NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metatranscriptome Family F078175

Metatranscriptome Family F078175

Go to section:
Overview Alignments Structure & Topology Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F078175
Family Type Metatranscriptome
Number of Sequences 116
Average Sequence Length 123 residues
Representative Sequence FTLTLFKNTLKSNNMPLAKEVTKGVFDPRTYREDDPVNWARKRKPDWMATTGKIHFTRERTVDKELEEENGSKEPSPTPEQVPEKEVVKMPPTEIPIMTNMERKQTNDYWPRKMRSDITRSRVI
Number of Associated Samples 102
Number of Associated Scaffolds 116

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Eukaryota
% of genes with valid RBS motifs 2.59 %
% of genes near scaffold ends (potentially truncated) 78.45 %
% of genes from short scaffolds (< 2000 bps) 100.00 %
Associated GOLD sequencing projects 81
AlphaFold2 3D model prediction No

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Eukaryota (100.000 % of family members)
NCBI Taxonomy ID 2759
Taxonomy All Organisms → cellular organisms → Eukaryota

Most Common Ecosystem
GOLD Ecosystem Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine
(89.655 % of family members)
Environment Ontology (ENVO) Unclassified
(97.414 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Saline → Water (saline)
(96.552 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 12.10%    β-sheet: 4.03%    Coil/Unstructured: 83.87%
Feature Viewer
Powered by Feature Viewer

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms100.00 %
UnclassifiedrootN/A0.00 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300009006|Ga0103710_10209009All Organisms → cellular organisms → Eukaryota540Open in IMG/M
3300009022|Ga0103706_10181864All Organisms → cellular organisms → Eukaryota539Open in IMG/M
3300009025|Ga0103707_10149884All Organisms → cellular organisms → Eukaryota549Open in IMG/M
3300009263|Ga0103872_1034700All Organisms → cellular organisms → Eukaryota689Open in IMG/M
3300009269|Ga0103876_1022113All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda → Gymnoplea → Calanoida → Temoridae → Eurytemora → Eurytemora affinis771Open in IMG/M
3300009269|Ga0103876_1043566All Organisms → cellular organisms → Eukaryota623Open in IMG/M
3300009738|Ga0123379_1043468All Organisms → cellular organisms → Eukaryota524Open in IMG/M
3300009750|Ga0123368_1125210All Organisms → cellular organisms → Eukaryota515Open in IMG/M
3300018513|Ga0193227_103574All Organisms → cellular organisms → Eukaryota668Open in IMG/M
3300018518|Ga0193462_108101All Organisms → cellular organisms → Eukaryota515Open in IMG/M
3300018525|Ga0193230_108913All Organisms → cellular organisms → Eukaryota646Open in IMG/M
3300018566|Ga0193331_1006442All Organisms → cellular organisms → Eukaryota570Open in IMG/M
3300018576|Ga0193373_1013467All Organisms → cellular organisms → Eukaryota543Open in IMG/M
3300018576|Ga0193373_1015497All Organisms → cellular organisms → Eukaryota504Open in IMG/M
3300018578|Ga0193389_1011941All Organisms → cellular organisms → Eukaryota558Open in IMG/M
3300018581|Ga0193079_1011063All Organisms → cellular organisms → Eukaryota572Open in IMG/M
3300018582|Ga0193454_1014709All Organisms → cellular organisms → Eukaryota576Open in IMG/M
3300018583|Ga0193223_1010436All Organisms → cellular organisms → Eukaryota647Open in IMG/M
3300018594|Ga0193292_1015805All Organisms → cellular organisms → Eukaryota556Open in IMG/M
3300018602|Ga0193182_1016838All Organisms → cellular organisms → Eukaryota661Open in IMG/M
3300018604|Ga0193447_1021615All Organisms → cellular organisms → Eukaryota583Open in IMG/M
3300018605|Ga0193339_1020907All Organisms → cellular organisms → Eukaryota635Open in IMG/M
3300018616|Ga0193064_1028120All Organisms → cellular organisms → Eukaryota522Open in IMG/M
3300018618|Ga0193204_1017644All Organisms → cellular organisms → Eukaryota551Open in IMG/M
3300018643|Ga0193431_1023429All Organisms → cellular organisms → Eukaryota651Open in IMG/M
3300018651|Ga0192937_1039193All Organisms → cellular organisms → Eukaryota551Open in IMG/M
3300018657|Ga0192889_1060264All Organisms → cellular organisms → Eukaryota509Open in IMG/M
3300018659|Ga0193067_1051199All Organisms → cellular organisms → Eukaryota608Open in IMG/M
3300018663|Ga0192999_1025894All Organisms → cellular organisms → Eukaryota684Open in IMG/M
3300018663|Ga0192999_1025895All Organisms → cellular organisms → Eukaryota684Open in IMG/M
3300018664|Ga0193401_1042511All Organisms → cellular organisms → Eukaryota585Open in IMG/M
3300018668|Ga0193013_1041868All Organisms → cellular organisms → Eukaryota635Open in IMG/M
3300018669|Ga0193108_111210All Organisms → cellular organisms → Eukaryota675Open in IMG/M
3300018673|Ga0193229_1021480All Organisms → cellular organisms → Eukaryota703Open in IMG/M
3300018673|Ga0193229_1024639All Organisms → cellular organisms → Eukaryota671Open in IMG/M
3300018677|Ga0193404_1046961All Organisms → cellular organisms → Eukaryota582Open in IMG/M
3300018679|Ga0193390_1057333All Organisms → cellular organisms → Eukaryota670Open in IMG/M
3300018685|Ga0193086_1040142All Organisms → cellular organisms → Eukaryota736Open in IMG/M
3300018690|Ga0192917_1056611All Organisms → cellular organisms → Eukaryota583Open in IMG/M
3300018697|Ga0193319_1069265All Organisms → cellular organisms → Eukaryota515Open in IMG/M
3300018699|Ga0193195_1027825All Organisms → cellular organisms → Eukaryota656Open in IMG/M
3300018700|Ga0193403_1053207All Organisms → cellular organisms → Eukaryota592Open in IMG/M
3300018709|Ga0193209_1023275All Organisms → cellular organisms → Eukaryota906Open in IMG/M
3300018716|Ga0193324_1053364All Organisms → cellular organisms → Eukaryota502Open in IMG/M
3300018723|Ga0193038_1039189All Organisms → cellular organisms → Eukaryota730Open in IMG/M
3300018728|Ga0193333_1060479All Organisms → cellular organisms → Eukaryota591Open in IMG/M
3300018729|Ga0193174_1079878All Organisms → cellular organisms → Eukaryota569Open in IMG/M
3300018738|Ga0193495_1049515All Organisms → cellular organisms → Eukaryota558Open in IMG/M
3300018740|Ga0193387_1066328All Organisms → cellular organisms → Eukaryota509Open in IMG/M
3300018743|Ga0193425_1038914All Organisms → cellular organisms → Eukaryota660Open in IMG/M
3300018750|Ga0193097_1081681All Organisms → cellular organisms → Eukaryota694Open in IMG/M
3300018752|Ga0192902_1077631All Organisms → cellular organisms → Eukaryota589Open in IMG/M
3300018764|Ga0192924_1039464All Organisms → cellular organisms → Eukaryota580Open in IMG/M
3300018771|Ga0193314_1082771All Organisms → cellular organisms → Eukaryota521Open in IMG/M
3300018777|Ga0192839_1059436All Organisms → cellular organisms → Eukaryota595Open in IMG/M
3300018784|Ga0193298_1074487All Organisms → cellular organisms → Eukaryota626Open in IMG/M
3300018785|Ga0193095_1082198All Organisms → cellular organisms → Eukaryota590Open in IMG/M
3300018785|Ga0193095_1094823All Organisms → cellular organisms → Eukaryota530Open in IMG/M
3300018794|Ga0193357_1067894All Organisms → cellular organisms → Eukaryota589Open in IMG/M
3300018801|Ga0192824_1090044All Organisms → cellular organisms → Eukaryota584Open in IMG/M
3300018811|Ga0193183_1034133All Organisms → cellular organisms → Eukaryota869Open in IMG/M
3300018819|Ga0193497_1087901All Organisms → cellular organisms → Eukaryota562Open in IMG/M
3300018820|Ga0193172_1078327All Organisms → cellular organisms → Eukaryota557Open in IMG/M
3300018823|Ga0193053_1066313All Organisms → cellular organisms → Eukaryota577Open in IMG/M
3300018835|Ga0193226_1114244All Organisms → cellular organisms → Eukaryota592Open in IMG/M
3300018840|Ga0193200_1206141All Organisms → cellular organisms → Eukaryota646Open in IMG/M
3300018849|Ga0193005_1061426All Organisms → cellular organisms → Eukaryota584Open in IMG/M
3300018854|Ga0193214_1090533All Organisms → cellular organisms → Eukaryota559Open in IMG/M
3300018854|Ga0193214_1104107All Organisms → cellular organisms → Eukaryota510Open in IMG/M
3300018859|Ga0193199_1088199All Organisms → cellular organisms → Eukaryota669Open in IMG/M
3300018867|Ga0192859_1072646All Organisms → cellular organisms → Eukaryota567Open in IMG/M
3300018924|Ga0193096_10182464All Organisms → cellular organisms → Eukaryota696Open in IMG/M
3300018925|Ga0193318_10185332All Organisms → cellular organisms → Eukaryota564Open in IMG/M
3300018944|Ga0193402_10177928All Organisms → cellular organisms → Eukaryota564Open in IMG/M
3300018947|Ga0193066_10132444All Organisms → cellular organisms → Eukaryota728Open in IMG/M
3300018947|Ga0193066_10143988All Organisms → cellular organisms → Eukaryota695Open in IMG/M
3300018958|Ga0193560_10211381All Organisms → cellular organisms → Eukaryota599Open in IMG/M
3300018963|Ga0193332_10267661All Organisms → cellular organisms → Eukaryota514Open in IMG/M
3300018964|Ga0193087_10159005All Organisms → cellular organisms → Eukaryota731Open in IMG/M
3300018966|Ga0193293_10056419All Organisms → cellular organisms → Eukaryota685Open in IMG/M
3300018972|Ga0193326_10064441All Organisms → cellular organisms → Eukaryota593Open in IMG/M
3300018985|Ga0193136_10180813All Organisms → cellular organisms → Eukaryota629Open in IMG/M
3300018985|Ga0193136_10203071All Organisms → cellular organisms → Eukaryota591Open in IMG/M
3300018987|Ga0193188_10070566All Organisms → cellular organisms → Eukaryota580Open in IMG/M
3300018995|Ga0193430_10118984All Organisms → cellular organisms → Eukaryota634Open in IMG/M
3300018996|Ga0192916_10192131All Organisms → cellular organisms → Eukaryota597Open in IMG/M
3300018998|Ga0193444_10135238All Organisms → cellular organisms → Eukaryota653Open in IMG/M
3300018998|Ga0193444_10137952All Organisms → cellular organisms → Eukaryota646Open in IMG/M
3300018999|Ga0193514_10212095All Organisms → cellular organisms → Eukaryota692Open in IMG/M
3300019004|Ga0193078_10103591All Organisms → cellular organisms → Eukaryota663Open in IMG/M
3300019004|Ga0193078_10105476All Organisms → cellular organisms → Eukaryota659Open in IMG/M
3300019004|Ga0193078_10220063All Organisms → cellular organisms → Eukaryota506Open in IMG/M
3300019008|Ga0193361_10264656All Organisms → cellular organisms → Eukaryota607Open in IMG/M
3300019008|Ga0193361_10276338All Organisms → cellular organisms → Eukaryota588Open in IMG/M
3300019010|Ga0193044_10231894All Organisms → cellular organisms → Eukaryota575Open in IMG/M
3300019016|Ga0193094_10204852All Organisms → cellular organisms → Eukaryota679Open in IMG/M
3300019019|Ga0193555_10207329All Organisms → cellular organisms → Eukaryota655Open in IMG/M
3300019038|Ga0193558_10295001All Organisms → cellular organisms → Eukaryota609Open in IMG/M
3300019043|Ga0192998_10145043All Organisms → cellular organisms → Eukaryota669Open in IMG/M
3300019051|Ga0192826_10166496All Organisms → cellular organisms → Eukaryota813Open in IMG/M
3300019052|Ga0193455_10379852All Organisms → cellular organisms → Eukaryota584Open in IMG/M
3300019055|Ga0193208_10514226All Organisms → cellular organisms → Eukaryota627Open in IMG/M
3300019067|Ga0193459_103069All Organisms → cellular organisms → Eukaryota586Open in IMG/M
3300019129|Ga0193436_1049146All Organisms → cellular organisms → Eukaryota658Open in IMG/M
3300019130|Ga0193499_1071708All Organisms → cellular organisms → Eukaryota711Open in IMG/M
3300019130|Ga0193499_1081833All Organisms → cellular organisms → Eukaryota659Open in IMG/M
3300019134|Ga0193515_1072450All Organisms → cellular organisms → Eukaryota601Open in IMG/M
3300019138|Ga0193216_10101023All Organisms → cellular organisms → Eukaryota662Open in IMG/M
3300019138|Ga0193216_10117171All Organisms → cellular organisms → Eukaryota607Open in IMG/M
3300019147|Ga0193453_1116274All Organisms → cellular organisms → Eukaryota711Open in IMG/M
3300019151|Ga0192888_10230878All Organisms → cellular organisms → Eukaryota544Open in IMG/M
3300019152|Ga0193564_10253758All Organisms → cellular organisms → Eukaryota508Open in IMG/M
3300030749|Ga0073969_11430405All Organisms → cellular organisms → Eukaryota598Open in IMG/M
3300031038|Ga0073986_12043212All Organisms → cellular organisms → Eukaryota634Open in IMG/M
3300031056|Ga0138346_10674564All Organisms → cellular organisms → Eukaryota503Open in IMG/M
3300031121|Ga0138345_10552528All Organisms → cellular organisms → Eukaryota607Open in IMG/M


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
MarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Marine89.66%
MarineEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Marine5.17%
Surface Ocean WaterEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Surface Ocean Water2.59%
Ocean WaterEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Ocean Water2.59%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300009006Eukaryotic communities from seawater of the North Pacific Subtropical Gyre - HoeDylan_E2EnvironmentalOpen in IMG/M
3300009022Eukaryotic communities from seawater of the North Pacific Subtropical Gyre - HoeDylan_S1EnvironmentalOpen in IMG/M
3300009025Eukaryotic communities from seawater of the North Pacific Subtropical Gyre - HoeDylan_S2EnvironmentalOpen in IMG/M
3300009263Eukaryotic communities of water from the North Atlantic ocean - ACM27EnvironmentalOpen in IMG/M
3300009269Eukaryotic communities of water from the North Atlantic ocean - ACM28EnvironmentalOpen in IMG/M
3300009738Marine microbial and viral communities from Louisana Shelf, Gulf of Mexico - GoM_2015_C6C_244_2m (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300009750Marine microbial and viral communities from Louisana Shelf, Gulf of Mexico - GoM_2015_C6C_206_18m (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300018513Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_047 - TARA_N000000284 (ERX1782447-ERR1712145)EnvironmentalOpen in IMG/M
3300018518Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_132 - TARA_N000002416 (ERX1782323-ERR1711987)EnvironmentalOpen in IMG/M
3300018525Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_051 - TARA_N000000189 (ERX1782203-ERR1712234)EnvironmentalOpen in IMG/M
3300018566Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_109 - TARA_N000001742 (ERX1789486-ERR1719286)EnvironmentalOpen in IMG/M
3300018576Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_122 - TARA_N000001942 (ERX1782464-ERR1711929)EnvironmentalOpen in IMG/M
3300018578Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_123 - TARA_N000001998 (ERX1782118-ERR1711914)EnvironmentalOpen in IMG/M
3300018581Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_051 - TARA_N000000225 (ERX1782098-ERR1712053)EnvironmentalOpen in IMG/M
3300018582Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_132 - TARA_N000002402 (ERX1789727-ERR1719292)EnvironmentalOpen in IMG/M
3300018583Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_046 - TARA_N000000270 (ERX1782454-ERR1711980)EnvironmentalOpen in IMG/M
3300018594Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_100 - TARA_N000001614 (ERX1809463-ERR1739849)EnvironmentalOpen in IMG/M
3300018602Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_036 - TARA_N000000319 (ERX1782193-ERR1711945)EnvironmentalOpen in IMG/M
3300018604Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_131 - TARA_N000002362 (ERX1782200-ERR1712077)EnvironmentalOpen in IMG/M
3300018605Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_110 - TARA_N000001754 (ERX1782444-ERR1712177)EnvironmentalOpen in IMG/M
3300018616Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_138 - TARA_N000003003 (ERX1782367-ERR1711877)EnvironmentalOpen in IMG/M
3300018618Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_041 - TARA_N000000071 (ERX1782354-ERR1712005)EnvironmentalOpen in IMG/M
3300018643Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_128 - TARA_N000002299 (ERX1782462-ERR1712152)EnvironmentalOpen in IMG/M
3300018651Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_078 - TARA_N000001512 (ERX1782264-ERR1711863)EnvironmentalOpen in IMG/M
3300018657Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_068 - TARA_N000000705 (ERX1789382-ERR1719418)EnvironmentalOpen in IMG/M
3300018659Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_142 - TARA_N000003102 (ERX1782249-ERR1712111)EnvironmentalOpen in IMG/M
3300018663Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_109 - TARA_N000001784 (ERX1782465-ERR1712058)EnvironmentalOpen in IMG/M
3300018664Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_124 - TARA_N000002043 (ERX1789700-ERR1719381)EnvironmentalOpen in IMG/M
3300018668Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_135 - TARA_N000002464 (ERX1782441-ERR1712149)EnvironmentalOpen in IMG/M
3300018669Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_139 - TARA_N000003043 (ERX1789562-ERR1719304)EnvironmentalOpen in IMG/M
3300018673Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_048 - TARA_N000000115 (ERX1782433-ERR1712189)EnvironmentalOpen in IMG/M
3300018677Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_124 - TARA_N000002043 (ERX1789362-ERR1719365)EnvironmentalOpen in IMG/M
3300018679Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_123 - TARA_N000001998 (ERX1782283-ERR1711917)EnvironmentalOpen in IMG/M
3300018685Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_065 - TARA_N000000939 (ERX1782360-ERR1712233)EnvironmentalOpen in IMG/M
3300018690Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_072 - TARA_N000000839 (ERX1782228-ERR1712109)EnvironmentalOpen in IMG/M
3300018697Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_102 - TARA_N000001662 (ERX1789701-ERR1719308)EnvironmentalOpen in IMG/M
3300018699Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_039 - TARA_N000000008 (ERX1782338-ERR1712211)EnvironmentalOpen in IMG/M
3300018700Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_124 - TARA_N000002043 (ERX1789597-ERR1719175)EnvironmentalOpen in IMG/M
3300018709Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_041 - TARA_N000000073 (ERX1782278-ERR1712213)EnvironmentalOpen in IMG/M
3300018716Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_109 - TARA_N000001728 (ERX1789726-ERR1719299)EnvironmentalOpen in IMG/M
3300018723Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_046 - TARA_N000000268 (ERX1782137-ERR1712170)EnvironmentalOpen in IMG/M
3300018728Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_109 - TARA_N000001796 (ERX1789465-ERR1719147)EnvironmentalOpen in IMG/M
3300018729Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_036 - TARA_N000000313 (ERX1789694-ERR1719374)EnvironmentalOpen in IMG/M
3300018738Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_137 - TARA_N000002938 (ERX1789371-ERR1719226)EnvironmentalOpen in IMG/M
3300018740Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_123 - TARA_N000001996 (ERX1789647-ERR1719307)EnvironmentalOpen in IMG/M
3300018743Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_128 - TARA_N000002293 (ERX1782423-ERR1712174)EnvironmentalOpen in IMG/M
3300018750Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_038 - TARA_N000000046 (ERX1789696-ERR1719423)EnvironmentalOpen in IMG/M
3300018752Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_070 - TARA_N000000662 (ERX1789652-ERR1719340)EnvironmentalOpen in IMG/M
3300018764Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_076 - TARA_N000000868 (ERX1782470-ERR1712186)EnvironmentalOpen in IMG/M
3300018771Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_102 - TARA_N000001658 (ERX1789535-ERR1719438)EnvironmentalOpen in IMG/M
3300018777Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_052 - TARA_N000000589 (ERX1789605-ERR1719349)EnvironmentalOpen in IMG/M
3300018784Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_100 - TARA_N000001620 (ERX1789528-ERR1719403)EnvironmentalOpen in IMG/M
3300018785Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_038 - TARA_N000000045 (ERX1789545-ERR1719351)EnvironmentalOpen in IMG/M
3300018794Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_111 - TARA_N000001823 (ERX1782102-ERR1711992)EnvironmentalOpen in IMG/M
3300018801Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_040 - TARA_N000000063 (ERX1789476-ERR1719434)EnvironmentalOpen in IMG/M
3300018811Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_036 - TARA_N000000319 (ERX1782290-ERR1712064)EnvironmentalOpen in IMG/M
3300018819Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_137 - TARA_N000002940 (ERX1789719-ERR1719288)EnvironmentalOpen in IMG/M
3300018820Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_036 - TARA_N000000312 (ERX1789518-ERR1719511)EnvironmentalOpen in IMG/M
3300018823Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_128 - TARA_N000002285 (ERX1789533-ERR1719243)EnvironmentalOpen in IMG/M
3300018835Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_047 - TARA_N000000284 (ERX1782152-ERR1712198)EnvironmentalOpen in IMG/M
3300018840Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_039 - TARA_N000000013 (ERX1782199-ERR1712136)EnvironmentalOpen in IMG/M
3300018849Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_128 - TARA_N000002287 (ERX1789411-ERR1719439)EnvironmentalOpen in IMG/M
3300018854Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_041 - TARA_N000000076 (ERX1789602-ERR1719346)EnvironmentalOpen in IMG/M
3300018859Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_039 - TARA_N000000012 (ERX1789645-ERR1719429)EnvironmentalOpen in IMG/M
3300018867Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_065 - TARA_N000000968 (ERX1789681-ERR1719251)EnvironmentalOpen in IMG/M
3300018924Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_038 - TARA_N000000046 (ERX1789468-ERR1719259)EnvironmentalOpen in IMG/M
3300018925Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_102 - TARA_N000001662 (ERX1789484-ERR1719312)EnvironmentalOpen in IMG/M
3300018944Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_124 - TARA_N000002043 (ERX1789675-ERR1719391)EnvironmentalOpen in IMG/M
3300018947Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_142 - TARA_N000003102 (ERX1782406-ERR1712029)EnvironmentalOpen in IMG/M
3300018958Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_144 - TARA_N000003191EnvironmentalOpen in IMG/M
3300018963Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_109 - TARA_N000001796 (ERX1789664-ERR1719481)EnvironmentalOpen in IMG/M
3300018964Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_065 - TARA_N000000939 (ERX1782328-ERR1712130)EnvironmentalOpen in IMG/M
3300018966Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_100 - TARA_N000001614 (ERX1809469-ERR1739845)EnvironmentalOpen in IMG/M
3300018972Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_109 - TARA_N000001734 (ERX1789632-ERR1719168)EnvironmentalOpen in IMG/M
3300018985Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_020 - TARA_A100000761 (ERX1782416-ERR1711874)EnvironmentalOpen in IMG/M
3300018987Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_038 - TARA_N000000041 (ERX1789590-ERR1719255)EnvironmentalOpen in IMG/M
3300018995Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_128 - TARA_N000002299 (ERX1782426-ERR1711902)EnvironmentalOpen in IMG/M
3300018996Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_072 - TARA_N000000839 (ERX1782178-ERR1712156)EnvironmentalOpen in IMG/M
3300018998Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_131 - TARA_N000002360 (ERX1782428-ERR1712117)EnvironmentalOpen in IMG/M
3300018999Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_142 - TARA_N000003100 (ERX1782275-ERR1712038)EnvironmentalOpen in IMG/M
3300019004Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_051 - TARA_N000000225 (ERX1782445-ERR1712173)EnvironmentalOpen in IMG/M
3300019008Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_111 - TARA_N000001826 (ERX1789684-ERR1719447)EnvironmentalOpen in IMG/M
3300019010Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_081 - TARA_N000001428 (ERX1809462-ERR1739838)EnvironmentalOpen in IMG/M
3300019016Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_038 - TARA_N000000045 (ERX1789509-ERR1719322)EnvironmentalOpen in IMG/M
3300019019Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_137 - TARA_N000002929EnvironmentalOpen in IMG/M
3300019038Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_143 - TARA_N000003141EnvironmentalOpen in IMG/M
3300019043Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_109 - TARA_N000001784 (ERX1782103-ERR1712098)EnvironmentalOpen in IMG/M
3300019051Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_040 - TARA_N000000064 (ERX1782232-ERR1712227)EnvironmentalOpen in IMG/M
3300019052Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_132 - TARA_N000002402 (ERX1789503-ERR1719228)EnvironmentalOpen in IMG/M
3300019055Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_041 - TARA_N000000073 (ERX1782414-ERR1711963)EnvironmentalOpen in IMG/M
3300019067Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_132 - TARA_N000002412 (ERX1782229-ERR1712040)EnvironmentalOpen in IMG/M
3300019129Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_131 - TARA_N000002352 (ERX1782251-ERR1711975)EnvironmentalOpen in IMG/M
3300019130Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_137 - TARA_N000002942 (ERX1782241-ERR1712112)EnvironmentalOpen in IMG/M
3300019134Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_142 - TARA_N000003100 (ERX1782286-ERR1712165)EnvironmentalOpen in IMG/M
3300019138Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_041 - TARA_N000000077 (ERX1782429-ERR1712131)EnvironmentalOpen in IMG/M
3300019147Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_132 - TARA_N000002400 (ERX1782434-ERR1711973)EnvironmentalOpen in IMG/M
3300019151Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_068 - TARA_N000000705 (ERX1789682-ERR1719501)EnvironmentalOpen in IMG/M
3300019152Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_150 - TARA_N000002717EnvironmentalOpen in IMG/M
3300030749Seawater microbial communities from Saanich Inlet, British Columbia, Canada - DeepDOM_E6_V_5 metaT (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031038Seawater microbial communities from Saanich Inlet, British Columbia, Canada - DeepDOM_S14_0.2 metaT (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031056Marine microbial communities from the Southern Atlantic ocean transect - DeepDOM_S12_Trap_metaT (Eukaryote Community Metatranscriptome) (version 2)EnvironmentalOpen in IMG/M
3300031121Marine microbial communities from the Southern Atlantic ocean transect - DeepDOM_S15_Trap_metaT (Eukaryote Community Metatranscriptome) (version 2)EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
Ga0103710_1020900913300009006Ocean WaterMVLTKEVTKGEFDPRTYREADPANWARKRRSDWLAVPGKIVFTRERTVDRELEEEKKPEPEPNPEREVVKVPPVEIPIQTNVGRKPSMELAWPRKMRSDITRTRVI*
Ga0103706_1018186413300009022Ocean WaterMVLTKEVTKGEFDPRTYREADPANWARKRRSDWLAVPGKIVFTRERTVDRELEEEKKPEPEPSPEREVVKVPPVEIPIQTNVGRKPSMELAWPRKMRSDITRTRVI*
Ga0103707_1014988413300009025Ocean WaterMPLAKEVTKGVFDPRTYREDDPENWARKRKPDWMATTGKIHFVRERTVEKELEDEAGSKEPSPTPEQVPEKEVVKMPPTEIPIVTNMERKQTNGYWPRKMRSDITRSRVI*
Ga0103872_103470013300009263Surface Ocean WaterVLYDGADFPRVAKFTKEVTKGVFDPRTYREDDPVNWARKRRSDWLAVPGKIHFVRERTVEKDIPDEKKPEGEVPEQGLEPSPDREVVKMPPREIPIMTNVGEKKQVNDYWPRKMRSDITRSRVI*
Ga0103876_102211323300009269Surface Ocean WaterRTYREDDPVNWARKRRSDWLAVPGKIHFVRERTVEKDIPDEKKAEEEAPEQVLEPSPDREVVKMPPREVPIMTNVGERKQVNDYWPRKMRSDITRSRVI*
Ga0103876_104356613300009269Surface Ocean WaterMPLAKEVTKGVFDPRTYREDDPENWARKRKPDWMATTGKIHFVRERTVEKELEDEAGSKEPSPTPEQVPEKDVVKMPPTEIPIVTNMERKQTNGYWPRKMRSDITRSRVI*
Ga0123379_104346813300009738MarineMVVTKEVTKGVFDPRTYREDDPVNWARKRRSDWLAVPGKIHFVRERTVEKEIPDEKKPEGEAPEQGLEPSPDREVVKMPPREVPIMTNVGERKQVNDYWPRKMRSDITRSRVI*
Ga0123368_112521013300009750MarineDTQNINIHINMVVTKEVTKGVFDPRTYREDDPVNWARKRRSDWLAVPGKIHFVRERTVEKEIPDEKKPEGEAPEQGLEPSPDREVVKMPPREVPIMTNVGERKQVNDYWPRKMRSDITRSRVI*
Ga0193227_10357413300018513MarineHGEISSSHTRFTLTLFKNTLKSNNMPLAKEVTKGVFDPRTYREDDPVNWARKRKPDWMATTGKIHFTRERTVDKELEEENGSKEPSPTPEQVPEKEVVKMPPTEIPIMTNMERKQTNDYWPRKMRSDITRSRVI
Ga0193462_10810113300018518MarineVTKGVFDPRTYREDDPVNWARKRKPDWMATTGKIHFTRERTVDKELEEENGSKEPSPTPEQVPEKEVVKMPPTEIPIMTNMERKQANDYWPRKMRSDITRSRVI
Ga0193230_10891313300018525MarineHGEISSSHTCFTLTLFKNTLKSNNMPLAKEVTKGVFDPRTYREDDPVNWARKRKPDWMATTGKIHFTRERTVDKELEEENGSKEPSPTPEQVPEKEVVKMPPTEIPIMTNMERKQTNDYWPRKMRSDITRSRVI
Ga0193331_100644213300018566MarineLLHINFIQKYTEANNMPLAKEVTKGVFDPRTYREDDPVNWARKRKPDWMATTGKIHFTRERTVDKELEEENGSKEPSPTPEQVPEKEVVKMPPTEIPIMTNMERKQANDYWPRKMRSDITRSRVI
Ga0193373_101346713300018576MarineHGEISSSHTCFTLTLIKNTLKSNNMPLAKEVTKGVFDPRTYREDDPVNWARKRKPDWMATTGKIHFTRERTVDKELEEENGSKEPSPTPEQVPEKEVVKMPPTEIPIMTNMERKQTNDYWPRKMRSDITRSRVI
Ga0193373_101549713300018576MarineKEVTKGVFDPRTYREDDPVNWARKRKPEWMATTGKIHFTRERTVDKELEEDNGSKEPSPTPEQVPEKEVVKMPPTEIPIMTNMERKQSNDYWPRKMRSDITRSRVV
Ga0193389_101194113300018578MarineVTKGVFDPRTYREDDPVNWARKRKPEWMATTGKIHFTRERTVDKELEEDNGSKEPSPTPEQVPEKEVVKMPPTEIPIMTNMERKQSNDYWPRKMRSDITRSRVV
Ga0193079_101106323300018581MarineNMPLAKEVTKGVFDPRTYREDDPVNWARKRKPDWMATTGKIHFTRERTVDKELEEENGSKEPSPTPEQVPEKEVVKMPPTEIPIMTNMERKQTNDYWPRKMRSDITRSRVI
Ga0193454_101470913300018582MarineTCFTLTLFKNTLKSNNMPLAKEVTKGVFDPRTYREDDPVNWARKRKPDWMATTGKIHFTRERTVDKELEEENGSKEPSPTPEQVPEKEVVKMPPTEIPIMTNMERKQANDYWPRKMRSDITRSRVI
Ga0193223_101043613300018583MarineHGEISSSHTCFTLTLFKNTLKSYNMPLAKEVTKGVFDPRTYREDDPVNWARKRKPDWMATTGKIHFTRERTVDKELEEENGSKEPSPTPEQVPEKEVVKMPPTEIPIMTNMERKQTNDYWPRKMRSDITRSRVI
Ga0193292_101580513300018594MarineTWEISSSHTCFTLTLIKNTLKSNNMPLAKEVTKGVFDPRTYREDDPVNWARKRKPDWMATTGKIHFTRERTVDKELEEENGSKEPSPTPEQVPEKEVVKMPPTEIPIMTNMERKQANDYWPRKMRSDITRSRVI
Ga0193182_101683813300018602MarineMPLAKEVTKGVFDPRTYREDDPENWARKRKPDWMATTGKIHFVRERTVEKELEDETGSKEPSPTPEQVPEKEVVKMPPTEIPIVTNMERKQTNDYWPRKMRSDITRSRVI
Ga0193447_102161513300018604MarineMVLTKEVTKGEFDPRTYRDADPANWARKRRSDWLAVPGKIVFTRERTVDRELEEEKKPEPEPSPEREVVKVPPVEIPIQTNVGRKPSMELAWPRKMRSDITRTRVI
Ga0193339_102090713300018605MarineTLTLIKNTLKSNNMPLAKEVTKGVFDPRTYREDDPVNWARKRKPDWMATTGKIHFTRERTVDKELEEENGSKEPSPTPEQVPEKEVVKMPPTEIPIMTNMERKQTNDYWPRKMRSDITRSRVI
Ga0193064_102812013300018616MarineEVTKGEFDPRTYREADPANWARKRRSDWLAVPGKIVFTRERTVDRELEEEKKPEPEPSPEREVVKVPPVEIPIQTNVGRKPSMELAWPRKMRSDITRTRVI
Ga0193204_101764413300018618MarineNNMPLAKEVTKGVFDPRTYREDDPVNWARKRKPDWMATTGKIHFTRERTVDKELDEENGSKEPSPTPEQVPEKEVVKMPPTEIPIMTNMERKQANDYWPRKMRSDITRSRVI
Ga0193431_102342913300018643MarineHGEISSSHTCFTLTLFKNTLKSNNMPLAKEVTKGVFDPRTYREDDPVNWARKRKPDWMATTGKIHFTRERTVDKELEEENGSKEPSPTPEQVPEKEVVKMPPTEIPIMTNMERKQANDYWPRKMRSDITRSRVI
Ga0192937_103919313300018651MarineMGSREQEADQLTINNISHTMVLTKEVTKGEFDPRTYREADPANWARKRRSDWLAVPGKIVFTRERTVDRELEEEKKPEPEPSPEREVMKVPPVEIPIQTNVGRKPSMELAWPRKMRSDITRTRVI
Ga0192889_106026413300018657MarineEQEADQLTINNISHTMVLTKEVTKGEFDPRTYREADPANWARKRRSDWLAVPGKIVFTRERTVDRELEDEKKPEPEPSPEREVMKVPPVEIPIQTNVGRKPSMELAWPRKMRSDITRTRV
Ga0193067_105119913300018659MarineMVVTKEVTRGVFDPRTYREDDPANWARKRRSDWLAVPGKIHFVRERTVDKDTPDDGEKTPEQAAEPSPDREVVKMPPKEIPIKSSSGDRKQSNDYWPRKMRSDITRSRVI
Ga0192999_102589413300018663MarineMPLAKEVTKGVFDPRTYREDDPENWARKRKPDWMATTGKIHFVRERTVEKELEDEAGSKEPSPTPEQVPEKEVVKMPPTEIPIVTNMERKQTNGYWPRKMRSDITRSRVI
Ga0192999_102589513300018663MarineMPLAKEVTKGVFDPRTYREDDPENWARKRKPDWMATTGKIHFVRERTVEKELEDDAGSKEPSPTPEQVPEKEVVKMPPTEIPIVTTMERKQTNGYWPRKMRSDITRSRVI
Ga0193401_104251113300018664MarineTCFTLTLIKNTLKSNNMPLAKEVTKGVFDPRTYREDDPVNWARKRKPDWMATTGKIHFTRERTVDKELEEENGSKEPSPTPEQVPEKEVVKMPPTEIPIMTNMERKQTNDYWPRKMRSDITRSRVI
Ga0193013_104186813300018668MarineHGEISSQHTCFTLTLIKNKLKSNNMPLAKEVTKGVFDPRTYREDDPVNWARKRKPEWMATTGKIHFTRERTVDKELEEDNGSKEPSPTPEQVPEKEVVKMPPTEIPIMTNMERKQSNDYWPRKMRSDITRSRVV
Ga0193108_11121023300018669MarineEDYVLVLYIQPESNNFQISSSHTCFTLTLFKNTLKSNNMPLAKEVTKGVFDPRTYREDDPVNWARKRKPDWMATTGKIHFTRERTVDKELEEENGSKEPSPTPEQVPEKEVVKMPPTEIPIMTNMERKQTNDYWPRKMRSDITRSRVI
Ga0193229_102148013300018673MarineMGQSTWEISSSHTCFTLTLIKNTLKSNNMPLAKEVTKGVFDPRTYREDDPVNWARKRKPDWMATTGKIHFTRERTVDKELEEENGSKEPSPTPEQVPEKEVVKMPPTEIPIMTNMERKQTNDYWPRKMRSDITRSRVI
Ga0193229_102463913300018673MarineMGQSTWEISSSHTCFTLTLIKNTLKSNNMPLAKEVTKGVFDPRTYREDDPVNWARKRKPDWMATTGKIHFTRERTVDKELEEENGSKEPSPTPEQVPEKEVVKMPPTEIPIMTNMERKQSNDYWPRKMRSDITRSRVV
Ga0193404_104696123300018677MarineSHTCFTLTLFKNTLKSNNMPLAKEVTKGVFDPRTYREDDPVNWARKRKPDWMATTGKIHFTRERTVDKELEEENGSKEPSPTPEQVPEKEVVKMPPTEIPIMTNMERKQANDYWPRKMRSDITRSRVI
Ga0193390_105733313300018679MarineHGEISSSHTCFTLTLIKNTLKSNNMPLAKEVTKGVFDPRTYREDDPVNWARKRKPDWMATTGKIHFTRERTVDKELEEENGSKEPSPTPEQVPEKEVVKMPPTEIPIMTNMERKQSNDYWPRKMRSDITRSRVV
Ga0193086_104014213300018685MarineMPLAKEVTKGVFDPRTYREDDPENWARKRKPDWMATTGKIHFVRYYQAFENSNFHRERTVEKELEDETGSKEPSPTPEQVPEKEVVKMPPTEIPIVTNMERKQTNDYWPRKMRSDITRSRVI
Ga0192917_105661113300018690MarineTWGTSREQEADQLTINNISHTMVLTKEVTKGEFDPRTYREADPANWARKRRSDWLAVPGKIVFTRERTVDRELEEEKKPEPEPSPEREVMKVPPVEIPIQTNVGRKPSMELAWPRKMRSDITRTRVI
Ga0193319_106926513300018697MarineMPLAKEVTKGVFDPRTYREDDPVNWARKRKPDWMATTGKIHFTRERTVDKELDEENGSKEPSPTPEQVPEKEVVKMPPTEIPIMTNMERKQANDYWPRKMRSDITRSRVI
Ga0193195_102782523300018699MarineMVVTKEVTRGVFDPRTYREDDPVNWARKRRSDWLAVPGKIHFVRERTVDKDTPDDGEKTPEQAAEPSPDREVVKMPPKEIPIKSSSGDRKQSNDYWPRKMRSDITRSRVI
Ga0193403_105320713300018700MarineSHTCFTLTLFKNTLKSNNMPLAKEVTKGVFDPRTYREDDPVNWARKRKPDWMATTGKIHFTRERTVDKELEEENGSKEPSPTPEQVPEKEVVKMPPTEIPIMTNMERKQTNDYWPRKMRSDITRSRVI
Ga0193209_102327513300018709MarineMPLAKEVTKGVFDPRTYREDDPVNWARKRKPDWMATTGKIHFTRERTVDKELEEENGSKEPSPTPEQVPEKEVVKMPPTEIPIMTNMERKQTNDYWPRKMRSDITRSRVI
Ga0193324_105336413300018716MarineSIMVVTKEVTRGVFDPRTYREDDPANWARKRRSDWLAVPGKIHFVRERTVDKDTPDDGEKTPEQAAEPSPDREVVKMPPKEIPIKSSSGDRKQSNDYWPRKMRSDITRSRVI
Ga0193038_103918913300018723MarineHGEISSSHTCFTLTLFKNTLKSDNMPLAKEVTKGVFDPRTYREDDPVNWARKRKPDWMATTGKIHFTRERTVDKELEEENGSKEPSPTPEQVPEKEVVKMPPTEIPIMTNMERKQTNDYWPRKMRSDITRSRVI
Ga0193333_106047913300018728MarineQISSSHTCYTLTLFKNTLKSNNMPLAKEVTKGVFDPRTYREDDPVNWARKRKPDWMATTGKIHFTRERTVDKELEEENGSKEPSPTPEQVPEKEVVKMPPTEIPIMTNMERKQTNDYWPRKMRSDITRSRVI
Ga0193174_107987813300018729MarineHTCFTLTLIKNTLKSNNMPLAKEVTKGVFDPRTYREDDPVNWARKRKPDWMATTGKIHFTRERTVDKELEEENGSKEPSPTPEQVPEKEVVKMPPTEIPIMTNMERKQTNDYWPRKMRSDITRSRVI
Ga0193495_104951513300018738MarineCFTLTLIKNTLKSNNMPLAKEVTKGVFDPRTYREDDPVNWARKRKPDWMATTGKIHFTRERTVDKELDEENGSKEPSPTPEQVPEKEVVKMPPTEIPIMTNMERKQTNDYWPRKMRSDITRSRVI
Ga0193387_106632813300018740MarineSITYHTMVLTKGVTKGEFDSRTYREADPANWARKRRSDWLAVPGKIVFTRERTVDRELEEEKKPEPEPSPEREVVKVPPVEIPIQTNVGRKPSMELAWPRKMRSDITRTRVI
Ga0193425_103891413300018743MarineQRRVHGEISSSHTCFTLTLFKNTLKSNNMPLAKEVTKGVFDPRTYREDDPVNWARKRKPDWMATTGKIHFTRERTVDKELEEENGSKEPSPTPEQVPEKEVVKMPPTEIPIMTNMERKQTNDYWPRKMRSDITRSRVI
Ga0193097_108168113300018750MarineEDYVLVLYIQPESNNFQISSSHTCFTLTLIKNTLKSNNMPLAKEVTKGVFDPRTYREDDPVNWARKRKPDWMATTGKIHFTRERTVDKELEEENGSKEPSPTPEQVPEKEVVKMPPTEIPIMTNMERKQTNDYWPRKMRSDITRSRVI
Ga0192902_107763113300018752MarineLTKEVTKGEFDPRTYREADQLTINNISHTMVLTKEVTKGEFDPRTYREADPANWARKRRSDWLAVPGKIVFTRERTVDRELEEEKKPEPEPSPEREVMKVPPVEIPIQTNVGRKPSMELAWPRKMRSDITRTRVI
Ga0192924_103946413300018764MarineMVLTKEVTKGEFDPRTYREADPANWARKRRSDWLAVPGKIVFTRERTVDRELEEEKKPEPEPSPEREVMKVPPVEIPIQTNVGRKPSMELAWPRKMRSDITRTRVI
Ga0193314_108277113300018771MarineQINISSSSIMVVTKEVTRGVFDPRTYREDDPANWARKRRSDWLAVPGKIHFVRERTVDKDTPDDGEKTPEQAAEPSPDREVVKMPPKEIPIKSSSGDRKQSNDYWPRKMRSDITRSRVI
Ga0192839_105943613300018777MarineSSHTCFTLTLFKNTLKSNNMPLAKEVTKGVFDPRTYREDDPVNWARKRKPDWMATTGKIHFTRERTVDKELEEENGSKEPSPTPEQVPEKEVVKMPPTEIPIMTNMERKQTNDYWPRKMRSDITRSRVI
Ga0193298_107448713300018784MarineHTCFTLTLFKNTLKSNNMPLAKEVTKGVFDPRTYREDDPVNWARKRKPDWMATTGKIHFTRERTVDKELEEENGSKEPSPTPEQVPEKEVVKMPPTEIPIMTNMERKQTNDYWPRKMRSDITRSRVI
Ga0193095_108219813300018785MarineSHTCFTLTLIKNTLKSNNMPLAKEVTKGVFDPRTYREDDPVNWARKRKPDWMATTGKIHFTRERTVDKELEEENGSKEPSPTPEQVPEKEVVKMPPTEIPIMTNMERKQTNDYWPRKMRSDITRSRVI
Ga0193095_109482313300018785MarineINISSSSIMVVTKEVTRGVFDPRTYREDDPANWARKRRSDWLAVPGKIHFVRERTVDKDTPDDGEKTPEQAAEPSPDREVVKMPPKEIPIKSSSGDRKQSNDYWPRKMRSDITRSRVI
Ga0193357_106789413300018794MarineKSNNMPLAKEVTKGVFDPRTYREDDPVNWARKRKPEWMATTGKIHFTRERTVDKELEEDNGSKEPSPTPEQVPEKEVVKMPPTEIPIMTNMERKQSNDYWPRKMRSDITRSRVV
Ga0192824_109004413300018801MarineQINISSSSIMVVTKEVTRGVFDPRTYREDDPVNWARKRRSDWLAVPGKIHFVRERTVDKDTPDDGEKTPEQAAEPSPDREVVKMPPKEIPIKSSSGDRKQSNDYWPRKMRSDITRSRVI
Ga0193183_103413313300018811MarineMPLAKEVTKGVFDPRTYREDDPENWARKRKPDWMATTGKIHFVRERTVEKELEDEAGSKEPSPTPEQVPEKEVVKMPPTEIPIVTNMERKQTNDYWPRKMRSDITRSRVI
Ga0193497_108790113300018819MarineHTCFTLTLFKNTLKSNNMPLAKEVTKGVFDPRTYREDDPVNWARKRKPDWMATTGKIHFTRERTVDKELDEENGSKEPSPTPEQVPEKEVVKMPPTEIPIMTNMERKQTNDYWPRKMRSDITRSRVI
Ga0193172_107832713300018820MarineHTCFTLTLFKNTLKSNNMPLAKEVTKGVFDPRTYREDDPVNWARKRKPDWMATTGKIHFTRERTVDKELDEENGSKEPSPTPEQVPEKEVVKMPPTEIPIMTNMERKQANDYWPRKMRSDITRSRVI
Ga0193053_106631313300018823MarineLTCFTLTLFKNTLKSNNMPLAKEVTKGVFDPRTYREDDPVNWARKRKPDWMATTGKIHFTRERTVDKELEEENGSKEPSPTPEQVPEKEVVKMPPTEIPIMTNMERKQTNDYWPRKMRSDITRSRVI
Ga0193226_111424413300018835MarineRRVHGEISSSHTCFTLTLFKNTLKSNNMPLAKEVTKGVFDPRTYREDDPVNWARKRKPDWMATTGKIHFTRERTVDKELEEENGSKEPSPTPEQVPEKEVVKMPPTEIPIMTNMERKQTNDYWPRKMRSDITRSRVI
Ga0193200_120614123300018840MarineHGEISSSHTCFTLTLIKNTLKSNNMPLAKEVTKGVFDPRTYREDDPVNWARKRKPDWMATTGKIHFTRERTVDKELEEENGSKEPSPTPEQIPEKEVVKMPPTEIPIMTNMERKQTNDYWPRKMRSDITRSRVI
Ga0193005_106142613300018849MarineTCFTLTLIKNTLKSNNMPLAKEVTKGVFDPRTYREDDPVNWARKRKPDWMATTGKIHFTRERTVDKELEEENGSKEPSPTPEQVPEKEVVKMPPTEIPIMTNMERKQANDYWPRKMRSDITRSRVI
Ga0193214_109053313300018854MarineFTLTLFKNTLKSNNMPLAKEVTKGVFDPRTYREDDPVNWARKRKPDWMATTGKIHFTRERTVDKELEEENGSKEPSPTPEQVPEKEVVKMPPTEIPIMTNMERKQTNDYWPRKMRSDITRSRVI
Ga0193214_110410713300018854MarineHQINISSSSIMVVTKEVTRGVFDPRTYREDDPVNWARKRRSDWLAVPGKIHFVRERTVDKDTPDDGEKTPEQAAEPSPDREVVKMPPKEIPIKSSSGDRKQSNDYWPRKMRSDITRSRVI
Ga0193199_108819913300018859MarineDTHQINISSSSIMVVTKEVTRGVFDPRTYREDDPVNWARKRRSDWLAVPGKIHFVRERTVDKDTPDDGEKTPEQAAEPSPDREVVKMPPKEIPIKSSSGDRKQSNDYWPRKMRSDITRSRVI
Ga0192859_107264613300018867MarineHTCFTLTLIKNTLKSNNMPLAKEVTKGVFDPRTYREDDPVNWARKRKPDWMATTGKIHFTRERTVDKELEEENGSKEPSPTPEQVPEKEVVKMPPTEIPIMTNMERKQANDYWPRKMRSDITRSRVI
Ga0193096_1018246413300018924MarineDYVLVLYIQPESNNFQISSSHTCFTLTLFKNTLKSNNMPLAKEVTKGVFDPRTYREDDPVNWARKRKPDWMATTGKIHFTRERTVDKELEEENGSKEPSPTPEQVPEKEVVKMPPTEIPIMTNMERKQTNDYWPRKMRSDITRSRVI
Ga0193318_1018533213300018925MarineLTLFKNTLKSNNMPLAKEVTKGVFDPRTYREDDPVNWARKRKPDWMATTGKIHFTRERTVDKELEEENGSKEPSPTPEQVPEKEVVKMPPTEIPIMTNMERKQANDYWPRKMRSDITRSRVI
Ga0193402_1017792813300018944MarineMPLAKEVTKGVFDPRTYREDDPVNWARKRKPEWMATTGKIHFTRERTVDKELEEDNGSKEPSPTPEQVPEKEVVKMPPTEIPIMTNMERKQSNDYWPRKMRSDITRSRVV
Ga0193066_1013244413300018947MarineYQRRVHGEISSSHTCFTLTLFKNTLKSNNMPLAKEVTKGVFDPRTYREDDPVNWARKRKPDWMATTGKIHFTRERTVDKELEEENGSKEPSPTPEQVPEKEVVKMPPTEIPIMTNMERKQTNDYWPRKMRSDITRSRVI
Ga0193066_1014398813300018947MarineMPLAKEVTKGVFDPRTYREDDPENWARKRKPDWMATTGKIHFVRERTVEKELEDEAGSKEPSPTPEQVPEKEVVKMPPTEIPIVTTMERKQTNGYWPRKMRSDITRSRVI
Ga0193560_1021138113300018958MarineQHTCFTLTLIKNILKSNNMPLAKEVTKGVFDPRTYREDDPVNWARKRKPDWMATTGKIHFTRERTVDKELEEDNGSKEPSPTPEQVPEKEVVKMPPTEIPIMTNMERKQTNDYWPRKMRSDITRSRVV
Ga0193332_1026766113300018963MarineVFDPRTYREDDPENWARKRKPDWMATTGKIHFVRERTVEKELEDEAGSKEPSPTPEQVPEKEVVKMPPTEIPIVTNMERKQTNGYWPRKMRSDITRSRVI
Ga0193087_1015900513300018964MarineMGEISSSHTCFTLTLIKNTLKSNNMPLAKEVTNGVFDPRTYREDDPVNWARKRKPDWMATTGKIHFTRERTVDKELEEENGSKEPSPTPEQVPEKEVVKMPPTEIPIMTNMERKQTNDYWPRKMRSDITRSRVI
Ga0193293_1005641913300018966MarineHGEISSSHTCFTLTLIKNTLKSNNMPLAKEVTKGVFDPRTYREDDPVNWARKRKPDWMATTGKIHFTRERTVDKELEEENGSKEPSPTPEQVPEKEVVKMPPTEIPIMTNMERKQANDYWPRKMRSDITRSRVI
Ga0193326_1006444113300018972MarineSSHTCFTLTLFKNTLKSNNMPLAKEVTKGVFDPRTYREDDPVNWARKRKPDWMATTGKIHFTRERTVDKELDEENGSKEPSPTPEQVPEKEVVKMPPTEIPIMTNMERKQTNDYWPRKMRSDITRSRVI
Ga0193136_1018081323300018985MarineTWEISSSHTCFTLTLFKNTLKSNNMPLAKEVTKGVFDPRTYREDDPVNWARKRKPDWMATTGKIHFTRERTVDKELDEENGSKEPSPTPEQVPEKEVVKMPPTEIPIMTNMERKQANDYWPRKMRSDITRSRVI
Ga0193136_1020307113300018985MarineMVVTKEVTKGVFDPRTYRDDDPVNWARKRRSDWLAIPGKIHFVRERTVEKDIPDEKKPEEGEQTAEATPEREVIKMPPKEIPIMTNVGEKKKENDYWPRKMRSDITRSRVI
Ga0193188_1007056613300018987MarineNISSSSIMVVTKEVTRGVFDPRTYREDDPANWARKRRSDWLAVPGKIHFVRERTVDKDTPDDGEKTPEQAAEPSPDREVVKMPPKEIPIKSSSGDRKQSNDYWPRKMRSDITRSRVI
Ga0193430_1011898413300018995MarineREISSSHTCFTLTLFKNTLKSNNMPLAKEVTKGVFDPRTYREDDPVNWARKRKPDWMATTGKIHFTRERTVDKELEEENGSKEPSPTPEQVPEKEVVKMPPTEIPIMTNMERKQTNDYWPRKMRSDITRSRVI
Ga0192916_1019213113300018996MarineTWGTSREQEADQLTINNISHTMVLTKEVTKGEFDPRTYREADPANWARKRRSDWLAVPGKIVFTRERTVDREMEDEKKPEPEPSPEREVMKVPPVEIPIQTNVGRKPSMELAWPRKMRSDITRTRVI
Ga0193444_1013523813300018998MarineTWGDQFFAYLLHINFIQKYTEANNMPLAKEVTKGVFDPRTYREDDPVNWARKRKPDWMATTGKIHFTRERTVDKELEEENGSKEPSPTPEQVPEKEVVKMPPTEIPIMTNMERKQSNDYWPRKMRSDITRSRVV
Ga0193444_1013795213300018998MarineTWGDQFFAYLLHINFIQKYTEANNMPLAKEVTKGVFDPRTYREDDPVNWARKRKPDWMATTGKIHFTRERTVDKELEEENGSKEPSPTPEQVPEKEVVKMPPTEIPIMTNMERKQSNDYWPRKMRSDITRSRVI
Ga0193514_1021209513300018999MarineMPLAKEVTKGVFDPRTYREDDPENWARKRKPDWMATTGKIHFVRERTVEKELEDEAGSKEPSPTPEQVPEKDVVKMPPTEIPIVTNMERKQTNGYWPRKMRSDITRSRVI
Ga0193078_1010359113300019004MarineHGEISSSHTCLTLTLFKNTLKSNNMPLAKEVTKGVFDPRTYREDDPVNWARKRKPDWMATTGKIHFTRERTVDKELEEENGSKEPSPTPEQVPEKEVVKMPPTEIPIMTNMERKQSNDYWPRKMRSDITRSRVV
Ga0193078_1010547613300019004MarineHGEISSQHTCFTLTLIKNKLKSNNTPLAKEVTKGVFDPRTYREDDPVNWARKRKPDWMATTGKIHFTRERTVDKELEEENGSKEPSPTPEQVPEKEVVKMPPTEIPIMTNMERKQTNDYWPRKMRSDITRSRVI
Ga0193078_1022006313300019004MarineDDPENWARKRKPDWMATTGKIHFVRERTVEKELEDEAGSKEPSPTPEQVPDKEVVKMPPTEIPIVTNMERKQTNGYWPRKMRSDITRSRVI
Ga0193361_1026465613300019008MarineHTCFTLTLFKNTLKSNNMPLAKEVTKGVFDPRTYREDDPVNWARKRKPEWMATTGKIHFTRERTVDKELEEDNGSKEPSPTPEQVPEKEVVKMPPTEIPIMTNMERKQSNDYWPRKMRSDITRSRVV
Ga0193361_1027633813300019008MarineTCFTLTLFKNTLKSNNMPLAKEVTKGVFDPRTYREDDPVNWARKRKPDWMATTGKIHFTRERTVDKELEEENGSKEPSPTPEQVPEKEVVKMPPTEIPIMTNMERKQTNDYWPRKMRSDITRSRVI
Ga0193044_1023189423300019010MarineAKEVTKGVFDPRTYREDDPVNWARKRKPDWMATTGKIHFTRERTVDKELDEENGSKEPSPTPEQVPEKEVVKMPPTEIPIMTNMERKQTNDYWPRKMRSDITRSRVI
Ga0193094_1020485213300019016MarineLYIQPESNNFQISSSHTCFTLTLIKNTLKSNNMPLAKEVTKGVFDPRTYREDDPVNWARKRKPDWMATTGKIHFTRERTVDKELEEENGSKEPSPTPEQVPEKEVVKMPPTEIPIMTNMERKQTNDYWPRKMRSDITRSRVI
Ga0193555_1020732923300019019MarineIQEISSSHTCFTLTLFKNTLKSNNMPLAKEVTKGVFDPRTYREDDPVNWARKRKPDWMATTGKIHFTRERTVDKELEEENGSKEPSPTPEQVPEKEVVKMPPTEIPIMTNMERKQTNDYWPRKMRSDITRSRVI
Ga0193558_1029500113300019038MarineCFTLTLIKNILKSNNMPLAKEVTKGVFDPRTYREDDPVNWARKRKPDWMATTGKIHFTRERTVDKELEDDNGSKEPSPTPEQVPEKEVVKMPPTEIPIMTNMERKQTNDYWPRKMRSDITRSRVV
Ga0192998_1014504313300019043MarineTWEISSSHTCFTLTFFKNTLKSNNMPLAKEVTKGVFDPRTYREDDPVNWARKRKPDWMATTGKIHFTRERTVDKELEEENGSKEPSPTPEQVPEKEVVKMPPTEIPIMTNMERKQTNDYWPRKMRSDITRSRVI
Ga0192826_1016649623300019051MarineYQRRVHGEISSSHTCFTLTLIKNTLKSNNMPLAKEVTKGVFDPRTYREDDPVNWARKRKPDWMATTGKIHFTRERTVDKELEEENGSKEPSPTPEQVPEKEVVKMPPTEIPIMTNMERKQTNDYWPRKMRSDITRSRVI
Ga0193455_1037985213300019052MarineQISSSHTCFTLTLFKNTLKSNNMPLAKEVTKGVFDPRTYREDDPVNWARKRKPDWMATTGKIHFTRERTVDKELEEENGSKEPSPTPEQVPEKEVVKMPPTEIPIMTNMERKQTNDYWPRKMRSDITRSRVI
Ga0193208_1051422613300019055MarineMNILHFIDPALYREADPANWARKRRSDWLAVPGKIVFTRERTVDRELEEEKKPEPEPSPEREVVKVPPVEIPIQTNVGRKPSMELAWPRKMRSDITRTRVI
Ga0193459_10306923300019067MarineNNMPLAKEVTKGVFDPRTYREDDPVNWARKRKPDWMATTGKIHFTRERTVDKELEEENGSKEPSPTPEQVPEKEVVKMPPTEIPIMTNMERKQTNDYWPRKMRSDITRSRVI
Ga0193436_104914613300019129MarineHGEISSSHTCFTLTVIKNTLKSINMPLAKEVTKGVFDPRTYREDDPVNWARKRKPDWMATTGKIHFTRERTVDKELEEENGSKEPSPTPEQVPEKEVVKMPPTEIPIMTNMERKQTNDYWPRKMRSDITRSRVI
Ga0193499_107170813300019130MarineAVGVEDYVLVLYIQPESNNFQISSSHTCFTLTLFKNTLKSNNMPLAKEVTKGVFDPRTYREDDPVNWARKRKPDWMATTGKIHFTRERTVDKELEEENGSKEPSPTPEQVPEKEVVKMPPTEIPIMTNMERKQTNDYWPRKMRSDITRSRVI
Ga0193499_108183313300019130MarineMGKISSQHTCFTLTLIKNILKSNNMPLAKEVTKGVFDPRTYREDDPANWARKRKPDWMATTGKIHFTRERTVDKELEDDNGSKEPSPTPEQVPEKEVVKMPPTEIPIMTNMERKQTNDYWPRKMRSDITRSRVV
Ga0193515_107245013300019134MarineMPLAKEVTKGVFDPRTYREDDPENWARKRKPDWMATTGKIHFVRERTVEKELEDEAGSKEPSPTPEQAPEKEVVKMPPTEIPIVTNMERKQTNGYWPRKMRSDITRSRVI
Ga0193216_1010102313300019138MarineLVSKKFAIIIIIFYQREDDPVNWARKRKPDWMATTGKIHFTRERTVDKELEEENGSKEPSPTPEQVPEKEVVKMPPTEIPIMTNMERKQTNDYWPRKMRSDITRSRVI
Ga0193216_1011717113300019138MarineMGYQRRVHGEISSSHTCFTLTLFKNTLKSNNMPLAKEVTKGVFDPRTYREDDPVNWARKRKPDWMATTGKIHFTRERTVDKELEEENGSKEPSPTPEQVPEKEVVKMPPTEIPIMTNMERKQTNDYWPRKMRSDITRSRVI
Ga0193453_111627413300019147MarineGVVATQSTWEISSSHTCFTLTLFKNTLKSNNMPLAKEVTKGVFDPRTYREDDPVNWARKRKPDWMATTGKIHFTRERTVDKELEEENGSKEPSPTPEQVPEKEVVKMPPTEIPIMTNMERKQTNDYWPRKMRSDITRSRVI
Ga0192888_1023087813300019151MarineIYPPEYARPPTSREQEADQLTINNISHTMVLTKEVTKGEFDPRTYREADPANWARKRRSDWLAVPGKIVFTRERTVDREMEDEKKPEPEPSPEREVMKVPPVEIPIQTNVGRKPSMELAWPRKMRSDITRTRVI
Ga0193564_1025375813300019152MarineREQEADQLTINNISHTMVLTKEVTKGEFDPRTYREADPANWARKRRSDWLAVPGKIVFTRERTVDRELEEEKKPEPEPSPEREVMKVPPVEIPIQTNVGRKPSMELAWPRKMRSDITRTRVI
Ga0073969_1143040513300030749MarineQEADQLTINNISHTMVLTKEVTKGEFDPRTYREADPANWARKRRSDWLAVPGKIVFTRERTVDREMEDEKKPEPEPSPEREVMKVPPVEIPIQTNVGRKPSMELAWPRKMRSDITRTRVI
Ga0073986_1204321213300031038MarineEQEADQLTINNISHTMVLTKEVTKGEFDPRTYREADPANWARKRRSDWLAVPGKIVFTRERTVDRELEDEKKPEPEPNPEREVMKVPPVEIPIQTNVGRKPSMELAWPRKMRSDITRTRV
Ga0138346_1067456413300031056MarineEADQLTINNISHTMVLTKEVTKGEFDPRTYREADPANWARKRRSDWLAVPGKIVFTRERTVDRELEEEKKPEPEPSPEREVMKVPPVEIPIQTNVGRKPSMELAWPRKMRSDITRTRVI
Ga0138345_1055252813300031121MarineMPLAKEVTKGVFDPRTYREDDPENWARKRKPDWMATTGKIHFVRERTVEKELEDEASSKEPSPTPEQVPEKEVVKMPPTEIPIVTNMERKQANGYWPRKMRSDITRSRVI

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.