Metagenome Family F078771

Basic Information
Family ID	F078771
Family Type	Metagenome
Number of Sequences	116
Average Sequence Length	43 residues
Representative Sequence	MAGEYVTVPLNTSLKGWNARWFYMKQSHPAIRCDVDHIPESQKS
Number of Associated Samples	53
Number of Associated Scaffolds	116

Quality Assessment
Transcriptomic Evidence	No
Most common taxonomic group	Unclassified
% of genes with valid RBS motifs	20.00 %
% of genes near scaffold ends (potentially truncated)	55.17 %
% of genes from short scaffolds (< 2000 bps)	94.83 %
Associated GOLD sequencing projects	53
AlphaFold2 3D model prediction	Yes
3D model pTM-score	0.28

Most Common Taxonomy
Group	Unclassified (75.862 % of family members)
NCBI Taxonomy ID	N/A
Taxonomy	N/A

Most Common Ecosystem
GOLD Ecosystem	Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Miscanthus Phyllosphere (98.276 % of family members)
Environment Ontology (ENVO)	Unclassified (98.276 % of family members)
Earth Microbiome Project Ontology (EMPO)	Host-associated → Plant → Plant surface (98.276 % of family members)

Full Alignment
Alignment of all the sequences in the family.

Powered by MSAViewer

Seed Alignment
Alignment of a non-redundant set of sequences, used to build the family's HMM profile.

Powered by MSAViewer

AlphaFold2 Input Alignment
Refined alignment used as input for AlphaFold2.

Powered by MSAViewer

Predicted Topology & Secondary Structure
Classification:	Globular	Signal Peptide:	No	Secondary Structure distribution:	α-helix: 23.61% β-sheet: 0.00% Coil/Unstructured: 76.39%
Feature Viewer

Powered by Feature Viewer

Pfam ID	Name	% Frequency in 116 Family Scaffolds
PF04195	Transposase_28	61.21

NCBI Taxonomy

Select NCBI taxonomy Level:

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	75.86 %
All Organisms	root	All Organisms	24.14 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	75.86 %
cellular organisms	root	All Organisms → cellular organisms	24.14 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	75.86 %
Eukaryota	superkingdom	All Organisms → cellular organisms → Eukaryota	24.14 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	75.86 %
Viridiplantae	kingdom	All Organisms → cellular organisms → Eukaryota → Viridiplantae	24.14 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	75.86 %
Streptophyta	phylum	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta	24.14 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	75.86 %
Streptophytina	subphylum	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina	24.14 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	75.86 %
Embryophyta	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	24.14 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	75.86 %
Tracheophyta	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta	24.14 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	75.86 %
Euphyllophyta	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta	24.14 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	75.86 %
Spermatophyta	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta	24.14 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	75.86 %
Magnoliopsida	class	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida	24.14 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	75.86 %
Mesangiospermae	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae	24.14 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	75.86 %
Liliopsida	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida	24.14 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	75.86 %
Petrosaviidae	subclass	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae	24.14 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	75.86 %
commelinids	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids	24.14 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	75.86 %
Poales	order	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales	24.14 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	75.86 %
Poaceae	family	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae	24.14 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	75.86 %
PACMAD clade	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade	20.69 %
BOP clade	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade	2.59 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	75.86 %
Panicoideae	subfamily	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae	20.69 %
Oryzoideae	subfamily	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Oryzoideae	2.59 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	75.86 %
Andropogonodae	no rank	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae	19.83 %
Oryzeae	tribe	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Oryzoideae → Oryzeae	2.59 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	75.86 %
Andropogoneae	tribe	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae	19.83 %
Oryzinae	subtribe	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Oryzoideae → Oryzeae → Oryzinae	1.72 %
Zizaniinae	subtribe	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Oryzoideae → Oryzeae → Zizaniinae	0.86 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	75.86 %
Sorghinae	subtribe	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae	19.83 %
Oryza	genus	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Oryzoideae → Oryzeae → Oryzinae → Oryza	1.72 %
Zizania	genus	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Oryzoideae → Oryzeae → Zizaniinae → Zizania	0.86 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	75.86 %
Sorghum	genus	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum	19.83 %
Oryza	genus	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Oryzoideae → Oryzeae → Oryzinae → Oryza	1.72 %
Zizania palustris	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Oryzoideae → Oryzeae → Zizaniinae → Zizania → Zizania palustris	0.86 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	75.86 %
Sorghum bicolor	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor	19.83 %
Oryza	genus	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Oryzoideae → Oryzeae → Oryzinae → Oryza	1.72 %
Zizania palustris	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Oryzoideae → Oryzeae → Zizaniinae → Zizania → Zizania palustris	0.86 %

Visualization

Powered by ApexCharts

Associated Scaffolds

Scaffold	Taxonomy	Length	IMG/M Link
3300005354\|Ga0070675_101805091	Not Available	564	Open in IMG/M
3300006358\|Ga0068871_101934264	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor	561	Open in IMG/M
3300015268\|Ga0182154_1037608	Not Available	609	Open in IMG/M
3300015269\|Ga0182113_1018495	Not Available	817	Open in IMG/M
3300015274\|Ga0182188_1053856	Not Available	523	Open in IMG/M
3300015275\|Ga0182172_1030549	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor	655	Open in IMG/M
3300015277\|Ga0182128_1022295	Not Available	719	Open in IMG/M
3300015277\|Ga0182128_1032842	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor	648	Open in IMG/M
3300015277\|Ga0182128_1034321	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor	641	Open in IMG/M
3300015279\|Ga0182174_1060916	Not Available	558	Open in IMG/M
3300015279\|Ga0182174_1070286	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor	535	Open in IMG/M
3300015281\|Ga0182160_1028403	Not Available	684	Open in IMG/M
3300015283\|Ga0182156_1048045	Not Available	602	Open in IMG/M
3300015285\|Ga0182186_1083898	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor	501	Open in IMG/M
3300015286\|Ga0182176_1069921	Not Available	537	Open in IMG/M
3300015288\|Ga0182173_1034240	Not Available	656	Open in IMG/M
3300015288\|Ga0182173_1057216	Not Available	569	Open in IMG/M
3300015292\|Ga0182141_1085827	Not Available	517	Open in IMG/M
3300015294\|Ga0182126_1030656	Not Available	702	Open in IMG/M
3300015295\|Ga0182175_1061314	Not Available	582	Open in IMG/M
3300015295\|Ga0182175_1090259	Not Available	516	Open in IMG/M
3300015295\|Ga0182175_1094842	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor	508	Open in IMG/M
3300015298\|Ga0182106_1040870	Not Available	664	Open in IMG/M
3300015299\|Ga0182107_1027606	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Oryzoideae → Oryzeae → Zizaniinae → Zizania → Zizania palustris	747	Open in IMG/M
3300015299\|Ga0182107_1043142	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae	657	Open in IMG/M
3300015299\|Ga0182107_1083825	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor	539	Open in IMG/M
3300015300\|Ga0182108_1053216	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor	623	Open in IMG/M
3300015300\|Ga0182108_1060439	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor	600	Open in IMG/M
3300015303\|Ga0182123_1052451	Not Available	606	Open in IMG/M
3300015303\|Ga0182123_1059173	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor	585	Open in IMG/M
3300015305\|Ga0182158_1036540	Not Available	687	Open in IMG/M
3300015308\|Ga0182142_1007615	Not Available	1105	Open in IMG/M
3300015308\|Ga0182142_1030852	Not Available	746	Open in IMG/M
3300015308\|Ga0182142_1090574	Not Available	542	Open in IMG/M
3300015314\|Ga0182140_1045072	Not Available	671	Open in IMG/M
3300015322\|Ga0182110_1080576	Not Available	578	Open in IMG/M
3300015323\|Ga0182129_1046953	Not Available	660	Open in IMG/M
3300015323\|Ga0182129_1061262	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor	611	Open in IMG/M
3300015342\|Ga0182109_1085686	Not Available	719	Open in IMG/M
3300015342\|Ga0182109_1139707	Not Available	602	Open in IMG/M
3300015342\|Ga0182109_1158729	Not Available	573	Open in IMG/M
3300015343\|Ga0182155_1047585	Not Available	871	Open in IMG/M
3300015343\|Ga0182155_1059027	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor	810	Open in IMG/M
3300015343\|Ga0182155_1064650	Not Available	786	Open in IMG/M
3300015343\|Ga0182155_1106414	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor	662	Open in IMG/M
3300015343\|Ga0182155_1121199	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor	632	Open in IMG/M
3300015344\|Ga0182189_1160133	Not Available	577	Open in IMG/M
3300015344\|Ga0182189_1213378	Not Available	516	Open in IMG/M
3300015345\|Ga0182111_1088540	Not Available	741	Open in IMG/M
3300015345\|Ga0182111_1129898	Not Available	643	Open in IMG/M
3300015345\|Ga0182111_1151513	Not Available	606	Open in IMG/M
3300015346\|Ga0182139_1045109	Not Available	944	Open in IMG/M
3300015346\|Ga0182139_1094771	Not Available	723	Open in IMG/M
3300015346\|Ga0182139_1097290	Not Available	716	Open in IMG/M
3300015346\|Ga0182139_1174344	Not Available	575	Open in IMG/M
3300015346\|Ga0182139_1228489	Not Available	517	Open in IMG/M
3300015347\|Ga0182177_1132353	Not Available	641	Open in IMG/M
3300015347\|Ga0182177_1142957	Not Available	623	Open in IMG/M
3300015347\|Ga0182177_1220834	Not Available	527	Open in IMG/M
3300015347\|Ga0182177_1225370	Not Available	522	Open in IMG/M
3300015347\|Ga0182177_1229492	Not Available	519	Open in IMG/M
3300015351\|Ga0182161_1136909	Not Available	657	Open in IMG/M
3300015351\|Ga0182161_1156893	Not Available	623	Open in IMG/M
3300015351\|Ga0182161_1259583	Not Available	508	Open in IMG/M
3300015355\|Ga0182159_1318953	Not Available	524	Open in IMG/M
3300015361\|Ga0182145_1006083	Not Available	1467	Open in IMG/M
3300015361\|Ga0182145_1097946	Not Available	633	Open in IMG/M
3300017404\|Ga0182203_1047458	Not Available	749	Open in IMG/M
3300017407\|Ga0182220_1065567	Not Available	581	Open in IMG/M
3300017407\|Ga0182220_1088983	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae	532	Open in IMG/M
3300017409\|Ga0182204_1032179	Not Available	745	Open in IMG/M
3300017409\|Ga0182204_1067002	Not Available	601	Open in IMG/M
3300017409\|Ga0182204_1121139	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Oryzoideae → Oryzeae → Oryzinae → Oryza	500	Open in IMG/M
3300017410\|Ga0182207_1048870	Not Available	768	Open in IMG/M
3300017410\|Ga0182207_1072983	Not Available	676	Open in IMG/M
3300017410\|Ga0182207_1102622	Not Available	605	Open in IMG/M
3300017410\|Ga0182207_1163678	Not Available	515	Open in IMG/M
3300017410\|Ga0182207_1174948	Not Available	503	Open in IMG/M
3300017411\|Ga0182208_1063288	Not Available	629	Open in IMG/M
3300017411\|Ga0182208_1067869	Not Available	616	Open in IMG/M
3300017413\|Ga0182222_1071643	Not Available	561	Open in IMG/M
3300017415\|Ga0182202_1033383	Not Available	786	Open in IMG/M
3300017424\|Ga0182219_1036538	Not Available	764	Open in IMG/M
3300017424\|Ga0182219_1043708	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Oryzoideae → Oryzeae → Oryzinae → Oryza	721	Open in IMG/M
3300017425\|Ga0182224_1064044	Not Available	680	Open in IMG/M
3300017425\|Ga0182224_1070037	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor	662	Open in IMG/M
3300017427\|Ga0182190_1100163	Not Available	598	Open in IMG/M
3300017427\|Ga0182190_1126741	Not Available	551	Open in IMG/M
3300017430\|Ga0182192_1060378	Not Available	723	Open in IMG/M
3300017430\|Ga0182192_1071608	Not Available	682	Open in IMG/M
3300017430\|Ga0182192_1104181	Not Available	601	Open in IMG/M
3300017436\|Ga0182209_1070251	Not Available	673	Open in IMG/M
3300017436\|Ga0182209_1074443	Not Available	661	Open in IMG/M
3300017436\|Ga0182209_1140677	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor	539	Open in IMG/M
3300017438\|Ga0182191_1031260	Not Available	896	Open in IMG/M
3300017442\|Ga0182221_1069822	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor	663	Open in IMG/M
3300017442\|Ga0182221_1084882	Not Available	625	Open in IMG/M
3300017442\|Ga0182221_1147846	Not Available	526	Open in IMG/M
3300017683\|Ga0182218_1048400	Not Available	715	Open in IMG/M
3300017683\|Ga0182218_1067911	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor	647	Open in IMG/M
3300017683\|Ga0182218_1112495	Not Available	555	Open in IMG/M
3300017684\|Ga0182225_1038001	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor	761	Open in IMG/M
3300017684\|Ga0182225_1078321	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor	608	Open in IMG/M
3300017684\|Ga0182225_1118423	Not Available	535	Open in IMG/M
3300017684\|Ga0182225_1123749	Not Available	528	Open in IMG/M
3300017685\|Ga0182227_1069888	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor	647	Open in IMG/M
3300017685\|Ga0182227_1114931	Not Available	536	Open in IMG/M
3300017686\|Ga0182205_1123264	Not Available	563	Open in IMG/M
3300017689\|Ga0182231_1029247	Not Available	1025	Open in IMG/M
3300017689\|Ga0182231_1078754	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor	628	Open in IMG/M

Habitat	Taxonomy	Distribution
Host-Associated	Host-Associated	100.00%

Habitat	Taxonomy	Distribution
Plants	Host-Associated → Plants	100.00%

Habitat	Taxonomy	Distribution
Phyllosphere	Host-Associated → Plants → Phyllosphere	98.28%
Roots	Host-Associated → Plants → Roots	0.86%
Rhizosphere	Host-Associated → Plants → Rhizosphere	0.86%

Habitat	Taxonomy	Distribution
Unclassified	Host-Associated → Plants → Phyllosphere → Unclassified	98.28%
Rhizosphere	Host-Associated → Plants → Roots → Rhizosphere	0.86%
Soil	Host-Associated → Plants → Rhizosphere → Soil	0.86%

Habitat	Taxonomy	Distribution
Unclassified	Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified	98.28%
Soil	Host-Associated → Plants → Roots → Rhizosphere → Soil	0.86%
Unclassified	Host-Associated → Plants → Rhizosphere → Soil → Unclassified	0.86%

Habitat	Taxonomy	Distribution
Miscanthus Phyllosphere	Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Miscanthus Phyllosphere	98.28%
Miscanthus Rhizosphere	Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere	0.86%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere	0.86%

Taxon OID	Sample Name	Habitat Type	IMG/M Link
3300005354	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG	Host-Associated	Open in IMG/M
3300006358	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2	Host-Associated	Open in IMG/M
3300015268	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_12JUL2016_LD1 MG	Host-Associated	Open in IMG/M
3300015269	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_09MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015274	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_22AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015275	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_01AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015277	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_31MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015279	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_01AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015281	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_12JUL2016_LD1 MG	Host-Associated	Open in IMG/M
3300015283	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_12JUL2016_LD1 MG	Host-Associated	Open in IMG/M
3300015285	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_22AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015286	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_01AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015288	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_01AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015292	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_20JUN2016_LD1 MG	Host-Associated	Open in IMG/M
3300015294	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_31MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015295	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_01AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015298	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_09MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015299	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_09MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015300	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_09MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015303	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_31MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015305	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_12JUL2016_LD1 MG	Host-Associated	Open in IMG/M
3300015308	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_20JUN2016_LD1 MG	Host-Associated	Open in IMG/M
3300015314	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_20JUN2016_LD1 MG	Host-Associated	Open in IMG/M
3300015322	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_09MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015323	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_31MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015342	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_09MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015343	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_12JUL2016_LD1 MG	Host-Associated	Open in IMG/M
3300015344	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_22AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015345	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_09MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015346	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_20JUN2016_LD1 MG	Host-Associated	Open in IMG/M
3300015347	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_01AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015351	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_12JUL2016_LD1 MG	Host-Associated	Open in IMG/M
3300015355	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_12JUL2016_LD1 MG	Host-Associated	Open in IMG/M
3300015361	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_20JUN2016_LD1 MG	Host-Associated	Open in IMG/M
3300017404	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_12SEP2016_LD1 MG	Host-Associated	Open in IMG/M
3300017407	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_03OCT2016_LD1 MG	Host-Associated	Open in IMG/M
3300017409	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_12SEP2016_LD1 MG	Host-Associated	Open in IMG/M
3300017410	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_12SEP2016_LD1 MG	Host-Associated	Open in IMG/M
3300017411	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_12SEP2016_LD1 MG	Host-Associated	Open in IMG/M
3300017413	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_03OCT2016_LD1 MG	Host-Associated	Open in IMG/M
3300017415	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_12SEP2016_LD1 MG	Host-Associated	Open in IMG/M
3300017424	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_03OCT2016_LD1 MG	Host-Associated	Open in IMG/M
3300017425	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_03OCT2016_LD1 MG	Host-Associated	Open in IMG/M
3300017427	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_22AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300017430	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_22AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300017436	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_12SEP2016_LD1 MG	Host-Associated	Open in IMG/M
3300017438	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_22AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300017442	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_03OCT2016_LD1 MG	Host-Associated	Open in IMG/M
3300017683	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_03OCT2016_LD1 MG	Host-Associated	Open in IMG/M
3300017684	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_03OCT2016_LD1 MG	Host-Associated	Open in IMG/M
3300017685	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_07NOV2016_LD1 MG	Host-Associated	Open in IMG/M
3300017686	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_12SEP2016_LD1 MG	Host-Associated	Open in IMG/M
3300017689	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_07NOV2016_LD1 MG	Host-Associated	Open in IMG/M

Family Sequences

Protein ID	Sample Taxon ID	Habitat	Sequence
Ga0070675_1018050911	3300005354	Miscanthus Rhizosphere	MASDYTSVPLNTSLKGWNSKWFYMKQNHLVIRCDVHHILES
Ga0068871_1019342643	3300006358	Miscanthus Rhizosphere	MAGEYITVPLNTSLKGWNARWFYMKQSHPTIRCDVDHILENLKS*
Ga0182154_10376082	3300015268	Miscanthus Phyllosphere	GEYLTVPLNTSLKGWNTRWFYMKQSHLAIRCDVDHVPEN*
Ga0182113_10184952	3300015269	Miscanthus Phyllosphere	MASEYINIPLNTSLKGWNSRWFYMKQSHPAIRCDVHHIPESQKS*
Ga0182188_10538562	3300015274	Miscanthus Phyllosphere	MAGEYLTVPLNTSLKGWNARWFYMKQSHLAIRCDADHIPESQKS*
Ga0182172_10305492	3300015275	Miscanthus Phyllosphere	MVGEYITILLNTSLKGWNARWFYMKQSHPAIRCDVDHVPENQRSWTEN*
Ga0182172_10480031	3300015275	Miscanthus Phyllosphere	MYLQLCNRMAGEYITVPLNTSLKGWNARWFYMEQSHPAIRCDIDHIPEN*
Ga0182128_10222952	3300015277	Miscanthus Phyllosphere	MAGEYVTVPLNTSLKGWNAKWFYMKQSHPVVRCDVDHIPES*
Ga0182128_10328423	3300015277	Miscanthus Phyllosphere	MASEYLTVPLNKSLKGWNARWFYMKQSHPTVCCDADHILEIQRSWLEMPS
Ga0182128_10343212	3300015277	Miscanthus Phyllosphere	MASEYINVPLNTSLKGWNARWFYIEQIHPVIWCDVHH
Ga0182174_10609161	3300015279	Miscanthus Phyllosphere	MADEYITILLNTSLKGWNARWFYMKQSHPAICCDVNHILEN*
Ga0182174_10702862	3300015279	Miscanthus Phyllosphere	MAGEYLTMLLNTSLKGWNVRWFYMKQSHPAICCDTDHISES*
Ga0182160_10284032	3300015281	Miscanthus Phyllosphere	MAGEYITVPLNTSLKGWNARWFYMKQSHPTIRCDVNHVLEN*
Ga0182156_10480451	3300015283	Miscanthus Phyllosphere	MVSEYLTVLLNTSLKGWNTRWFYMKQNHPVVRCDTDHIPEN*
Ga0182186_10838982	3300015285	Miscanthus Phyllosphere	MASEYITVPLNTSLKGWNARWFYMKQSHYDVDHIPESQKS*
Ga0182176_10699212	3300015286	Miscanthus Phyllosphere	MVGEYLTVLLNTSLKGWNARWFYMKQSHPTIHYDTDHILDSQKSW
Ga0182173_10342401	3300015288	Miscanthus Phyllosphere	PLNTSLKGWNARWFYIKQSHPAIRYDADHILESRRS*
Ga0182173_10572161	3300015288	Miscanthus Phyllosphere	LIVPLNTSLKWWNARWFYMRQSHSAVRYDTDHIPESQKS*
Ga0182141_10858271	3300015292	Miscanthus Phyllosphere	MASEYITIPLNTSLKGWNARWFYMKQSHPAIHCDIDHIPESQKS*
Ga0182126_10306561	3300015294	Miscanthus Phyllosphere	MASKYITVLLNTSLKGWNARWFYMKQSHPAIRCDVDHVPENQKSW*
Ga0182175_10613141	3300015295	Miscanthus Phyllosphere	QLWDGMASEYINIPLNTSLKGWNSRWFYMKQSHPAIRCDVHHIPESQKS*
Ga0182175_10902591	3300015295	Miscanthus Phyllosphere	LQLRDGMASEYLTLPLNTSLKGWNARWFYMKQSQPAIRCDADHVPESQKS*
Ga0182175_10948421	3300015295	Miscanthus Phyllosphere	MAGEYITVPLNTLLKRWNARWFFMKQNHPTIRCDVEYVSENQRS
Ga0182106_10408702	3300015298	Miscanthus Phyllosphere	DGMAGEYITMPLNTLLKRCNARWFYMKQSHPAIRCYVDQIPENQRS*
Ga0182107_10276061	3300015299	Miscanthus Phyllosphere	MASEYINVPLNTSLEGWNSKWSYMKQSHPAIRCDVHHI
Ga0182107_10431421	3300015299	Miscanthus Phyllosphere	MADEYLTLPLNTSLKGWNGRWFYMKQSQPTIRCDADYISES*
Ga0182107_10838252	3300015299	Miscanthus Phyllosphere	MASEYITIPLNTSLKGWNDRWFYLKQSHPAIRSDVDHVLEN*
Ga0182108_10532162	3300015300	Miscanthus Phyllosphere	MAGEYLTVPLNTSLKGWNARWFYIKQSHPAVRCDTDHIPES
Ga0182108_10604392	3300015300	Miscanthus Phyllosphere	MASEYINVPLNTSLKGWNSRWFYIKQSHPLIRCDVHYIPVNHSNWS
Ga0182123_10514771	3300015303	Miscanthus Phyllosphere	RDGMAGEYITIPLNTSLKGWNTRWFYMKQSHPAIHCDVDHMSENQRSW*
Ga0182123_10524511	3300015303	Miscanthus Phyllosphere	CDGMVGEYLTVLLNTSLKGWNARWFYMKQSHIAICYDVDHIPESQKR*
Ga0182123_10591732	3300015303	Miscanthus Phyllosphere	MVGEYLTVLLNTSLKGWNARWFYMKQSHPAIRCDPNHIPESQKS*
Ga0182158_10365402	3300015305	Miscanthus Phyllosphere	VADEYITMLLNTSLKGWNARWFYMKQSHPVIHCDVDHVLENQRS*
Ga0182142_10076151	3300015308	Miscanthus Phyllosphere	SKYITVSLNTSLKGWNAWWFYMKQSHTTICCDIDHIPES*
Ga0182142_10308521	3300015308	Miscanthus Phyllosphere	MASEYINVPLNTSLKGWNSKWFYMKQSHPAIRRDVHHIPVNQSS*
Ga0182142_10701761	3300015308	Miscanthus Phyllosphere	MAGEYITVPLNTLLKGWNAKWFYMKQSHPAIRCNVD
Ga0182142_10905741	3300015308	Miscanthus Phyllosphere	MVGEYITVLLNTSLKGWNARWFYMKQTHPAIRYDVDQILENQRTW
Ga0182140_10450723	3300015314	Miscanthus Phyllosphere	MVGEYLTMPLNTSLKGWNAKWFYMKQSHPTVRYDADHIPKRQKS*
Ga0182110_10805762	3300015322	Miscanthus Phyllosphere	MAGEYLTVPLNTSLKGWNTRWFYMKQSHLAIRCDVDHVPEN*
Ga0182129_10469531	3300015323	Miscanthus Phyllosphere	QLRDGMAGEYLTVLLNTSVKGWNARWFYMKQSHPAIRCDADHISES*
Ga0182129_10596332	3300015323	Miscanthus Phyllosphere	GMVGEYLIVLLSTSLKGWNTRWFYMKQRHPVARCNIDHIPKSQKS*
Ga0182129_10612621	3300015323	Miscanthus Phyllosphere	MASEYINVPLNTSLKGWNARWFYIKQSHPIIRCDVHHI
Ga0182109_10856861	3300015342	Miscanthus Phyllosphere	DGMASEYINVPLNTSLKGWNSKWFYMKQSHPTIRYDVHHIPENQRS*
Ga0182109_11397072	3300015342	Miscanthus Phyllosphere	RDGMAGEYLTMPLNTSLKGWNAKWFYMKQSHPTIRCDVDHILES*
Ga0182109_11587291	3300015342	Miscanthus Phyllosphere	MVGEYITVPLNTSLKGWNAMWFYMKQSHPAIRCDVNHIPENQKS*
Ga0182155_10475851	3300015343	Miscanthus Phyllosphere	GEYLTVSLNMSLKVWNTRWVYMKQSHPAMRYDADDILWSQKS*
Ga0182155_10590273	3300015343	Miscanthus Phyllosphere	MADEYITMPPNTSLKGWNARWFYMKQSHPAIRGDMDKVPEN*
Ga0182155_10646503	3300015343	Miscanthus Phyllosphere	MVGEYLTVPVNMSLKGWNARWFYMKQSHPAIHCDADHILESYKS*
Ga0182155_11064143	3300015343	Miscanthus Phyllosphere	MAGEYITVPLNTSLKGWNARWFYMKQSHPAICCDVDHV
Ga0182155_11211992	3300015343	Miscanthus Phyllosphere	MAGEYLTVPLNTSLKGWNARWFYIKQSHPAIRYDADHILESRRS*
Ga0182189_11601332	3300015344	Miscanthus Phyllosphere	MASEYITVLLNTSLKGWNARWFYMKQSHIAIRCDVDHILESQKS*
Ga0182189_12133781	3300015344	Miscanthus Phyllosphere	EYITVTLNTSLKGWNTRWFYMKQSHLTIRCDIDHVPEN*
Ga0182111_10885402	3300015345	Miscanthus Phyllosphere	MAGEYVTVPLNTSLKGWNAKWFYMKQSHPAVCCDADHIPES*
Ga0182111_11298981	3300015345	Miscanthus Phyllosphere	DGMVGEYLTVPLNMSLKGWNARWFYMKQIHPIIRCDGNHIPES*
Ga0182111_11515131	3300015345	Miscanthus Phyllosphere	QLQYGMTSEYINVPLNTSLKGWNSKWFYMKQSHPAIRCDVHHILEN*
Ga0182139_10451093	3300015346	Miscanthus Phyllosphere	IPLNTSLKGWNARWFYMKQSHPTIRFDVDHILEN*
Ga0182139_10947711	3300015346	Miscanthus Phyllosphere	EYINVPLNTSLKGWNARWFYIKQSRPVIRCDVHHILESQSS*
Ga0182139_10972902	3300015346	Miscanthus Phyllosphere	MASEYINIPLNTSLKGWNSRWFYMKQSHPTIRYDVNHISKNVKS*
Ga0182139_11743441	3300015346	Miscanthus Phyllosphere	MAGEYLTMPLNTSLNTSNARWFYMKQSHPAVRYDADHIP*
Ga0182139_12284892	3300015346	Miscanthus Phyllosphere	MASEYITIPLNTSLKGWNVRWFYMKQSHPAIRCDVDHISKS*
Ga0182177_11323532	3300015347	Miscanthus Phyllosphere	QLHDGMVGEYLAMPLNTSLKGWNARWFYMKQSHPAIRCDADHILESQKS*
Ga0182177_11429571	3300015347	Miscanthus Phyllosphere	MVSEYITILLNTSLKGWNTRWFYMKQSHSAICYDVDHIPKS*
Ga0182177_12208342	3300015347	Miscanthus Phyllosphere	INVPLNTSLKGWNARWFYIKQSHPVIRCDIHHIPES*
Ga0182177_12253702	3300015347	Miscanthus Phyllosphere	MAGEYLTVPLNMSLKGWNARWFYMKQSHPTIRCDVDHILES*
Ga0182177_12294922	3300015347	Miscanthus Phyllosphere	MAGGYLTVPLNTSMKGWNVRWFYMKQIHPAIHYDAKHILES*
Ga0182161_11369091	3300015351	Miscanthus Phyllosphere	EYITIPLNTSLKGWNVRWFYLKQSHPAIRSDVDHVPEN*
Ga0182161_11568932	3300015351	Miscanthus Phyllosphere	EYITMPLNTSLKGWTTRWFYMKRSHPAIRYDVDHILEN*
Ga0182161_12595831	3300015351	Miscanthus Phyllosphere	LNTSLKGWNARWFYMKQSHPAIRCDIDQVLENQRS*
Ga0182159_13189532	3300015355	Miscanthus Phyllosphere	HDRMEGEYITVPLNTSLKGWNVRWFYMKQSDSAIHCDIDHIPENQRS*
Ga0182145_10060832	3300015361	Miscanthus Phyllosphere	SEYINVPLNTSLKGWNARWFYIKEQSHPVIRCDVHRIPES*
Ga0182145_10979462	3300015361	Miscanthus Phyllosphere	MVGEYIIVLLNTSLKGWNARWFYMKQSHPAIHCDVD*
Ga0182203_10474582	3300017404	Miscanthus Phyllosphere	MASEYITVLLNTSLKGWNARWFYMKQSHIAIRCDVDHILESQKS
Ga0182220_10655673	3300017407	Miscanthus Phyllosphere	GEYLIMLLNTSLKGWNTRWFYMKQSHPTIRYGADHILESQKS
Ga0182220_10889831	3300017407	Miscanthus Phyllosphere	MYLQLRDGMAGEYLTVLLNTSLKGWNARWFYMKQSHPAIRCDVDHILEN
Ga0182204_10321793	3300017409	Miscanthus Phyllosphere	MAGEYLTVPLNTSLKGWNARWFYMKQSHPAIRYDVDHIPKSQKS
Ga0182204_10670022	3300017409	Miscanthus Phyllosphere	MAGEYVTVPLNTSLKGWNAKWFYMKQSHPAVCCDADHIPES
Ga0182204_11211391	3300017409	Miscanthus Phyllosphere	MTSEYITIPLNTSLKGWNSRWFYMKQSHPTICCDVDHIMKSQKS
Ga0182207_10488702	3300017410	Miscanthus Phyllosphere	MAGEYLTVPRNMPLKGWNTKWFYMKQSHTAIRCDTDHIPES
Ga0182207_10729832	3300017410	Miscanthus Phyllosphere	MAGEYITMSLNTLLKAWNARWFYMKQSHPVVRCGIDQIPENQKS
Ga0182207_11026221	3300017410	Miscanthus Phyllosphere	LQLHDGMAGEYLTMPLNTSLKGWNARWFYMKQSQPAIRCDVDCIPESQKS
Ga0182207_11636781	3300017410	Miscanthus Phyllosphere	MASEYITVSLNTALKGWNARWFYMKQSHPAIRCDVDHVL
Ga0182207_11749482	3300017410	Miscanthus Phyllosphere	DGMEGEYLTVSLNTSLMGWNARWFYIKQSHPAIRYDADHIPKRQKS
Ga0182208_10632882	3300017411	Miscanthus Phyllosphere	MAGEYVTVPLNTSLKGWNARWFYMKQSHPAIRCDVDHIPESQKS
Ga0182208_10678692	3300017411	Miscanthus Phyllosphere	DGMAGEYITVLLNTSLKGWNAMWFYMKQSHPAIRCDADHIPEIQKS
Ga0182222_10716431	3300017413	Miscanthus Phyllosphere	VPLNTSLKGWNARWFYMKQSHPANCRDADHISESKKS
Ga0182202_10333831	3300017415	Miscanthus Phyllosphere	MAGEYITIPLNTSLKGWNARWFYTKQSHPTIRYDVDHIPKN
Ga0182219_10365382	3300017424	Miscanthus Phyllosphere	GMASEYINVPLNTSLKGWNARWFYMKQSHIAIPESQKS
Ga0182219_10437081	3300017424	Miscanthus Phyllosphere	MASKYINVPLNTSLKGWNSKWFYMKQNHPAIRYDVHHIPENQRSW
Ga0182224_10640442	3300017425	Miscanthus Phyllosphere	MVGEYLTVPLNTSLKGWNARWFYMKQSHPAIRCDADHISES
Ga0182224_10700371	3300017425	Miscanthus Phyllosphere	MVSDYITIPLNTSLKGWNARWFYMKQSHIAIRCDVDYIPESQKS
Ga0182190_11001631	3300017427	Miscanthus Phyllosphere	EYITVPLNTSLKGWNARWFYMKQSHPAIRYDVDHILES
Ga0182190_11267412	3300017427	Miscanthus Phyllosphere	MAGEYVTVLLNMSLKGWNVKWFYMKQSHPAIRYDVDHILKS
Ga0182192_10603782	3300017430	Miscanthus Phyllosphere	GMAGEYLTMPLNTSLKGWNGRWFYMKQIHPAVRCNADHILES
Ga0182192_10716082	3300017430	Miscanthus Phyllosphere	VYLQLRDGMAGEDLTVPLNTSLKNWNTRWFYIRQTDPAIRCDPDHIPKNQKS
Ga0182192_11041812	3300017430	Miscanthus Phyllosphere	MASEYITIPLNTSLKGWNDRWFYLKQSHPAIRCDVDHIPKNQKS
Ga0182209_10574112	3300017436	Miscanthus Phyllosphere	MAGEYLTMPLNTSLKGWNVRWFYMKQSHPAIRCNADHIPESQKSWSERPSSTDME
Ga0182209_10702511	3300017436	Miscanthus Phyllosphere	IPLNTSLKGWNARWFYMKQSHCAIYCDVDHVPENQRS
Ga0182209_10744432	3300017436	Miscanthus Phyllosphere	MTGEYIHVPLNTSLKGCNTMWFYMKQSDPAIQCDVDQILENQR
Ga0182209_11406772	3300017436	Miscanthus Phyllosphere	MAGEYLTVPLNTSLKGWNARWFYMRQSHPVVRYDTDHILES
Ga0182191_10312601	3300017438	Miscanthus Phyllosphere	RDRMMSEYITVPLNTSLKGWNARWFYMKQSHPTIRYDVNHISKNVKS
Ga0182221_10698222	3300017442	Miscanthus Phyllosphere	VYLQLRDGMAGEYLTVSLNTLVKGWNGRWFYMKQSHPAICCDANHI
Ga0182221_10848821	3300017442	Miscanthus Phyllosphere	LQLRDGMAGEYLTVPLNTSLKNWNTRWFYMSQSHPAIRCDTDHILEN
Ga0182221_11478462	3300017442	Miscanthus Phyllosphere	MVGGYLTVPLNTSLKGWNARWFYMKQSHPANCRDADHISESKKS
Ga0182218_10484002	3300017683	Miscanthus Phyllosphere	MTSEYITIPLNTSLKGWNTRWFYMKQSHLAIHYDVDHIPESQKSWSEKPSSADME
Ga0182218_10679111	3300017683	Miscanthus Phyllosphere	MASEYITVLLNTLLKGWNARWFYMKQSHPTIRCDADHILESQKS
Ga0182218_11124951	3300017683	Miscanthus Phyllosphere	TVPLNTSLKGWNAKWFYMKQSHIAIRCNVDHILESQKS
Ga0182225_10380011	3300017684	Miscanthus Phyllosphere	LCDGMAGEYLTMPLNTSLKNWNTRWFYMRQSHPAICCDTD
Ga0182225_10783211	3300017684	Miscanthus Phyllosphere	MAGEYITVPLNTSLKGWNVRWFYMKQSYPPIRCDVD
Ga0182225_11184233	3300017684	Miscanthus Phyllosphere	MAGEYLTVPLNTSLKGWNARWFYIKQSHPAVRYDADHIPKS
Ga0182225_11237492	3300017684	Miscanthus Phyllosphere	MASEYISVALNASLKGWNARWFNIKQSHLAIRCDVDHIPESQKS
Ga0182227_10698882	3300017685	Miscanthus Phyllosphere	MAGKYLTVLLNTSLKRWNARWFYMKQSHPAIRCDADHILENQKS
Ga0182227_11149312	3300017685	Miscanthus Phyllosphere	EYITVPLNTSLKGWNARWFYIKQSHPAIRCDAIHIPKSQKS
Ga0182227_11293431	3300017685	Miscanthus Phyllosphere	LQLHDGMEGEYITIPLNTSLKGWNTRWFYMKQSHPAIRCNVDNVSENQRS
Ga0182205_11232642	3300017686	Miscanthus Phyllosphere	AGEYLTVPLNTSVKGWNARWFYMKQSHPAVRCDADHILES
Ga0182231_10292472	3300017689	Miscanthus Phyllosphere	MASEYITISLDTSLKGWNARWFYIKQSHPAIRCDIDHILEN
Ga0182231_10787542	3300017689	Miscanthus Phyllosphere	MASEYINVPLNTSLKGWNARWFYIKQSHPIIRCDIHH

Structure Viewer


Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100	pTM-score: 0.28
Secondary Structure: α-helix β-sheet Coil Turn	pTM-score: 0.28
Powered by PDBe Molstar

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

Metagenome Family F078771

Overview

Multiple Sequence Alignments

Structure & Topology

Predicted Secondary Structure and Topology

Predicted 3D Structure

Low Quality Model:

Gene Neighborhood

Neighboring Pfam domains

Phylogeny

NCBI Taxonomy

Associated Scaffolds

Environmental Properties

Associated Habitat Types

Associated Samples

Family Sequences

Hidden Markov Model


Click on a Sequence Logo column to get its information.
Powered by Skylign