Metagenome Family F079023

Basic Information
Family ID	F079023
Family Type	Metagenome
Number of Sequences	116
Average Sequence Length	42 residues
Representative Sequence	VRGFNVAHASGSGMDWLAVSDVSADVLTAFVQRLARADAAL
Number of Associated Samples	106
Number of Associated Scaffolds	116

Quality Assessment
Transcriptomic Evidence	No
Most common taxonomic group	Bacteria
% of genes with valid RBS motifs	0.00 %
% of genes near scaffold ends (potentially truncated)	98.28 %
% of genes from short scaffolds (< 2000 bps)	95.69 %
Associated GOLD sequencing projects	98
AlphaFold2 3D model prediction	Yes
3D model pTM-score	0.68

Most Common Taxonomy
Group	Bacteria (85.345 % of family members)
NCBI Taxonomy ID	2
Taxonomy	All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere (11.207 % of family members)
Environment Ontology (ENVO)	Unclassified (52.586 % of family members)
Earth Microbiome Project Ontology (EMPO)	Host-associated → Plant → Plant rhizosphere (61.207 % of family members)

Full Alignment
Alignment of all the sequences in the family.

Powered by MSAViewer

Seed Alignment
Alignment of a non-redundant set of sequences, used to build the family's HMM profile.

Powered by MSAViewer

AlphaFold2 Input Alignment
Refined alignment used as input for AlphaFold2.

Powered by MSAViewer

Predicted Topology & Secondary Structure
Classification:	Globular	Signal Peptide:	No	Secondary Structure distribution:	α-helix: 24.64% β-sheet: 20.29% Coil/Unstructured: 55.07%
Feature Viewer

Powered by Feature Viewer

Pfam ID	Name	% Frequency in 116 Family Scaffolds
PF00149	Metallophos	18.10
PF13557	Phenol_MetA_deg	3.45
PF04542	Sigma70_r2	2.59
PF13899	Thioredoxin_7	2.59
PF07690	MFS_1	2.59
PF13473	Cupredoxin_1	2.59
PF03401	TctC	1.72
PF04392	ABC_sub_bind	1.72
PF08281	Sigma70_r4_2	1.72
PF02798	GST_N	1.72
PF00593	TonB_dep_Rec	1.72
PF02530	Porin_2	1.72
PF02627	CMD	0.86
PF00912	Transgly	0.86
PF13561	adh_short_C2	0.86
PF13410	GST_C_2	0.86
PF11937	DUF3455	0.86
PF10605	3HBOH	0.86
PF01740	STAS	0.86
PF00378	ECH_1	0.86
PF13683	rve_3	0.86
PF13511	DUF4124	0.86
PF00116	COX2	0.86
PF13442	Cytochrome_CBB3	0.86
PF03928	HbpS-like	0.86
PF10604	Polyketide_cyc2	0.86
PF02867	Ribonuc_red_lgC	0.86
PF00515	TPR_1	0.86

COG ID	Name	Functional Category	% Frequency in 116 Family Scaffolds
COG0568	DNA-directed RNA polymerase, sigma subunit (sigma70/sigma32)	Transcription [K]	2.59
COG1191	DNA-directed RNA polymerase specialized sigma subunit	Transcription [K]	2.59
COG1595	DNA-directed RNA polymerase specialized sigma subunit, sigma24 family	Transcription [K]	2.59
COG4941	Predicted RNA polymerase sigma factor, contains C-terminal TPR domain	Transcription [K]	2.59
COG2984	ABC-type uncharacterized transport system, periplasmic component	General function prediction only [R]	1.72
COG3181	Tripartite-type tricarboxylate transporter, extracytoplasmic receptor component TctC	Energy production and conversion [C]	1.72
COG3637	Opacity protein LomR and related surface antigens	Cell wall/membrane/envelope biogenesis [M]	1.72
COG0209	Ribonucleotide reductase alpha subunit	Nucleotide transport and metabolism [F]	0.86
COG0599	Uncharacterized conserved protein YurZ, alkylhydroperoxidase/carboxymuconolactone decarboxylase family	General function prediction only [R]	0.86
COG0744	Penicillin-binding protein 1B/1F, peptidoglycan transglycosylase/transpeptidase	Cell wall/membrane/envelope biogenesis [M]	0.86
COG1622	Heme/copper-type cytochrome/quinol oxidase, subunit 2	Energy production and conversion [C]	0.86
COG2128	Alkylhydroperoxidase family enzyme, contains CxxC motif	Inorganic ion transport and metabolism [P]	0.86
COG4263	Nitrous oxide reductase	Inorganic ion transport and metabolism [P]	0.86
COG4953	Membrane carboxypeptidase/penicillin-binding protein PbpC	Cell wall/membrane/envelope biogenesis [M]	0.86
COG5009	Membrane carboxypeptidase/penicillin-binding protein	Cell wall/membrane/envelope biogenesis [M]	0.86

NCBI Taxonomy

Select NCBI taxonomy Level:

Name	Rank	Taxonomy	Distribution
All Organisms	root	All Organisms	85.34 %
Unclassified	root	N/A	14.66 %

Name	Rank	Taxonomy	Distribution
cellular organisms	root	All Organisms → cellular organisms	85.34 %
Unclassified	root	N/A	14.66 %

Name	Rank	Taxonomy	Distribution
Bacteria	superkingdom	All Organisms → cellular organisms → Bacteria	85.34 %
Unclassified	root	N/A	14.66 %

Name	Rank	Taxonomy	Distribution
Proteobacteria	phylum	All Organisms → cellular organisms → Bacteria → Proteobacteria	56.03 %
Unclassified	root	N/A	14.66 %
Acidobacteria	phylum	All Organisms → cellular organisms → Bacteria → Acidobacteria	1.72 %
PVC group	clade	All Organisms → cellular organisms → Bacteria → PVC group	0.86 %
Bacteria incertae sedis	no rank	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis	0.86 %

Name	Rank	Taxonomy	Distribution
Betaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	37.07 %
Unclassified	root	N/A	14.66 %
Alphaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	1.72 %
Bacteria candidate phyla	clade	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla	0.86 %
Gammaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	0.86 %
Planctomycetes	phylum	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes	0.86 %
Acidobacteriia	class	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia	0.86 %
unclassified Acidobacteria	no rank	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria	0.86 %

Name	Rank	Taxonomy	Distribution
unclassified Betaproteobacteria	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria	25.00 %
Unclassified	root	N/A	14.66 %
Burkholderiales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales	6.90 %
Candidatus Rokubacteria	phylum	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria	0.86 %
Acidobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	0.86 %
Hyphomicrobiales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	0.86 %
Xanthomonadales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales	0.86 %
Planctomycetia	class	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia	0.86 %
Acidobacteriales	order	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales	0.86 %

Name	Rank	Taxonomy	Distribution
Betaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	25.00 %
Unclassified	root	N/A	14.66 %
Burkholderiales genera incertae sedis	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiales genera incertae sedis	1.72 %
Burkholderiaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae	1.72 %
Rhodanobacteraceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Rhodanobacteraceae	0.86 %
Pirellulales	order	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Pirellulales	0.86 %
Acidobacteriaceae	family	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae	0.86 %
unclassified Candidatus Rokubacteria	no rank	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria	0.86 %
Acidobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	0.86 %
Hyphomicrobiales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	0.86 %

Name	Rank	Taxonomy	Distribution
Betaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	25.00 %
Unclassified	root	N/A	14.66 %
Methylibium	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiales genera incertae sedis → Methylibium	1.72 %
Burkholderiaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae	1.72 %
Lacipirellulaceae	family	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Pirellulales → Lacipirellulaceae	0.86 %
Silvibacterium	genus	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Silvibacterium	0.86 %
Candidatus Rokubacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	0.86 %
Rudaea	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Rhodanobacteraceae → Rudaea	0.86 %
Acidobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	0.86 %
Hyphomicrobiales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	0.86 %

Name	Rank	Taxonomy	Distribution
Betaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	25.00 %
Unclassified	root	N/A	14.66 %
Burkholderiaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae	1.72 %
unclassified Methylibium	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiales genera incertae sedis → Methylibium → unclassified Methylibium	0.86 %
Silvibacterium bohemicum	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Silvibacterium → Silvibacterium bohemicum	0.86 %
Rudaea cellulosilytica	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Rhodanobacteraceae → Rudaea → Rudaea cellulosilytica	0.86 %
Lacipirellulaceae	family	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Pirellulales → Lacipirellulaceae	0.86 %
Candidatus Rokubacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	0.86 %
Acidobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	0.86 %
Hyphomicrobiales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	0.86 %

Name	Rank	Taxonomy	Distribution
Betaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	25.00 %
Unclassified	root	N/A	14.66 %
Burkholderiaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae	1.72 %
Methylibium sp. YR605	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiales genera incertae sedis → Methylibium → unclassified Methylibium → Methylibium sp. YR605	0.86 %
Silvibacterium bohemicum	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Silvibacterium → Silvibacterium bohemicum	0.86 %
Rudaea cellulosilytica	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Rhodanobacteraceae → Rudaea → Rudaea cellulosilytica	0.86 %
Lacipirellulaceae	family	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Pirellulales → Lacipirellulaceae	0.86 %
Candidatus Rokubacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	0.86 %
Acidobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	0.86 %
Hyphomicrobiales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	0.86 %

Visualization

Powered by ApexCharts

Associated Scaffolds

Scaffold	Taxonomy	Length	IMG/M Link
2199352024\|deeps__Contig_179531	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	593	Open in IMG/M
3300001991\|JGI24743J22301_10066284	All Organisms → cellular organisms → Bacteria	749	Open in IMG/M
3300004092\|Ga0062389_104553804	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae	522	Open in IMG/M
3300005181\|Ga0066678_11112158	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	508	Open in IMG/M
3300005327\|Ga0070658_11194511	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales	661	Open in IMG/M
3300005328\|Ga0070676_10397783	All Organisms → cellular organisms → Bacteria → Proteobacteria	958	Open in IMG/M
3300005329\|Ga0070683_100366272	All Organisms → cellular organisms → Bacteria	1372	Open in IMG/M
3300005330\|Ga0070690_101247844	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiales genera incertae sedis → Methylibium → unclassified Methylibium → Methylibium sp. YR605	594	Open in IMG/M
3300005335\|Ga0070666_10329068	All Organisms → cellular organisms → Bacteria → Proteobacteria	1091	Open in IMG/M
3300005338\|Ga0068868_100147742	All Organisms → cellular organisms → Bacteria → Proteobacteria	1934	Open in IMG/M
3300005344\|Ga0070661_101388299	All Organisms → cellular organisms → Bacteria	591	Open in IMG/M
3300005353\|Ga0070669_100747580	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	828	Open in IMG/M
3300005354\|Ga0070675_101705707	All Organisms → cellular organisms → Bacteria	581	Open in IMG/M
3300005435\|Ga0070714_102461361	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	505	Open in IMG/M
3300005438\|Ga0070701_10754433	Not Available	659	Open in IMG/M
3300005439\|Ga0070711_100874998	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	766	Open in IMG/M
3300005457\|Ga0070662_100924552	All Organisms → cellular organisms → Bacteria	745	Open in IMG/M
3300005468\|Ga0070707_101686188	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	601	Open in IMG/M
3300005529\|Ga0070741_11761906	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales	502	Open in IMG/M
3300005536\|Ga0070697_100675505	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	910	Open in IMG/M
3300005563\|Ga0068855_102240068	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales	548	Open in IMG/M
3300005563\|Ga0068855_102486223	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	515	Open in IMG/M
3300005564\|Ga0070664_101360734	All Organisms → cellular organisms → Bacteria → Proteobacteria	671	Open in IMG/M
3300005578\|Ga0068854_101823591	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	558	Open in IMG/M
3300005614\|Ga0068856_100683945	All Organisms → cellular organisms → Bacteria	1046	Open in IMG/M
3300005616\|Ga0068852_100486587	All Organisms → cellular organisms → Bacteria	1227	Open in IMG/M
3300005834\|Ga0068851_10704746	All Organisms → cellular organisms → Bacteria	621	Open in IMG/M
3300005840\|Ga0068870_10413290	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	881	Open in IMG/M
3300005841\|Ga0068863_101690084	All Organisms → cellular organisms → Bacteria → Proteobacteria	642	Open in IMG/M
3300005842\|Ga0068858_102431250	All Organisms → cellular organisms → Bacteria → Proteobacteria	518	Open in IMG/M
3300005843\|Ga0068860_102267886	Not Available	563	Open in IMG/M
3300006031\|Ga0066651_10123822	All Organisms → cellular organisms → Bacteria → Proteobacteria	1330	Open in IMG/M
3300006050\|Ga0075028_100786729	Not Available	579	Open in IMG/M
3300006175\|Ga0070712_100740557	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	840	Open in IMG/M
3300006358\|Ga0068871_100207626	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	1693	Open in IMG/M
3300006755\|Ga0079222_10836759	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiales genera incertae sedis → Methylibium	759	Open in IMG/M
3300006804\|Ga0079221_10017666	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales	2852	Open in IMG/M
3300006852\|Ga0075433_11762264	All Organisms → cellular organisms → Bacteria → Proteobacteria	533	Open in IMG/M
3300006904\|Ga0075424_100702602	All Organisms → cellular organisms → Bacteria	1080	Open in IMG/M
3300009012\|Ga0066710_103551584	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	589	Open in IMG/M
3300009098\|Ga0105245_11687061	All Organisms → cellular organisms → Bacteria	686	Open in IMG/M
3300009156\|Ga0111538_11020467	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Pirellulales → Lacipirellulaceae	1046	Open in IMG/M
3300009177\|Ga0105248_10684530	All Organisms → cellular organisms → Bacteria	1157	Open in IMG/M
3300009545\|Ga0105237_10293842	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Rhodanobacteraceae → Rudaea → Rudaea cellulosilytica	1627	Open in IMG/M
3300009545\|Ga0105237_11931698	All Organisms → cellular organisms → Bacteria	598	Open in IMG/M
3300010396\|Ga0134126_11914177	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	649	Open in IMG/M
3300010397\|Ga0134124_11260789	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	761	Open in IMG/M
3300010399\|Ga0134127_10282734	Not Available	1589	Open in IMG/M
3300010401\|Ga0134121_12559235	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	553	Open in IMG/M
3300010403\|Ga0134123_10092642	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	2385	Open in IMG/M
3300011119\|Ga0105246_10712470	Not Available	881	Open in IMG/M
3300011119\|Ga0105246_12592209	Not Available	501	Open in IMG/M
3300012200\|Ga0137382_10109138	All Organisms → cellular organisms → Bacteria → Proteobacteria	1836	Open in IMG/M
3300012203\|Ga0137399_10526707	All Organisms → cellular organisms → Bacteria	992	Open in IMG/M
3300012206\|Ga0137380_10711026	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	872	Open in IMG/M
3300012207\|Ga0137381_10375505	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	1239	Open in IMG/M
3300012285\|Ga0137370_10801928	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	584	Open in IMG/M
3300012354\|Ga0137366_10431737	Not Available	957	Open in IMG/M
3300012917\|Ga0137395_10834624	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	668	Open in IMG/M
3300012923\|Ga0137359_10299155	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	1433	Open in IMG/M
3300012955\|Ga0164298_11021987	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	612	Open in IMG/M
3300013100\|Ga0157373_11120833	All Organisms → cellular organisms → Bacteria	591	Open in IMG/M
3300013308\|Ga0157375_12524828	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	614	Open in IMG/M
3300014154\|Ga0134075_10420639	Not Available	592	Open in IMG/M
3300014325\|Ga0163163_12555177	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	568	Open in IMG/M
3300014326\|Ga0157380_12349814	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	598	Open in IMG/M
3300014745\|Ga0157377_11092121	All Organisms → cellular organisms → Bacteria → Proteobacteria	611	Open in IMG/M
3300015090\|Ga0167634_1031241	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	759	Open in IMG/M
3300018062\|Ga0187784_10783186	Not Available	761	Open in IMG/M
3300018433\|Ga0066667_11522040	Not Available	592	Open in IMG/M
3300018468\|Ga0066662_10564003	All Organisms → cellular organisms → Bacteria	1056	Open in IMG/M
3300018482\|Ga0066669_10092908	All Organisms → cellular organisms → Bacteria → Proteobacteria	2070	Open in IMG/M
3300018482\|Ga0066669_12288652	Not Available	515	Open in IMG/M
3300019356\|Ga0173481_10596319	All Organisms → cellular organisms → Bacteria	580	Open in IMG/M
3300019789\|Ga0137408_1301817	All Organisms → cellular organisms → Bacteria → Proteobacteria	1717	Open in IMG/M
3300019879\|Ga0193723_1032954	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	1556	Open in IMG/M
3300020583\|Ga0210401_11265174	All Organisms → cellular organisms → Bacteria → Proteobacteria	596	Open in IMG/M
3300022756\|Ga0222622_10551510	All Organisms → cellular organisms → Bacteria	828	Open in IMG/M
3300022756\|Ga0222622_10789589	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	693	Open in IMG/M
3300025898\|Ga0207692_11066495	All Organisms → cellular organisms → Bacteria → Proteobacteria	535	Open in IMG/M
3300025909\|Ga0207705_10549831	Not Available	897	Open in IMG/M
3300025912\|Ga0207707_10341219	All Organisms → cellular organisms → Bacteria → Proteobacteria	1292	Open in IMG/M
3300025920\|Ga0207649_10385771	All Organisms → cellular organisms → Bacteria	1045	Open in IMG/M
3300025920\|Ga0207649_10789244	All Organisms → cellular organisms → Bacteria	741	Open in IMG/M
3300025927\|Ga0207687_11964034	All Organisms → cellular organisms → Bacteria	500	Open in IMG/M
3300025940\|Ga0207691_11681521	All Organisms → cellular organisms → Bacteria	514	Open in IMG/M
3300025941\|Ga0207711_10566741	All Organisms → cellular organisms → Bacteria	1059	Open in IMG/M
3300025949\|Ga0207667_10136522	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae	2525	Open in IMG/M
3300025949\|Ga0207667_10850974	All Organisms → cellular organisms → Bacteria	906	Open in IMG/M
3300025960\|Ga0207651_11127931	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	703	Open in IMG/M
3300025981\|Ga0207640_11006453	Not Available	733	Open in IMG/M
3300025986\|Ga0207658_10646668	All Organisms → cellular organisms → Bacteria → Proteobacteria	953	Open in IMG/M
3300026023\|Ga0207677_10341749	All Organisms → cellular organisms → Bacteria → Proteobacteria	1251	Open in IMG/M
3300026041\|Ga0207639_10176343	All Organisms → cellular organisms → Bacteria → Proteobacteria	1815	Open in IMG/M
3300026078\|Ga0207702_12298878	All Organisms → cellular organisms → Bacteria	527	Open in IMG/M
3300026116\|Ga0207674_10267927	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	1655	Open in IMG/M
3300026116\|Ga0207674_10715770	All Organisms → cellular organisms → Bacteria	966	Open in IMG/M
3300026548\|Ga0209161_10339332	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	681	Open in IMG/M
3300027727\|Ga0209328_10271483	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	504	Open in IMG/M
3300028379\|Ga0268266_11112037	All Organisms → cellular organisms → Bacteria	764	Open in IMG/M
3300028587\|Ga0247828_11237221	All Organisms → cellular organisms → Bacteria	502	Open in IMG/M
3300028799\|Ga0307284_10306813	Not Available	638	Open in IMG/M
3300028812\|Ga0247825_10932288	All Organisms → cellular organisms → Bacteria	630	Open in IMG/M
3300028906\|Ga0308309_10899792	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	768	Open in IMG/M
3300031231\|Ga0170824_110320243	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	759	Open in IMG/M
3300031545\|Ga0318541_10505392	Not Available	676	Open in IMG/M
3300031548\|Ga0307408_100056663	All Organisms → cellular organisms → Bacteria → Proteobacteria	2842	Open in IMG/M
3300031720\|Ga0307469_10130517	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Silvibacterium → Silvibacterium bohemicum	1839	Open in IMG/M
3300031740\|Ga0307468_100540853	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	935	Open in IMG/M
3300031908\|Ga0310900_10927689	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	712	Open in IMG/M
3300032013\|Ga0310906_11283749	All Organisms → cellular organisms → Bacteria	534	Open in IMG/M
3300032174\|Ga0307470_11215328	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	613	Open in IMG/M
3300032180\|Ga0307471_100449259	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	1428	Open in IMG/M
3300032180\|Ga0307471_100693371	Not Available	1183	Open in IMG/M
3300032180\|Ga0307471_103209139	Not Available	580	Open in IMG/M
3300032211\|Ga0310896_10089996	All Organisms → cellular organisms → Bacteria	1350	Open in IMG/M

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:

Habitat	Taxonomy	Distribution
Environmental	Environmental	54.31%
Host-Associated	Host-Associated	45.69%

Habitat	Taxonomy	Distribution
Terrestrial	Environmental → Terrestrial	50.86%
Plants	Host-Associated → Plants	45.69%
Aquatic	Environmental → Aquatic	3.45%

Habitat	Taxonomy	Distribution
Soil	Environmental → Terrestrial → Soil	50.86%
Rhizosphere	Host-Associated → Plants → Rhizosphere	26.72%
Rhizoplane	Host-Associated → Plants → Rhizoplane	17.24%
Sediment	Environmental → Aquatic → Sediment	2.59%
Roots	Host-Associated → Plants → Roots	1.72%
Freshwater	Environmental → Aquatic → Freshwater	0.86%

Habitat	Taxonomy	Distribution
Unclassified	Environmental → Terrestrial → Soil → Unclassified	39.66%
Epiphytes	Host-Associated → Plants → Rhizoplane → Epiphytes	17.24%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified	13.79%
Soil	Host-Associated → Plants → Rhizosphere → Soil	12.93%
Loam	Environmental → Terrestrial → Soil → Loam	10.34%
Unclassified	Environmental → Aquatic → Sediment → Unclassified	2.59%
Rhizosphere	Host-Associated → Plants → Roots → Rhizosphere	1.72%
Wetlands	Environmental → Aquatic → Freshwater → Wetlands	0.86%
Wetlands	Environmental → Terrestrial → Soil → Wetlands	0.86%

Habitat	Taxonomy	Distribution
Unclassified	Environmental → Terrestrial → Soil → Unclassified → Unclassified	18.97%
Unclassified	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified	17.24%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified	13.79%
Unclassified	Host-Associated → Plants → Rhizosphere → Soil → Unclassified	12.93%
Agricultural Soil	Environmental → Terrestrial → Soil → Loam → Agricultural Soil	8.62%
Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil	7.76%
Grasslands	Environmental → Terrestrial → Soil → Unclassified → Grasslands	6.90%
Agricultural	Environmental → Terrestrial → Soil → Unclassified → Agricultural	4.31%
Unclassified	Environmental → Aquatic → Sediment → Unclassified → Unclassified	2.59%
Agricultural Land	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land	1.72%
Forest Soil	Environmental → Terrestrial → Soil → Loam → Forest Soil	1.72%
Soil	Host-Associated → Plants → Roots → Rhizosphere → Soil	1.72%
Bog	Environmental → Aquatic → Freshwater → Wetlands → Bog	0.86%
Unclassified	Environmental → Terrestrial → Soil → Wetlands → Unclassified	0.86%

Habitat	Taxonomy	Distribution
Corn Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere	11.21%
Vadose Zone Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil	7.76%
Corn Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere	6.03%
Hardwood Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil	5.17%
Corn, Switchgrass And Miscanthus Rhizosphere	Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere	5.17%
Terrestrial Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil	4.31%
Grasslands Soil	Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil	4.31%
Soil	Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil	4.31%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere	4.31%
Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil	3.45%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere	3.45%
Soil	Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil	2.59%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere	2.59%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere	2.59%
Populus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere	2.59%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere	2.59%
Groundwater Sediment	Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment	1.72%
Agricultural Soil	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil	1.72%
Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil	1.72%
Corn Rhizosphere	Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere	1.72%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere	1.72%
Corn Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere	1.72%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere	1.72%
Bog Forest Soil	Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil	0.86%
Watersheds	Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds	0.86%
Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil	0.86%
Glacier Forefield Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soil	0.86%
Grasslands Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil	0.86%
Surface Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil	0.86%
Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil	0.86%
Tropical Peatland	Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland	0.86%
Forest Soil	Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil	0.86%
Soil	Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil	0.86%
Switchgrass Rhizosphere	Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere	0.86%
Agricultural Soil	Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil	0.86%
Corn, Switchgrass And Miscanthus Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere	0.86%
Miscanthus Rhizosphere	Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere	0.86%
Switchgrass Rhizosphere	Host-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere	0.86%
Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere	0.86%
Corn Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere	0.86%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere	0.86%

Visualization

Powered by ApexCharts

Associated Samples

Taxon OID	Sample Name	Habitat Type	IMG/M Link
2199352024	Bare-fallow DEEP SOIL	Environmental	Open in IMG/M
3300001991	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2	Host-Associated	Open in IMG/M
3300004092	Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3, ECP14_OM1, ECP14_OM2, ECP14_OM3	Environmental	Open in IMG/M
3300005181	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_127	Environmental	Open in IMG/M
3300005327	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG	Host-Associated	Open in IMG/M
3300005328	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG	Host-Associated	Open in IMG/M
3300005329	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG	Environmental	Open in IMG/M
3300005330	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG	Environmental	Open in IMG/M
3300005335	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG	Host-Associated	Open in IMG/M
3300005338	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2	Host-Associated	Open in IMG/M
3300005344	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG	Host-Associated	Open in IMG/M
3300005353	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG	Host-Associated	Open in IMG/M
3300005354	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG	Host-Associated	Open in IMG/M
3300005435	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG	Environmental	Open in IMG/M
3300005438	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG	Environmental	Open in IMG/M
3300005439	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG	Environmental	Open in IMG/M
3300005457	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG	Host-Associated	Open in IMG/M
3300005468	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG	Environmental	Open in IMG/M
3300005529	Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen16_06102014_R1	Environmental	Open in IMG/M
3300005536	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG	Environmental	Open in IMG/M
3300005563	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2	Host-Associated	Open in IMG/M
3300005564	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG	Host-Associated	Open in IMG/M
3300005578	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2	Host-Associated	Open in IMG/M
3300005614	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2	Host-Associated	Open in IMG/M
3300005616	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2	Host-Associated	Open in IMG/M
3300005834	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2	Host-Associated	Open in IMG/M
3300005840	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2	Host-Associated	Open in IMG/M
3300005841	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2	Host-Associated	Open in IMG/M
3300005842	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2	Host-Associated	Open in IMG/M
3300005843	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2	Host-Associated	Open in IMG/M
3300006031	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Angelo_100	Environmental	Open in IMG/M
3300006050	Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2014	Environmental	Open in IMG/M
3300006175	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG	Environmental	Open in IMG/M
3300006358	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2	Host-Associated	Open in IMG/M
3300006755	Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter	Environmental	Open in IMG/M
3300006804	Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200	Environmental	Open in IMG/M
3300006852	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2	Host-Associated	Open in IMG/M
3300006904	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3	Host-Associated	Open in IMG/M
3300009012	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159	Environmental	Open in IMG/M
3300009098	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG	Host-Associated	Open in IMG/M
3300009156	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2)	Host-Associated	Open in IMG/M
3300009177	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG	Host-Associated	Open in IMG/M
3300009545	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG	Host-Associated	Open in IMG/M
3300010396	Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2	Environmental	Open in IMG/M
3300010397	Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4	Environmental	Open in IMG/M
3300010399	Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3	Environmental	Open in IMG/M
3300010401	Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1	Environmental	Open in IMG/M
3300010403	Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3	Environmental	Open in IMG/M
3300011119	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG	Host-Associated	Open in IMG/M
3300012200	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaG	Environmental	Open in IMG/M
3300012203	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG	Environmental	Open in IMG/M
3300012206	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaG	Environmental	Open in IMG/M
3300012207	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaG	Environmental	Open in IMG/M
3300012285	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_20_16 metaG	Environmental	Open in IMG/M
3300012354	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_60_16 metaG	Environmental	Open in IMG/M
3300012917	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaG	Environmental	Open in IMG/M
3300012923	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaG	Environmental	Open in IMG/M
3300012955	Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_216_MG	Environmental	Open in IMG/M
3300013100	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG	Host-Associated	Open in IMG/M
3300013308	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG	Host-Associated	Open in IMG/M
3300014154	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09212015	Environmental	Open in IMG/M
3300014325	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG	Host-Associated	Open in IMG/M
3300014326	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG	Host-Associated	Open in IMG/M
3300014745	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG	Host-Associated	Open in IMG/M
3300015090	Arctic soil microbial communities from a glacier forefield, Russell Glacier, Kangerlussuaq, Greenland (Sample G5A, Northern proglacial tributary margin, adjacent to top of river)	Environmental	Open in IMG/M
3300018062	Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP15_20_MG	Environmental	Open in IMG/M
3300018433	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116	Environmental	Open in IMG/M
3300018468	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111	Environmental	Open in IMG/M
3300018482	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118	Environmental	Open in IMG/M
3300019356	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S073-202C-2 (version 2)	Environmental	Open in IMG/M
3300019789	Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (PacBio error correction)	Environmental	Open in IMG/M
3300019879	Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2m2	Environmental	Open in IMG/M
3300020583	Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-M	Environmental	Open in IMG/M
3300022756	Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5_b1	Environmental	Open in IMG/M
3300025898	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes)	Environmental	Open in IMG/M
3300025909	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025912	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes)	Environmental	Open in IMG/M
3300025920	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025927	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025940	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025941	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025949	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes)	Host-Associated	Open in IMG/M
3300025960	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025981	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes)	Host-Associated	Open in IMG/M
3300025986	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300026023	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes)	Host-Associated	Open in IMG/M
3300026041	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes)	Host-Associated	Open in IMG/M
3300026078	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes)	Host-Associated	Open in IMG/M
3300026116	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes)	Host-Associated	Open in IMG/M
3300026548	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 (SPAdes)	Environmental	Open in IMG/M
3300027727	Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM3H0_M1 (SPAdes)	Environmental	Open in IMG/M
3300028379	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300028587	Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day3	Environmental	Open in IMG/M
3300028799	Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_123	Environmental	Open in IMG/M
3300028812	Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Vanillin_Day48	Environmental	Open in IMG/M
3300028906	Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2)	Environmental	Open in IMG/M
3300031231	Coassembly Site 11 (all samples) - Champenoux / Amance forest	Environmental	Open in IMG/M
3300031545	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f26	Environmental	Open in IMG/M
3300031548	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3	Host-Associated	Open in IMG/M
3300031720	Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515	Environmental	Open in IMG/M
3300031740	Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05	Environmental	Open in IMG/M
3300031908	Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24D1	Environmental	Open in IMG/M
3300032013	Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D3	Environmental	Open in IMG/M
3300032174	Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05	Environmental	Open in IMG/M
3300032180	Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515	Environmental	Open in IMG/M
3300032211	Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8D1	Environmental	Open in IMG/M

Geographical Distribution

Zoom:	Powered by OpenStreetMap

Structure Viewer


Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100	pTM-score: 0.68
Secondary Structure: α-helix β-sheet Coil Turn	pTM-score: 0.68
Powered by PDBe Molstar

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

Metagenome Family F079023

Overview

Multiple Sequence Alignments

Structure & Topology

Predicted Secondary Structure and Topology

Predicted 3D Structure

Low Quality Model:

Gene Neighborhood

Neighboring Pfam domains

Neighboring Clusters of Orthologous Genes (COGs)

Phylogeny

NCBI Taxonomy

Associated Scaffolds

Environmental Properties

Associated Habitat Types

Associated Samples

Family Sequences

Protein ID	Sample Taxon ID	Habitat	Sequence
deeps_03354000	2199352024	Soil	VRPESEHGTPSTLRTIRGFNVAHASGFGMDWLAVSDINAGELADFVGKVARESGP
JGI24743J22301_100662841	3300001991	Corn, Switchgrass And Miscanthus Rhizosphere	ALRTVRGFNVAHATGSGMDWLAVSDLSSGELTSLVQRLARDDSMAKP*
Ga0062389_1045538042	3300004092	Bog Forest Soil	LTTQRGFNVAHAKGAAMEWWGVSDVSVDVLSALVARLARGE*
Ga0066678_111121582	3300005181	Soil	PTPSSRTTIRGFNVAHAAGVGMDWWAVSDASPEVVNALVNRLARGDSPN*
Ga0070658_111945111	3300005327	Corn Rhizosphere	VRGFHVAHARGGGMEWLAVSDASAPVLMSFVQRLAAEAAAP*
Ga0070676_103977831	3300005328	Miscanthus Rhizosphere	PMTLRTVRGFNVVHATGSGMEWIAVSDVNADELTEFVQRLARQSATP*
Ga0070683_1003662721	3300005329	Corn Rhizosphere	TVRGFNVAHATGSGMDWLAVSDLSSGELTSLVQRLARDDSMAKP*
Ga0070690_1012478441	3300005330	Switchgrass Rhizosphere	PAPMTLRTVRGFNVVHATGSGMEWIAVSDVNADELTEFVQRLARQSATP*
Ga0070666_103290681	3300005335	Switchgrass Rhizosphere	LRTVRGINVAHASGSGMDWLAVSDVSRDVLASFVQQLARSDTR*
Ga0068868_1001477421	3300005338	Miscanthus Rhizosphere	ALPTVRGFNVAHATGAGMDWIAVSDVSGDVLNAFLQKLAGEPAKN*
Ga0070661_1013882991	3300005344	Corn Rhizosphere	RTIRGINVAHASGAQMDWLAVSDVSSDVLGSFVQSLARGGATQ*
Ga0070669_1007475802	3300005353	Switchgrass Rhizosphere	PALRTVRGFNVARANGSGMDWLAVSDVSADVLSAFVQRLARADTSP*
Ga0070675_1017057072	3300005354	Miscanthus Rhizosphere	TVRGFNVAHASGSGMEWLAVSDVSPEVLDTFVEQFTRVSSVP*
Ga0070714_1024613611	3300005435	Agricultural Soil	VRGFNVAHATGSGMDWLAVSDVNPDELTEFARKLAREAGAP*
Ga0070701_107544331	3300005438	Corn, Switchgrass And Miscanthus Rhizosphere	ALPTVRGFNVAHATGAGMDWIAVSDVSADVLNAFVQQLAGEAAKN*
Ga0070711_1008749982	3300005439	Corn, Switchgrass And Miscanthus Rhizosphere	TVRGFNVVHATGSGMDWIAVSDVNADELTEFVQRLARQSATP*
Ga0070662_1009245521	3300005457	Corn Rhizosphere	GINVAHASGAQMDWLAVSDVSPDVLSAFVESLARGNPTQ*
Ga0070707_1016861882	3300005468	Corn, Switchgrass And Miscanthus Rhizosphere	ALRTVRGFNVAHATGSGMDWLAVSDVNPDELTEFARKLAREAGAP*
Ga0070741_117619061	3300005529	Surface Soil	MPLRTLRGFNIAHARGADMDWLAVSDVSADVLVPFVEALAAAR*
Ga0070697_1006755051	3300005536	Corn, Switchgrass And Miscanthus Rhizosphere	PMPELRTVRGFNVAHASGPSMDWLAVSDAEPAVLSAFVQRLAREDSSR*
Ga0068855_1022400682	3300005563	Corn Rhizosphere	RTVRGFNVVHAVGSGMDWLAVSDLNAAELSRFVDKLKE*
Ga0068855_1024862231	3300005563	Corn Rhizosphere	NVVHATGSGMDWIAVSDVNADELTEFVQRLARQSATP*
Ga0070664_1013607341	3300005564	Corn Rhizosphere	PALRTVRGFNVAHASGSGMDWLAVSDVSPDVLSPFVQRLARAEASPR*
Ga0068854_1018235911	3300005578	Corn Rhizosphere	RGFNVAHATGSGMDWLAVSDVEPGILAEFVLRLARPDASP*
Ga0068856_1006839451	3300005614	Corn Rhizosphere	VPATGRSMEWLAVSDAEPAAVAALVQRLAREEGAP*
Ga0068852_1004865873	3300005616	Corn Rhizosphere	VAHARGGGMEWLAVSDAGAPVLASFVQRLAAEAAAP*
Ga0068851_107047461	3300005834	Corn Rhizosphere	AHATGSGMDWLAVSDLSAGELTSLVQRLAREDSMPKP*
Ga0068870_104132902	3300005840	Miscanthus Rhizosphere	HATGSGMDWIAVSDVSADELTQFVQRLAQQTATP*
Ga0068863_1016900843	3300005841	Switchgrass Rhizosphere	ALRTVRGFNVAHASGSGMDWLAVSDVSPDVLSPFVQRLARAEASPR*
Ga0068858_1024312503	3300005842	Switchgrass Rhizosphere	TVRGFNVAHASGSGMDWLAVSDVSPDVLSPFVQRLARAEASPR*
Ga0068860_1022678863	3300005843	Switchgrass Rhizosphere	VRGFNVAHATGAGMDWIAVSDVSADVLNAFVQQLAGEAAKN*
Ga0066651_101238223	3300006031	Soil	PTALRTVRGFNVAHATGSGMDWLGVSDVSADVLTAFVQRLAREDATPKP*
Ga0075028_1007867291	3300006050	Watersheds	SALRTVRGFNVARASGPSMDWLAVSDADAAALSAFVQRLAREDISQ*
Ga0070712_1007405572	3300006175	Corn, Switchgrass And Miscanthus Rhizosphere	VHATGSGMDWIAVSDVNADELTEFVQRLARQSATP*
Ga0068871_1002076263	3300006358	Miscanthus Rhizosphere	HATGSGMDWLAVSDVSADVLSSFVQRLAHPATSP*
Ga0079222_108367592	3300006755	Agricultural Soil	TIRGFNVAHATGSGMDWLAVSDVNADELTGFVQKLARESGMP*
Ga0079221_100176663	3300006804	Agricultural Soil	PSALRTIRGFNVAHATGSGMDWLAVSDVNADELTGFVQKLARESGMP*
Ga0075433_117622641	3300006852	Populus Rhizosphere	PPPELRTVRGFNVARASGPSMDWLAVSDAEPAVLSAFVQRLAREDIAQ*
Ga0075424_1007026021	3300006904	Populus Rhizosphere	TVRGFNVARASGPTMDWLAVSDAEPAVLSAFVQRLAREDISQ*
Ga0066710_1035515841	3300009012	Grasslands Soil	GFNVAHATGAGMEWWGVSDVSADVLQLLVARLAQGE
Ga0105245_116870612	3300009098	Miscanthus Rhizosphere	FNVAHATGSGMDWLAVSDLSSGELTSLVQRLARDDSMAKP*
Ga0111538_110204671	3300009156	Populus Rhizosphere	VRGFNVAPATGSGMDWLAVSDVSADVLTAFVQRLARADAAP*
Ga0105248_106845302	3300009177	Switchgrass Rhizosphere	FNVAHATGAGMDWIAVSDVSADVLNAFVQQLAGEAAKN*
Ga0105237_102938423	3300009545	Corn Rhizosphere	ALRTVRGFNVAHATGSGMDWLAVSDVSADVLTAFVQRLAREDATTKP*
Ga0105237_119316981	3300009545	Corn Rhizosphere	HATGSGMDWLAVSDVSAGELTSLVQRLAREDALPKR*
Ga0134126_119141772	3300010396	Terrestrial Soil	PMTLRTVRGFNVVHATGSGMDWIAVSDVNADELTEFVQRLARQSATP*
Ga0134124_112607892	3300010397	Terrestrial Soil	GFNVAHASGSGMDWLAVSDVSTDVLSPFVQRLARAEASPR*
Ga0134127_102827341	3300010399	Terrestrial Soil	RGFNVAHATGSGMDWLAVSDVNADELTGFVQKLARESGMP*
Ga0134121_125592352	3300010401	Terrestrial Soil	LRTVRGFNVARANGLGMDWLAVSDVSADVLSEFVQRLARADTSP*
Ga0134123_100926421	3300010403	Terrestrial Soil	STLRTVRGFNVVHATGSGMDWIAVSDVNADELTELVQRLAQQTPSP*
Ga0105246_107124702	3300011119	Miscanthus Rhizosphere	APRAVRGFNVAHASGPSMDWLAVSDAEPAELSAFVQRLAHEDTSQ*
Ga0105246_125922091	3300011119	Miscanthus Rhizosphere	VALPTVRGFNVAHATGAGMDWIAVSDVSADVLNAFVQQLAGEAAKN*
Ga0137382_101091383	3300012200	Vadose Zone Soil	FNVARASGPTMDWLAVSDAEPAVLSAFVQRLAREDISQ*
Ga0137399_105267071	3300012203	Vadose Zone Soil	NVARASSANMDWLAVSDAEPAALTAFVQRLAREDISQ*
Ga0137380_107110261	3300012206	Vadose Zone Soil	AHANGSGMDWLAVSDVSADILSSFVQRLARAEAAP*
Ga0137381_103755052	3300012207	Vadose Zone Soil	FNVARASGPSMAWVAVSDAEPAVLSAFVQRLAREEVPQ*
Ga0137370_108019282	3300012285	Vadose Zone Soil	GFNVAHASGPSMDWLAVSDAEPAVLSAFVQRLAREDSSR*
Ga0137366_104317371	3300012354	Vadose Zone Soil	FNVARASGPNMDWLAVSDTDPAVLSALVQRLAREDVTQ*
Ga0137395_108346241	3300012917	Vadose Zone Soil	VARASGPRMDWFAVSDAEPAALSSFVQRLAREDVAQ*
Ga0137359_102991554	3300012923	Vadose Zone Soil	VRGFNVAHASGPSMDWVAVSDAEPAVLSSFVQRLAREDVSR*
Ga0164298_110219871	3300012955	Soil	SALRTVRGFNVVHASGSGMEWLAVSDVSADFLPRFVQRLASDAVAPL*
Ga0157373_111208331	3300013100	Corn Rhizosphere	RTIRGINVAHASGAQMDWLAVSDVSADVLGSFVLSLARGGATQ*
Ga0157375_125248281	3300013308	Miscanthus Rhizosphere	PAPVALPTVRGFNVAHATGAGMDWIAVSDVSGDVLNAFLQKLAGEPAKN*
Ga0134075_104206391	3300014154	Grasslands Soil	TVRGFTVVHASASGMDWLAVSDVSTDVLSAFVERLAHQAASQ*
Ga0163163_125551772	3300014325	Switchgrass Rhizosphere	VRGFNVAHATGSGMDWLAVSDVEPDTLSEFVQRLARPDISP*
Ga0157380_123498142	3300014326	Switchgrass Rhizosphere	FNVAHATGSGMDWLAVSDVEPDTLSEFVQRLARPDISP*
Ga0157377_110921211	3300014745	Miscanthus Rhizosphere	HATGSGMDWIAVSDVNADELTEFVQRLARQSATP*
Ga0167634_10312412	3300015090	Glacier Forefield Soil	RGFNVAHASGSGMDWLAVSDVSADVLTTFVQRLARADAAP*
Ga0187784_107831861	3300018062	Tropical Peatland	RGFNVAHAQGSQMEWLAVSDVSPDVLQGFVEQLARSETSH
Ga0066667_115220402	3300018433	Grasslands Soil	PTALRTVRGFNVAHATGSGMDWLGVSDVSADVLTSFVQRLARGSGAP
Ga0066662_105640033	3300018468	Grasslands Soil	GFNVAHATGTGLEWLAVSDVSPDVLAPFAEPLAPESPTR
Ga0066669_100929081	3300018482	Grasslands Soil	MSALRTVRGFNVARASGPTMDWLAVSDAEPAVLSMFVQRLAREDISQ
Ga0066669_122886521	3300018482	Grasslands Soil	TVRGFNVAHAVGSGMDWVAVSDLNAAELSSFVARVSSQD
Ga0173481_105963192	3300019356	Soil	VRGFNVAHATGSGMDWLAVSDLSAGELTSLVQRLAREDSMPKP
Ga0137408_13018174	3300019789	Vadose Zone Soil	VRGFNVAHASGSGMEWLAVSDVSADVLSPFVQRLARGEASP
Ga0193723_10329542	3300019879	Soil	VRGFNVAHASGSGMEWLAVSDVSADALSAFVQRLARAEAAP
Ga0210401_112651741	3300020583	Soil	SLAARRGFNVAHATGAGMEWWGVSDVSADVLAALVARLAHGE
Ga0222622_105515101	3300022756	Groundwater Sediment	PPHGVRGFNVAGEQGPTMDWLAVSDAEPEAVLALVRRLAREEAAR
Ga0222622_107895892	3300022756	Groundwater Sediment	PALRTVRGFNVAHASGSGMDWLAVSDVSPDVLSPFVQRLARGETSP
Ga0207692_110664952	3300025898	Corn, Switchgrass And Miscanthus Rhizosphere	MPLRTLRGFNIAHARGADMDWLAVSDVSADVLVPFVEALAAAR
Ga0207705_105498311	3300025909	Corn Rhizosphere	TVRGFHVAHARGGGMEWLAVSDASAPVLMSFVQRLAAEAAAP
Ga0207707_103412191	3300025912	Corn Rhizosphere	GFNVAHGAGSGMEWLAVSDVSADVLASLVERLAHAATPP
Ga0207649_103857712	3300025920	Corn Rhizosphere	ALRTVRGFNVAHATGSGMDWLAVSDVSAGELTSLVQRLAREDALPKR
Ga0207649_107892442	3300025920	Corn Rhizosphere	NVAHATGPSMDWLAVSDAEPEVLSAFVQRLAREEISQETPQRE
Ga0207687_119640341	3300025927	Miscanthus Rhizosphere	FNVAHATGSGMDWLAVSDLSSGELTSLVQRLARDDSMAKP
Ga0207691_116815212	3300025940	Miscanthus Rhizosphere	HVAHARGGGMEWLAVSDAGAPVLASFVQRLAAEAAAP
Ga0207711_105667411	3300025941	Switchgrass Rhizosphere	FNVAHATGAGMDWIAVSDVSADVLNAFVQQLAGEAAKN
Ga0207667_101365224	3300025949	Corn Rhizosphere	TIRGFNVAHGAGSGMEWLAVSDVSADVLASLVERLAHAATSP
Ga0207667_108509742	3300025949	Corn Rhizosphere	ATGSGMDWLAVSDVSADVLTAFVQRLAREDATTKP
Ga0207651_111279312	3300025960	Switchgrass Rhizosphere	LSPSSPPRPVRGFNVAHATGSGMDWLAVSDVEPDTLSEFVQRLARPDISP
Ga0207640_110064531	3300025981	Corn Rhizosphere	RGFNVAHATGSGMDWLAVSDVEPGILAEFVLRLARPDASP
Ga0207658_106466682	3300025986	Switchgrass Rhizosphere	GFNVAHATGAGMDWIAVSDVSGDVLNAFLQKLAGEPAKN
Ga0207677_103417492	3300026023	Miscanthus Rhizosphere	PVPAPAALPTVRGFNVAHATGAGMDWIAVSDVSGDVLNAFLQKLAGEPAKN
Ga0207639_101763433	3300026041	Corn Rhizosphere	LRTVRGINVAHASGSGMDWLAVSDVSRDVLASFVQQLARSDTR
Ga0207702_122988781	3300026078	Corn Rhizosphere	LRTVRGFNVAHATGSGMDWLAVSDVSAGELTSLVQRLAREDALPKR
Ga0207674_102679271	3300026116	Corn Rhizosphere	APAPMTLRTVRGFNVAHATGSGMDWIAVSDVGADELTEFVQRLARQSATP
Ga0207674_107157702	3300026116	Corn Rhizosphere	MTLRTVRGFNVVHATGSGMDWIAVSDVNADELTEFVQRLARQSATP
Ga0209161_103393321	3300026548	Soil	ARANGPSMDWLAVSDAEPAVLSAFVQRLAREDISQ
Ga0209328_102714832	3300027727	Forest Soil	VRGFNVAHASGSGMDWLAVSDVSADVLTAFVQRLARADAAL
Ga0268266_111120372	3300028379	Switchgrass Rhizosphere	TVRGFNVAHATGSGMDWLAVSDLSAGELTSLVQRLAREDSMPKP
Ga0247828_112372212	3300028587	Soil	AIGSGMDWLAVSDLSAGELTSLVQRLAREDSMPKP
Ga0307284_103068131	3300028799	Soil	PPAALRTVRGFNVAHAAGSGMDWLAVSDLNAAELSSFVARVSRDE
Ga0247825_109322882	3300028812	Soil	TIRGINVAHASGAQMDWLAVSDVSSDLLSSFVESLARGGPTQ
Ga0308309_108997922	3300028906	Soil	FNVAHATGAGMEWWGVSDVSADVLAALVARLARGE
Ga0170824_1103202432	3300031231	Forest Soil	HGFNVARANGPSMDWLAVSDADSGVLSAFVERLAREDISQ
Ga0318541_105053922	3300031545	Soil	FNVARAVGPSMEWVAVSDVEPAVLSAFVQRLAREDITQ
Ga0307408_1000566631	3300031548	Rhizosphere	RGINVAHASGAQMDWLAVSDVSPDVLSSFVDSLARGGSTQ
Ga0307469_101305173	3300031720	Hardwood Forest Soil	NVARASGASMDWLAVSDAEPAVLSAFVQRLAREDVSR
Ga0307468_1005408531	3300031740	Hardwood Forest Soil	PALRTVRGFNVAHASGSGMDWLAVSDVSADVLSPFVQRLARADASPR
Ga0310900_109276891	3300031908	Soil	PLRPVRGFNVARATGSGMNWLAVSDVEPDTLSEFVQRLARPESSP
Ga0310906_112837492	3300032013	Soil	LRTVRGFNVAHATGSGMDWLAVSDLSSGELTSLVQRLARDDSMAKP
Ga0307470_112153281	3300032174	Hardwood Forest Soil	PPPALRAVRGFNVAHASGSGMDWLAVSDVSADVLSSFVQRLARAEASPR
Ga0307471_1004492591	3300032180	Hardwood Forest Soil	TVRGFNVAHASGPSMDWLAVSDAEPAVLSAFVQRLAREDSSR
Ga0307471_1006933713	3300032180	Hardwood Forest Soil	HASTPALRTVRGFNVAHASGPSMDWLAVSDAEPAELSAFVQRLAREDISQ
Ga0307471_1032091391	3300032180	Hardwood Forest Soil	ARASGLGMDWLAVSDAEPAELAAFVQRLAREDISQ
Ga0310896_100899963	3300032211	Soil	HATGSGMDWLAVSDLSAGELTSLVQRLAREDSMPKP

Hidden Markov Model


Click on a Sequence Logo column to get its information.
Powered by Skylign