ga0209328_1017909233300027727Forest SoilVVARAVYALGGKIGVSTHPGKFTRFKIVLPASDAVTAVA
Ga0209579_1003984483300027869Surface SoilRSVALLGGKIGVTTNPGKFTRFKIALPVSEGADSAVA
Ga0268265_1070519213300028380Switchgrass RhizosphereKSVYAIGGKIGVTTNPGKFTRFKVSLPATEEANTAVA
Ga0311371_1068144313300029951PalsaVARSVYALGGKIGVSTHPGRFTRFKIVLPAVEAARTAVA
Ga0268253_1014499533300030514AgaveGVGMDVVAKSVYAIGGKIGVTTNPGKFTRFKVSLPASEEASTQVA
Ga0311372_1161878513300030520PalsaMDVVARSVYALGGKIGVSTNPGKFTRFKIVLPAAEAASSTAVA
Ga0210278_113657923300030596SoilRGVGMDVVARSVYALGGKIGVSTHPGRFTRFKILLPPAQAVSTAVA
Ga0265461_1328503623300030743SoilVGMDVVARSVYALGGKIGVSTHPGRFTRFKILLPPAQAVSTAVA
Ga0170834_10988666633300031057Forest SoilARSVYALGGKIGVSTHPGRFTRFKIVLPSSDSVSSTAVA
Ga0308181_117504923300031099SoilVGMDVVAKSVYAIGGKIGVTTNPGKFTRFKVSLPATEEANTAVA
Ga0170822_1528452613300031122Forest SoilRGVGMDVVARSVANLGGKIGVSTHPGKFTRFRVVLPSADESSAAVA
Ga0170824_10191896533300031231Forest SoilRSVYALGGKIGVSTNPGKFTRFKIVLPAAEAANTGAAVAV
Ga0170824_12628478933300031231Forest SoilDVVARSVYTLGGKIGVSTNPGKLTRFKIVLPATEEASTAVA
Ga0170818_11240622023300031474Forest SoilVGMDVVARSVYALGGKIGVSTNPGKFTRFKIVLPAAEAASTAVA
Ga0318538_1020567233300031546SoilSVYALGGKIGVSTHPGKFTRFKIVLPATEAVSTAVA
Ga0318538_1028786933300031546SoilVYALGGKLGVSTHPGKFTRFKIVLPATEAVSTAVA
Ga0307508_1052636113300031616EctomycorrhizaVVARSVYALGGKIGVSTNPGKFTRFKIVLPAAEAANSGASAAAV
Ga0318560_1022487033300031682SoilRSVYALGGKLGVSTHPGKFTRFKIVLPATEAVSTAVA
Ga0318500_1044944813300031724SoilMDVVARSVYALGGKIGVSTHPGKFTRFKIVLPATEAVSTAVA
Ga0318492_1081506223300031748SoilGMDVVARSISAIGGKIGVSTNPGKFTRFRIALPLTQDADSAVA
Ga0318494_1051529513300031751SoilDLVARSVYALGGKIGVSTHPGKFTRFKIVLPATEAVSTAVA
Ga0307475_1104074833300031754Hardwood Forest SoilVGMDVVARSVYALGGRIGVSTHPGKYTRFKISLPAGQASSSAVA
Ga0318535_1019990913300031764SoilGMDVVARSVYALGGKIGVSTHPGKFTRFKIVLPAAEPVSTAVA
Ga0318554_1056827113300031765SoilMDVVARSVAGLGGKIGVSTHPGKYTRFRVVLPDIDPDSVAVA
Ga0318498_1027583833300031778SoilVGMDVVARSVYALGGKIGVSTHPGKFTRFKIVLPAAEPVSTAVA
Ga0318550_1042317733300031797SoilVHLLGGRIGVSTHPGRYTRFKIVLPADESLSTAVA
Ga0318523_1027732233300031798SoilARSVYALGGKIGVSTHPGKFTRFKIVLPATDSLNTAVA
Ga0318564_1017929113300031831SoilVYALGGKIGVSTHAGKFTRFKIVLPATEAVSTAVA
Ga0318499_1040647923300031832SoilVYALGGKIGVSTHPGKFTRFKIVLPTSESVSTAVA
Ga0318517_1041422223300031835SoilGMDLVARSVYALGGKIGVSTHPGKFTRFKIVLPATEAVSTAVA
Ga0318522_1011004533300031894SoilVVARSVYALGGKIGVSTHPGKFTRFKIVLPATDESVSTAVA
Ga0306921_1017895253300031912SoilVARSVYALGGRIGVSTHPGRYTRFKIVLPADESLSTAVA
Ga0318530_1024008533300031959SoilVYALGGKIGVSTHPGKFTRFKIVLPATEPASTAVA
Ga0318530_1037768113300031959SoilVGMDVVARSVYALGGKIGVSTHPGKFTRFKIVLPATEAVSTAVA
Ga0318558_1043545433300032044SoilDLVARSVYALGGKIGVSTHPGKFTRFKIVLPAAEPVSTAVA
Ga0318513_1035855833300032065SoilVYALGGRIGVSTHPGRYTRFKIVLPADESLSTAVA
Ga0318525_1070362623300032089SoilVGMDVVARSVYALGGKIGVSTHPGKFTRFKIVLPAAEAVSTAVA
Ga0307415_10119019413300032126RhizosphereVVAKSVYAIGGKIGVTTNPGKFTRFKVSLPATEEANTAVA
Ga0307471_10105062833300032180Hardwood Forest SoilDVVARSVYALGGKIGVSTHPGKFTRFKIVLPSAEAVSTAVA
Ga0306920_10444689423300032261SoilSVYALGGKIGVSTHPGKFTRFKIVLPATDSLNTAVA
Ga0348332_1040807613300032515Plant LitterRSVANLGGKIVVSTHPGKFTRFRVVLPGADSDSAAVA
Ga0335069_1012558053300032893SoilDVVARSVYALGGKIGVSTHPGKYTRFKILLPGAEPASTAVA
Ga0335069_1270998623300032893SoilSVYALGGKIGVSTHPGKYTRFKISLPGGAAAGNSAVA

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.