NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F077989

Metagenome / Metatranscriptome Family F077989

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F077989
Family Type Metagenome / Metatranscriptome
Number of Sequences 117
Average Sequence Length 43 residues
Representative Sequence MIARVVKYHSIAEWNFSLWFALLSPLIGILLGILGGFLLYH
Number of Associated Samples 107
Number of Associated Scaffolds 117

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 66.38 %
% of genes near scaffold ends (potentially truncated) 34.19 %
% of genes from short scaffolds (< 2000 bps) 88.03 %
Associated GOLD sequencing projects 105
AlphaFold2 3D model prediction Yes
3D model pTM-score0.43

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (88.889 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil
(24.786 % of family members)
Environment Ontology (ENVO) Unclassified
(39.316 % of family members)
Earth Microbiome Project Ontology (EMPO) Host-associated → Plant → Plant rhizosphere
(47.863 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Transmembrane (alpha-helical) Signal Peptide: No Secondary Structure distribution: α-helix: 56.52%    β-sheet: 0.00%    Coil/Unstructured: 43.48%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  		pTM-score: 0.43
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 117 Family Scaffolds
PF13602ADH_zinc_N_2 51.28
PF00171Aldedh 5.13
PF04542Sigma70_r2 2.56
PF07992Pyr_redox_2 1.71
PF05368NmrA 1.71
PF00069Pkinase 1.71
PF00072Response_reg 0.85
PF08240ADH_N 0.85
PF02627CMD 0.85
PF02861Clp_N 0.85
PF07690MFS_1 0.85
PF00873ACR_tran 0.85
PF02915Rubrerythrin 0.85
PF04545Sigma70_r4 0.85
PF03466LysR_substrate 0.85
PF03358FMN_red 0.85
PF02515CoA_transf_3 0.85

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 117 Family Scaffolds
COG0515Serine/threonine protein kinaseSignal transduction mechanisms [T] 6.84
COG0014Gamma-glutamyl phosphate reductaseAmino acid transport and metabolism [E] 5.13
COG1012Acyl-CoA reductase or other NAD-dependent aldehyde dehydrogenaseLipid transport and metabolism [I] 5.13
COG4230Delta 1-pyrroline-5-carboxylate dehydrogenaseAmino acid transport and metabolism [E] 5.13
COG0568DNA-directed RNA polymerase, sigma subunit (sigma70/sigma32)Transcription [K] 2.56
COG1191DNA-directed RNA polymerase specialized sigma subunitTranscription [K] 2.56
COG1595DNA-directed RNA polymerase specialized sigma subunit, sigma24 familyTranscription [K] 2.56
COG4941Predicted RNA polymerase sigma factor, contains C-terminal TPR domainTranscription [K] 2.56
COG0542ATP-dependent Clp protease, ATP-binding subunit ClpAPosttranslational modification, protein turnover, chaperones [O] 0.85
COG0599Uncharacterized conserved protein YurZ, alkylhydroperoxidase/carboxymuconolactone decarboxylase familyGeneral function prediction only [R] 0.85
COG1804Crotonobetainyl-CoA:carnitine CoA-transferase CaiB and related acyl-CoA transferasesLipid transport and metabolism [I] 0.85
COG2128Alkylhydroperoxidase family enzyme, contains CxxC motifInorganic ion transport and metabolism [P] 0.85

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms88.89 %
UnclassifiedrootN/A11.11 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2088090014|GPIPI_16649921All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Candidatus Udaeobacter1346Open in IMG/M
3300001369|JGI12701J14581_1015753All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium538Open in IMG/M
3300002245|JGIcombinedJ26739_100972547All Organisms → cellular organisms → Bacteria733Open in IMG/M
3300002886|JGI25612J43240_1081560All Organisms → cellular organisms → Bacteria512Open in IMG/M
3300005093|Ga0062594_100200582All Organisms → cellular organisms → Bacteria1390Open in IMG/M
3300005181|Ga0066678_10201334All Organisms → cellular organisms → Bacteria1271Open in IMG/M
3300005186|Ga0066676_10512849All Organisms → cellular organisms → Bacteria814Open in IMG/M
3300005289|Ga0065704_10177121All Organisms → cellular organisms → Bacteria1258Open in IMG/M
3300005289|Ga0065704_10477133All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia684Open in IMG/M
3300005289|Ga0065704_10653090All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium582Open in IMG/M
3300005354|Ga0070675_101819825All Organisms → cellular organisms → Bacteria562Open in IMG/M
3300005355|Ga0070671_100626528All Organisms → cellular organisms → Bacteria930Open in IMG/M
3300005364|Ga0070673_101778945Not Available584Open in IMG/M
3300005365|Ga0070688_101320313Not Available583Open in IMG/M
3300005367|Ga0070667_100148311Not Available2058Open in IMG/M
3300005436|Ga0070713_100256335All Organisms → cellular organisms → Bacteria1597Open in IMG/M
3300005437|Ga0070710_10327446All Organisms → cellular organisms → Bacteria1008Open in IMG/M
3300005450|Ga0066682_10757161All Organisms → cellular organisms → Bacteria591Open in IMG/M
3300005458|Ga0070681_11989162Not Available509Open in IMG/M
3300005549|Ga0070704_101866750All Organisms → cellular organisms → Bacteria557Open in IMG/M
3300005552|Ga0066701_10050426Not Available2282Open in IMG/M
3300005552|Ga0066701_10342397All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria926Open in IMG/M
3300005554|Ga0066661_10054657All Organisms → cellular organisms → Bacteria2294Open in IMG/M
3300005555|Ga0066692_10202292Not Available1243Open in IMG/M
3300005556|Ga0066707_10457377All Organisms → cellular organisms → Bacteria828Open in IMG/M
3300005559|Ga0066700_10702378All Organisms → cellular organisms → Bacteria693Open in IMG/M
3300005574|Ga0066694_10317262All Organisms → cellular organisms → Bacteria742Open in IMG/M
3300005618|Ga0068864_102328294All Organisms → cellular organisms → Bacteria542Open in IMG/M
3300006028|Ga0070717_11362564All Organisms → cellular organisms → Bacteria644Open in IMG/M
3300006034|Ga0066656_10896955All Organisms → cellular organisms → Bacteria → Terrabacteria group568Open in IMG/M
3300006046|Ga0066652_100334489All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium1357Open in IMG/M
3300006175|Ga0070712_100298288All Organisms → cellular organisms → Bacteria → Proteobacteria1303Open in IMG/M
3300006176|Ga0070765_100314124All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia1451Open in IMG/M
3300006755|Ga0079222_10013991All Organisms → cellular organisms → Bacteria3023Open in IMG/M
3300006893|Ga0073928_10341687All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium1111Open in IMG/M
3300007255|Ga0099791_10518404All Organisms → cellular organisms → Bacteria580Open in IMG/M
3300007788|Ga0099795_10168439All Organisms → cellular organisms → Bacteria908Open in IMG/M
3300009038|Ga0099829_11377895All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium583Open in IMG/M
3300009089|Ga0099828_11784884Not Available540Open in IMG/M
3300009098|Ga0105245_13212437Not Available506Open in IMG/M
3300009137|Ga0066709_104483297All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium510Open in IMG/M
3300009143|Ga0099792_10761323All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium631Open in IMG/M
3300010159|Ga0099796_10518741All Organisms → cellular organisms → Bacteria534Open in IMG/M
3300010304|Ga0134088_10554706All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium569Open in IMG/M
3300010396|Ga0134126_12160029All Organisms → cellular organisms → Bacteria608Open in IMG/M
3300010862|Ga0126348_1272286All Organisms → cellular organisms → Bacteria568Open in IMG/M
3300011269|Ga0137392_10328478All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Burkholderia → Burkholderia cepacia complex → Burkholderia cenocepacia1266Open in IMG/M
3300011271|Ga0137393_11005855All Organisms → cellular organisms → Bacteria710Open in IMG/M
3300012169|Ga0153990_1118570All Organisms → cellular organisms → Bacteria590Open in IMG/M
3300012189|Ga0137388_10349622All Organisms → cellular organisms → Bacteria1363Open in IMG/M
3300012198|Ga0137364_10161676All Organisms → cellular organisms → Bacteria1625Open in IMG/M
3300012200|Ga0137382_10132096All Organisms → cellular organisms → Bacteria1678Open in IMG/M
3300012202|Ga0137363_11188122All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Nitrosomonadaceae → Nitrosospira → unclassified Nitrosospira → Nitrosospira sp. Nsp2649Open in IMG/M
3300012203|Ga0137399_11731174All Organisms → cellular organisms → Bacteria513Open in IMG/M
3300012350|Ga0137372_11222261All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium506Open in IMG/M
3300012363|Ga0137390_10579569All Organisms → cellular organisms → Bacteria → Proteobacteria1091Open in IMG/M
3300012685|Ga0137397_10613997All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia809Open in IMG/M
3300012915|Ga0157302_10083895All Organisms → cellular organisms → Bacteria973Open in IMG/M
3300012922|Ga0137394_10211796All Organisms → cellular organisms → Bacteria1657Open in IMG/M
3300012923|Ga0137359_11249384All Organisms → cellular organisms → Bacteria631Open in IMG/M
3300012927|Ga0137416_10396870All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia1168Open in IMG/M
3300012929|Ga0137404_10964679All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium779Open in IMG/M
3300012929|Ga0137404_11544387All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium615Open in IMG/M
3300012951|Ga0164300_10117787All Organisms → cellular organisms → Bacteria1195Open in IMG/M
3300012960|Ga0164301_10796422All Organisms → cellular organisms → Bacteria722Open in IMG/M
3300012961|Ga0164302_10622109All Organisms → cellular organisms → Bacteria786Open in IMG/M
3300012988|Ga0164306_10429715All Organisms → cellular organisms → Bacteria999Open in IMG/M
3300013296|Ga0157374_10266575All Organisms → cellular organisms → Bacteria1688Open in IMG/M
3300013296|Ga0157374_11173007All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium789Open in IMG/M
3300013296|Ga0157374_11250960All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium764Open in IMG/M
3300013297|Ga0157378_10098406All Organisms → cellular organisms → Bacteria2667Open in IMG/M
3300013306|Ga0163162_13056332All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium537Open in IMG/M
3300015052|Ga0137411_1049570All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia1837Open in IMG/M
3300015077|Ga0173483_10646413All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium589Open in IMG/M
3300015242|Ga0137412_10154793All Organisms → cellular organisms → Bacteria1847Open in IMG/M
3300015242|Ga0137412_11239607Not Available522Open in IMG/M
3300015371|Ga0132258_12929282All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1185Open in IMG/M
3300017659|Ga0134083_10471882All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium558Open in IMG/M
3300018027|Ga0184605_10189736All Organisms → cellular organisms → Bacteria931Open in IMG/M
3300018027|Ga0184605_10510265All Organisms → cellular organisms → Bacteria → Terrabacteria group522Open in IMG/M
3300018431|Ga0066655_10955860All Organisms → cellular organisms → Bacteria589Open in IMG/M
3300018433|Ga0066667_10027150All Organisms → cellular organisms → Bacteria3159Open in IMG/M
3300019789|Ga0137408_1000757All Organisms → cellular organisms → Bacteria995Open in IMG/M
3300019879|Ga0193723_1039065All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Candidatus Udaeobacter → Candidatus Udaeobacter copiosus1413Open in IMG/M
3300019882|Ga0193713_1094734All Organisms → cellular organisms → Bacteria834Open in IMG/M
3300019883|Ga0193725_1063683All Organisms → cellular organisms → Bacteria920Open in IMG/M
3300019887|Ga0193729_1060391All Organisms → cellular organisms → Bacteria1517Open in IMG/M
3300020021|Ga0193726_1033038All Organisms → cellular organisms → Bacteria2552Open in IMG/M
3300020581|Ga0210399_10610363All Organisms → cellular organisms → Bacteria902Open in IMG/M
3300021046|Ga0215015_10382100All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae6079Open in IMG/M
3300021078|Ga0210381_10160659All Organisms → cellular organisms → Bacteria767Open in IMG/M
3300021086|Ga0179596_10677802All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium522Open in IMG/M
3300022756|Ga0222622_10296574All Organisms → cellular organisms → Bacteria1111Open in IMG/M
3300024288|Ga0179589_10446881Not Available596Open in IMG/M
3300025906|Ga0207699_10471367Not Available903Open in IMG/M
3300025939|Ga0207665_10307465All Organisms → cellular organisms → Bacteria1187Open in IMG/M
3300026023|Ga0207677_12009766All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium537Open in IMG/M
3300026351|Ga0257170_1027840All Organisms → cellular organisms → Bacteria757Open in IMG/M
3300026354|Ga0257180_1013999All Organisms → cellular organisms → Bacteria991Open in IMG/M
3300026515|Ga0257158_1042927All Organisms → cellular organisms → Bacteria822Open in IMG/M
3300026557|Ga0179587_10540590All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium766Open in IMG/M
3300026557|Ga0179587_10890954All Organisms → cellular organisms → Bacteria587Open in IMG/M
3300027537|Ga0209419_1001157All Organisms → cellular organisms → Bacteria3220Open in IMG/M
3300027537|Ga0209419_1005015Not Available2034Open in IMG/M
3300027635|Ga0209625_1006428All Organisms → cellular organisms → Bacteria2554Open in IMG/M
3300027727|Ga0209328_10001504All Organisms → cellular organisms → Bacteria6465Open in IMG/M
3300027787|Ga0209074_10329038All Organisms → cellular organisms → Bacteria → Terrabacteria group620Open in IMG/M
3300028379|Ga0268266_10290697All Organisms → cellular organisms → Bacteria1522Open in IMG/M
3300028673|Ga0257175_1002934All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium2111Open in IMG/M
3300030923|Ga0138296_1117897All Organisms → cellular organisms → Bacteria1291Open in IMG/M
3300031128|Ga0170823_17693159All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium516Open in IMG/M
3300031231|Ga0170824_120871186All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium776Open in IMG/M
3300031754|Ga0307475_11369567All Organisms → cellular organisms → Bacteria546Open in IMG/M
3300031820|Ga0307473_11166413All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium571Open in IMG/M
3300031962|Ga0307479_11684173All Organisms → cellular organisms → Bacteria588Open in IMG/M
3300032174|Ga0307470_10114770All Organisms → cellular organisms → Bacteria1576Open in IMG/M


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil24.79%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil11.11%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil10.26%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere5.98%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil5.13%
Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil5.13%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil3.42%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil3.42%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere3.42%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere3.42%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Switchgrass Rhizosphere2.56%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment1.71%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil1.71%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil1.71%
Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil1.71%
Groundwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment0.85%
Iron-Sulfur Acid SpringEnvironmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring0.85%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment0.85%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil0.85%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Switchgrass Rhizosphere0.85%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil0.85%
SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Soil0.85%
Corn RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere0.85%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere0.85%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere0.85%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere0.85%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere0.85%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere0.85%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.85%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere0.85%
Attine Ant Fungus GardensHost-Associated → Fungi → Mycelium → Unclassified → Unclassified → Attine Ant Fungus Gardens0.85%
Boreal Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil0.85%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
2088090014Soil microbial communities from Great Prairies - Iowa, Native Prairie soilEnvironmentalOpen in IMG/M
3300001369Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM3H0_M1EnvironmentalOpen in IMG/M
3300002245Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027)EnvironmentalOpen in IMG/M
3300002886Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_20cmEnvironmentalOpen in IMG/M
3300005093Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All BlocksEnvironmentalOpen in IMG/M
3300005181Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_127EnvironmentalOpen in IMG/M
3300005186Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_125EnvironmentalOpen in IMG/M
3300005289Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2Host-AssociatedOpen in IMG/M
3300005294Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 Bulk SoilEnvironmentalOpen in IMG/M
3300005354Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaGHost-AssociatedOpen in IMG/M
3300005355Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaGHost-AssociatedOpen in IMG/M
3300005364Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaGHost-AssociatedOpen in IMG/M
3300005365Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaGEnvironmentalOpen in IMG/M
3300005367Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaGHost-AssociatedOpen in IMG/M
3300005436Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaGEnvironmentalOpen in IMG/M
3300005437Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaGEnvironmentalOpen in IMG/M
3300005450Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_131EnvironmentalOpen in IMG/M
3300005458Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaGEnvironmentalOpen in IMG/M
3300005549Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaGEnvironmentalOpen in IMG/M
3300005552Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_150EnvironmentalOpen in IMG/M
3300005554Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110EnvironmentalOpen in IMG/M
3300005555Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141EnvironmentalOpen in IMG/M
3300005556Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156EnvironmentalOpen in IMG/M
3300005559Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149EnvironmentalOpen in IMG/M
3300005574Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_143EnvironmentalOpen in IMG/M
3300005618Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2Host-AssociatedOpen in IMG/M
3300006028Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaGEnvironmentalOpen in IMG/M
3300006034Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_105EnvironmentalOpen in IMG/M
3300006046Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101EnvironmentalOpen in IMG/M
3300006175Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaGEnvironmentalOpen in IMG/M
3300006176Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5EnvironmentalOpen in IMG/M
3300006755Agricultural soil microbial communities from Georgia to study Nitrogen management - GA PlitterEnvironmentalOpen in IMG/M
3300006893Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPA 5.5 metaGEnvironmentalOpen in IMG/M
3300007255Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1EnvironmentalOpen in IMG/M
3300007788Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2EnvironmentalOpen in IMG/M
3300009038Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaGEnvironmentalOpen in IMG/M
3300009089Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaGEnvironmentalOpen in IMG/M
3300009098Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaGHost-AssociatedOpen in IMG/M
3300009137Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158EnvironmentalOpen in IMG/M
3300009143Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2EnvironmentalOpen in IMG/M
3300010159Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3EnvironmentalOpen in IMG/M
3300010304Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09182015EnvironmentalOpen in IMG/M
3300010396Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2EnvironmentalOpen in IMG/M
3300010862Boreal forest soil eukaryotic communities from Alaska, USA - C4-4 Metatranscriptome (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300011269Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaGEnvironmentalOpen in IMG/M
3300011271Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaGEnvironmentalOpen in IMG/M
3300012169Attine ant fungus gardens microbial communities from North Carolina, USA - TSNC074 MetaGHost-AssociatedOpen in IMG/M
3300012189Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaGEnvironmentalOpen in IMG/M
3300012198Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaGEnvironmentalOpen in IMG/M
3300012200Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaGEnvironmentalOpen in IMG/M
3300012202Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaGEnvironmentalOpen in IMG/M
3300012203Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaGEnvironmentalOpen in IMG/M
3300012350Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_60_16 metaGEnvironmentalOpen in IMG/M
3300012363Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaGEnvironmentalOpen in IMG/M
3300012685Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz1.16 metaGEnvironmentalOpen in IMG/M
3300012915Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S103-311B-2EnvironmentalOpen in IMG/M
3300012922Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaGEnvironmentalOpen in IMG/M
3300012923Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaGEnvironmentalOpen in IMG/M
3300012927Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012929Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012951Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_226_MGEnvironmentalOpen in IMG/M
3300012960Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MGEnvironmentalOpen in IMG/M
3300012961Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_202_MGEnvironmentalOpen in IMG/M
3300012988Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_242_MGEnvironmentalOpen in IMG/M
3300013296Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaGHost-AssociatedOpen in IMG/M
3300013297Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaGHost-AssociatedOpen in IMG/M
3300013306Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaGHost-AssociatedOpen in IMG/M
3300015052Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (PacBio error correction)EnvironmentalOpen in IMG/M
3300015077Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S178-409R-2 (version 2)EnvironmentalOpen in IMG/M
3300015242Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300015371Combined assembly of cpr5 and col0 rhizosphere and soilHost-AssociatedOpen in IMG/M
3300017659Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_40cm_5_24_1 metaGEnvironmentalOpen in IMG/M
3300018027Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30_coexEnvironmentalOpen in IMG/M
3300018431Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_104EnvironmentalOpen in IMG/M
3300018433Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116EnvironmentalOpen in IMG/M
3300019789Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (PacBio error correction)EnvironmentalOpen in IMG/M
3300019879Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2m2EnvironmentalOpen in IMG/M
3300019882Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H3a2EnvironmentalOpen in IMG/M
3300019883Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2a2EnvironmentalOpen in IMG/M
3300019887Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1c2EnvironmentalOpen in IMG/M
3300020021Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2c1EnvironmentalOpen in IMG/M
3300020581Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-MEnvironmentalOpen in IMG/M
3300021046Soil microbial communities from Shale Hills CZO, Pennsylvania, United States - 90cm depthEnvironmentalOpen in IMG/M
3300021078Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_5_coex redoEnvironmentalOpen in IMG/M
3300021086Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_1_08_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300022756Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5_b1EnvironmentalOpen in IMG/M
3300024288Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_08_16fungalEnvironmentalOpen in IMG/M
3300025906Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025939Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300026023Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026351Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DW-05-BEnvironmentalOpen in IMG/M
3300026354Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NR-04-BEnvironmentalOpen in IMG/M
3300026515Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NL-03-AEnvironmentalOpen in IMG/M
3300026557Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungalEnvironmentalOpen in IMG/M
3300027537Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM1H0_M3 (SPAdes)EnvironmentalOpen in IMG/M
3300027635Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_M2 (SPAdes)EnvironmentalOpen in IMG/M
3300027727Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM3H0_M1 (SPAdes)EnvironmentalOpen in IMG/M
3300027787Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter (SPAdes)EnvironmentalOpen in IMG/M
3300028379Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300028673Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NI-69-BEnvironmentalOpen in IMG/M
3300030923Forest soil microbial communities from Spain - ITS-tags Site 9-Mixed-thinned forest site A3_MS_autumn Metatranscriptome (Eukaryote Community Metatranscriptome) (version 2)EnvironmentalOpen in IMG/M
3300031128Oak Summer Coassembly Site 11 - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031231Coassembly Site 11 (all samples) - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031754Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515EnvironmentalOpen in IMG/M
3300031820Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515EnvironmentalOpen in IMG/M
3300031962Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515EnvironmentalOpen in IMG/M
3300032174Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
GPIPI_009868502088090014SoilMTIKWHTAPEWDFSLWFALLSPLFGALLGVLGVFILGR
JGI12701J14581_101575323300001369Forest SoilMKARPNRIVAWDFSLWFALLSPVIGTLLGILGGFLLYHWKETQR*
JGIcombinedJ26739_10097254723300002245Forest SoilETVMIARVVKYDSIAGWNFSLWFALLSPLIGILLGFLGGFLLYH*
JGI25612J43240_108156023300002886Grasslands SoilMTARVVKYHSIAERNFSLWFVLFSPVIGILLGILGAFLLYH*
Ga0062594_10020058223300005093SoilMMKTKGNGITVWDFSLWFAALSPVIGVLLGILGGFLLYN*
Ga0066678_1020133413300005181SoilRRNLRKETVMIARVVKYHSIAEWNFSLWFALHSPLIGILLGFLGGFLLYH*
Ga0066676_1051284913300005186SoilERRRNLRKETVMIAKTKYHSITEWDFSLWFALLSPLIGILLGILGVFLLYH*
Ga0065704_1017712123300005289Switchgrass RhizosphereMIAKTKYHSIAEWNFLLWFALLSPLIGILLGFLGVFLLYH*
Ga0065704_1047713333300005289Switchgrass RhizosphereMIAKTKYHSIAEWDFSLWFALLSPLIGILFDILGGFLLYH*
Ga0065704_1065309013300005289Switchgrass RhizosphereRKETVMIARVVKYHSKMPVRLGPEWNFSLWFALLSPLIGILLGILGVFLLYH*
Ga0065705_1049068723300005294Switchgrass RhizosphereMIARVVKYHSKMPVRLGPEWNFSLWFALLSPLIGILLGILGVFLLYH*
Ga0070675_10181982523300005354Miscanthus RhizosphereMIAQVVKYESIAEWNFSLWFALLSPLIGILLGFLGGFLLYH*
Ga0070671_10062652823300005355Switchgrass RhizosphereMTARVVKYHSIAERNFSLWFVRFSPVIGILLGILGAFLLYH*
Ga0070673_10177894513300005364Switchgrass RhizosphereMIAQVVKYESIAEWNFSLWFALLSPLIGILSGLLGGFLPYH*
Ga0070688_10132031323300005365Switchgrass RhizosphereMMKTKGNGITVWDFSLWFAALSPVIGVLLGILGGFLLYH*
Ga0070667_10014831133300005367Switchgrass RhizosphereMTARVVKYHSIAERNFSLWFVLFSPVIGILLGILGTFLLYH*
Ga0070713_10025633543300005436Corn, Switchgrass And Miscanthus RhizosphereQQRRNPRKETVMIARWNFSLWFALLSPVIGILLGILGVFLFYH*
Ga0070710_1032744623300005437Corn, Switchgrass And Miscanthus RhizosphereMIARVVKYHSIAEWNFSLWFALLSPVIGILLGILGVFLLY
Ga0066682_1075716113300005450SoilAGQQRRRNLRKETVMIARVVKHHSIAEWDFSLWFALLSPLIGILLGILGVFLLYH*
Ga0070681_1198916213300005458Corn RhizosphereRRNPRKETVMIARVVKYYSMAEWHFSLWFALLSPLIGILLGILGVFLLYH*
Ga0070704_10186675023300005549Corn, Switchgrass And Miscanthus RhizosphereMIARVVKYHSIAEWNFSLWFALLSPVIGILLGILGVFLLYH*
Ga0066701_1005042613300005552SoilMKIKWHAFAEWNFSLWFALLSPLIGVLLGILGVFILYH*
Ga0066701_1034239723300005552SoilMIARVVKYHSIANWDFSLWFALLSPLIGILLGFLGGFLLYHSKQTQR*
Ga0066661_1005465723300005554SoilMKARPNSSVAWDFSLWFALLSPVIGTLLGILGVFLLYH*
Ga0066692_1020229243300005555SoilQKETITMKIKWHAFAEWNFSLWFALLSPLIGVLLGILGVFILYH*
Ga0066707_1045737723300005556SoilMIARVVKYHSIAEWTFSLWFALLSPLIGILLGFLGGFLLYH*
Ga0066700_1070237823300005559SoilMTARVVKYHSIAERNFSLWFVLFSPVIGILLGILG
Ga0066694_1031726223300005574SoilMIARVVKYHSIAEWNFSLWFAPLSPLIGILLGFLGGFLLYH*
Ga0068864_10232829413300005618Switchgrass RhizosphereQRRRNLGKETVMTARVVKYHSIAERNFSLWFVLFSPVIGILLGILGVFLLYH*
Ga0070717_1136256423300006028Corn, Switchgrass And Miscanthus RhizosphereMTARIVKYHSIAERNFSLWFVLFSPVIGILLGILGAFLLYH*
Ga0066656_1089695523300006034SoilMIARVVKYHSIAEWNFSLWFALLSPLIGILLGILGGFLLYH*
Ga0066652_10033448923300006046SoilMIARVVKYHSIAEWNFSLWFAPLSPLIGILLGFLGGFLLYR*
Ga0070712_10029828833300006175Corn, Switchgrass And Miscanthus RhizosphereMIARVVKYHSIAEWNFSLWFALLSPLIGILLGFLGGFLLYH*
Ga0070765_10031412413300006176SoilMIARVVKYHSVAEWNFSLWFVLLSPLIGILLGILGGFLLYH*
Ga0079222_1001399133300006755Agricultural SoilMKTKGNDIAVWDFSLWFAALSPVIGVLLGILGGFLLYH*
Ga0073928_1034168713300006893Iron-Sulfur Acid SpringRPAGQERRWSLRKETVMIARVVKYHSIAEWNLSLWFALLSPLIGILLGFLGGFLLYH*
Ga0099791_1051840413300007255Vadose Zone SoilMIAKTKYHTIAEWNFSLWFALLSPLIGILLGILGVFLLYH*
Ga0099795_1016843943300007788Vadose Zone SoilNLGKETVMTARVVKYHSIAERNFSLWFVLFSPVIGILLGILGAFLLYH*
Ga0099829_1137789523300009038Vadose Zone SoilMITMNSKWHDIAEWDFSLWFALLSPVIGILFGILGVFLLYH*
Ga0099828_1178488413300009089Vadose Zone SoilRKNRPAGQQRRRNLGKETGRTARVVKCHSIAERNFSLWFVLFSPVIGILLGILGAFLLYH
Ga0105245_1321243723300009098Miscanthus RhizosphereGKETVMTARVVKYHSIAERNFSLWFVLFSPVIGILLGILGAFLLYH*
Ga0066709_10448329713300009137Grasslands SoilKETVMIAKTKYRTSAEWNFSLWFALLSPLIGILFGILEGFLLYH*
Ga0099792_1076132313300009143Vadose Zone SoilPAGEQQRRNIEKETVMIAKTKYHTIAKWNFSLWFALLSPLIGILLGILGVFLLYH*
Ga0099796_1051874123300010159Vadose Zone SoilMIAKTKYHTIAEWNFSLWFALLSPLIGILLGILGVF
Ga0134088_1055470613300010304Grasslands SoilRNLRKETVMIARVVKYHSIAEWNFSFWFALLSPLIGILLGFLGGFLLYH*
Ga0134126_1216002913300010396Terrestrial SoilMTARVVKYHTIAERNFSLWFVLFSPVIGVLLGILGAFLLYH*
Ga0126348_127228613300010862Boreal Forest SoilMTARVVKCHSIAEWNFSLWFALLSPLIGIVLGFLGGFLLYH*
Ga0137392_1032847843300011269Vadose Zone SoilMTARVVKYHSIAERNVSLWFVLFSPVIGILLGILGAFLLYH*
Ga0137393_1100585513300011271Vadose Zone SoilVMTARVVKYHSIAERNVSLWFVLFSPVIGILLGILGAFLLYH*
Ga0153990_111857023300012169Attine Ant Fungus GardensMKTKFESVAEWDFSLWFALLSPVIGTLLGILGVFLLYN*
Ga0137388_1034962243300012189Vadose Zone SoilKNRPAGQQRRRNLGKETVMTARVVKYHSIAERNVSLWFVLFSPVIGILLGILGAFLLYH*
Ga0137364_1016167613300012198Vadose Zone SoilNRPAGQQRRRNLGKETVMTARVVKYHSIAERNFSLWFVLFSPVIGILLGILGAFLLYH*
Ga0137382_1013209613300012200Vadose Zone SoilRRRNLGKETVMTARVVKYHSIAERNFSLWFVLFSPVIGILLGILGAFLLYH*
Ga0137363_1118812223300012202Vadose Zone SoilMIAKTKYHSIAEWDFSLWFALLSPLIGILFGILGGFLLCH*
Ga0137399_1173117413300012203Vadose Zone SoilMIAKTKYHAIVESNFSLWFALLSPLIGTLLGILGEFLLYH*
Ga0137372_1122226113300012350Vadose Zone SoilRNLRKETVMIARVVKYHSIAEWNFSLWFALLTPLIGISFSILGGFLLYH*
Ga0137390_1057956923300012363Vadose Zone SoilMIARVVKYHSIAEWNFSLWFALLSPVIGILLGFLGVFLLYH*
Ga0137397_1061399723300012685Vadose Zone SoilMIARVVKYHTIAESNFSLWFALLSPLIGILLGILGVFLLYH*
Ga0157302_1008389523300012915SoilMIARVVKYHSIAEWNFSLWFALLSPLIGILFGMLKVFLFYH*
Ga0137394_1021179623300012922Vadose Zone SoilMIARVVKYHSIAESNFSLWFALLSPLIGILLGILGVFLLYH*
Ga0137359_1124938423300012923Vadose Zone SoilMTARVVKYHSIAERNFSLWFVLFSPVIGILLGFLGAFLLYH*
Ga0137416_1039687023300012927Vadose Zone SoilMIARVVKYHSIAEWTFSLWFALLSPLIGILLGFIESKTSQ*
Ga0137404_1096467913300012929Vadose Zone SoilAGQQRRRDVRRETVMIAKTKYHTIAERNFSLWFALLSPLIGILLGFLGGFLLYH*
Ga0137404_1154438723300012929Vadose Zone SoilYHSIDEWNFSLWFALLSPLIGILLGFLGGFLLYH*
Ga0164300_1011778733300012951SoilMTARVVKYHSIAERNFSLWFVLFSPVIGILLGILGAFLLYQ*
Ga0164301_1079642223300012960SoilMTARVVKYRSIAERNFSLWFVLFSSVIGILLGILGAFLLYH*
Ga0164302_1062210913300012961SoilTAVIARVVKYHSIAEWNFTLWFALLSPLIGILLGILGVFLLYH*
Ga0164306_1042971513300012988SoilRKNRPAGQQRRRNLGKETVMTARVVKYRSIAERNFSLWFVLFSPVIGILLGILGAFLLYH
Ga0157374_1026657523300013296Miscanthus RhizosphereMIAQVVKYESIAEWNFSLWFVRFSPVIGILLGILGAFLLYH*
Ga0157374_1117300713300013296Miscanthus RhizosphereRETVMIAQVVKYESIAEWNFSLWFALLSPLIGILSGLLGGFLPYH*
Ga0157374_1125096033300013296Miscanthus RhizosphereYYSMAEWDFSLWFALLSPLIGILLGILGVFLLCH*
Ga0157378_1009840623300013297Miscanthus RhizosphereMTGRVVKYHSIAERNFSLWFVLFSPVIGILLGILGAFLLYH*
Ga0163162_1305633213300013306Switchgrass RhizosphereQERSRNLRKETVMIAKTKYHSIAEWDFSLWFALLSPLIGILFGILGGFLLYH*
Ga0137411_104957023300015052Vadose Zone SoilMIAKTKYHTLAEWNFSLWFALLSPLIGILLGILGVFLLYH*
Ga0173483_1064641313300015077SoilKETVMIARVVKYHSIANWDFSLWFALLSPLIGILLGFLGGFLLYH*
Ga0137412_1015479343300015242Vadose Zone SoilMTAKTKYHTIAEWNFSLWFALLSPLIGILLGILGVFLLYH*
Ga0137412_1123960713300015242Vadose Zone SoilTVMIAKTKYHSIAEWDFSLWFALLSPLIGILFGILGGFLLCH*
Ga0132258_1292928223300015371Arabidopsis RhizosphereMIAKTKYHSIAEWDFSLWFALLSPLIGILFGILGGFLLYH*
Ga0134083_1047188213300017659Grasslands SoilQRRRNLRKETVMIARVVKYHSIAEWNFSLWFALLSPLIGILLGFLGGFLLYR
Ga0184605_1018973623300018027Groundwater SedimentMTARVVKYHSIAERNFSLWFVLFSPVIGILLGILGAFLLYH
Ga0184605_1051026523300018027Groundwater SedimentMIARVVKYHSIAEWNFSLWFALLSPVIGILLGFLGGFLLYH
Ga0066655_1095586023300018431Grasslands SoilMIARIVKYHSIAEWNFSLGFALLSPLIGILLGFLGGFLLYH
Ga0066667_1002715053300018433Grasslands SoilMKARPNSSVAWDFSLWFALLSPVIGTLLGILGVFLLYH
Ga0137408_100075723300019789Vadose Zone SoilMTARVVKYHSIAERNFSLWFVLLSPVIGILLGILGAFLLYH
Ga0193723_103906523300019879SoilMIAKTKYHTIAEWNFSLWFALLSPLIGILLGILGVFLLYH
Ga0193713_109473423300019882SoilMIARVVKYHSIAQWNFSLWFALLSPLIGILLGILGEFLLYH
Ga0193725_106368313300019883SoilNETVMTARVVKYHSIAERNFSLWFVLFSPVIGILLGILGAFLLYH
Ga0193729_106039133300019887SoilMIARVVKYHSIAEWNLSLWFALLSPLIGVLLGILGGFLLYH
Ga0193726_103303833300020021SoilMIAKIKYHTIAEWDFSLSFALLSPLIGILLGFLGAFLLSH
Ga0210399_1061036323300020581SoilMIAKTKYHTIAKSNFSLWFALLSPLIGILLGILGEFLLYH
Ga0215015_1038210023300021046SoilMKIKLHTVAEWDFSLWFALLSPLIGVLLGVLGVFILYR
Ga0210381_1016065913300021078Groundwater SedimentMIARVVKYHSIAEWNFSLWFALLSPVIGILLGFLGGFLL
Ga0179596_1067780213300021086Vadose Zone SoilRNIEKETVMIAKTKYHTIAEWNFSLWFALLSPLIGILLGILGVFLLYH
Ga0222622_1029657443300022756Groundwater SedimentMTARVVKYHSIAERNFSLWFVLFGPVIGILLGILGAFLLYH
Ga0179589_1044688113300024288Vadose Zone SoilMKTKCHDIAEWDFSLWFALLSPLIGAALGLFGVSFL
Ga0207699_1047136723300025906Corn, Switchgrass And Miscanthus RhizosphereMTARVVKYHSIAERNFSLWFVRFSPVIGILLGILGAFLLYH
Ga0207665_1030746523300025939Corn, Switchgrass And Miscanthus RhizosphereMTARIVKYHSIAERNFSLWFVLFSPVIGILLGILGAFLLYH
Ga0207677_1200976613300026023Miscanthus RhizosphereTEPSKETVMIAQVVRYESIAEWNFSLWFALLSPLIGILSGLLGGFLPYH
Ga0257170_102784023300026351SoilMIARVVKYHSIAERNFSLWFVLFSPVIGILLGILGAFLLYH
Ga0257180_101399943300026354SoilMTARVVKYHSIAERNVSLWFVLFSPVIGILLGILGAFLLYH
Ga0257158_104292723300026515SoilMIARVVKHHSIAERNFSLWFVLFSPVIGILLGILGAFLLYH
Ga0179587_1054059023300026557Vadose Zone SoilMIAKTKYHSIAEWDFSLWFALLSPLIGILFGILGGFLLCH
Ga0179587_1089095423300026557Vadose Zone SoilMIARVVKYHSIAEWNLSLWFALLSPLIGILLGILGGFLLYH
Ga0209419_100115713300027537Forest SoilMIARVVKYHSIAEWNFSLWFALLSPLIGILLGFLGGFLLYH
Ga0209419_100501543300027537Forest SoilRPHSRKNRPSGQERRRNLRKETVMMTQWNFSLWFALLSPVIGILLGILGVFLLYH
Ga0209625_100642813300027635Forest SoilMIARVVKHHSIAEWNFSLWFALLSPVIGISLGFLGAFVLYH
Ga0209328_1000150423300027727Forest SoilMKARPNRIVAWDFSLWFALLSPVIGTLLGILGGFLLYHWKETQR
Ga0209074_1032903823300027787Agricultural SoilMKTKGNDIAVWDFSLWFAALSPVIGVLLGILGGFLLYH
Ga0268266_1029069743300028379Switchgrass RhizosphereMMKTKGNGITVWDFSLWFAALSPVIGVLLGILGGFLLYN
Ga0257175_100293443300028673SoilMIARVVKYHSIANWDFSLWFALLSPLIGILLGFLGGFLLYH
Ga0138296_111789723300030923SoilMKTKHHSIIEWDFSFWFALLSPVIGILLGILGGFLLYH
Ga0170823_1769315923300031128Forest SoilMKTKHYSIIEWDFSLWFALLSPVIGILLGILGIFLLYQ
Ga0170824_12087118623300031231Forest SoilMTARVVKYHTIAERNFSLRFVLFSPVIGILLGILGAFLLYH
Ga0307475_1136956723300031754Hardwood Forest SoilMKTKHHSIIEWDFSLWFALLSPVIGILLGILGVFLLYH
Ga0307473_1116641323300031820Hardwood Forest SoilMIARVVKYHSIAERNFSLWFVLFSPVIGILLGILGAFLLYQ
Ga0307479_1168417323300031962Hardwood Forest SoilMIARVVKYHSIAEWNFPLWFALLSLLIGILLGFLGGFLLYH
Ga0307470_1011477043300032174Hardwood Forest SoilMTARVVKYHSIAERNFSLWFVLFSPVIGILLGILGAFLLYQ

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.