Basic Information | |
---|---|
Family ID | F079124 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 116 |
Average Sequence Length | 40 residues |
Representative Sequence | VPEPKKLVLIEGADHFFEGRLRELRETIEAWVKEAVNS |
Number of Associated Samples | 108 |
Number of Associated Scaffolds | 116 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Unclassified |
% of genes with valid RBS motifs | 0.00 % |
% of genes near scaffold ends (potentially truncated) | 2.59 % |
% of genes from short scaffolds (< 2000 bps) | 2.59 % |
Associated GOLD sequencing projects | 106 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.45 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Unclassified (97.414 % of family members) |
NCBI Taxonomy ID | N/A |
Taxonomy | N/A |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (14.655 % of family members) |
Environment Ontology (ENVO) | Unclassified (26.724 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (54.310 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 31.82% β-sheet: 0.00% Coil/Unstructured: 68.18% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.45 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 116 Family Scaffolds |
---|---|---|
PF13660 | DUF4147 | 73.28 |
PF04402 | SIMPL | 2.59 |
PF00487 | FA_desaturase | 1.72 |
PF01694 | Rhomboid | 1.72 |
PF00903 | Glyoxalase | 1.72 |
PF00072 | Response_reg | 0.86 |
PF01346 | FKBP_N | 0.86 |
PF01797 | Y1_Tnp | 0.86 |
PF12695 | Abhydrolase_5 | 0.86 |
PF02661 | Fic | 0.86 |
PF12706 | Lactamase_B_2 | 0.86 |
PF00005 | ABC_tran | 0.86 |
PF01243 | Putative_PNPOx | 0.86 |
COG ID | Name | Functional Category | % Frequency in 116 Family Scaffolds |
---|---|---|---|
COG2859 | Outer membrane channel-forming protein BP26/OMP28, SIMPL family | Cell wall/membrane/envelope biogenesis [M] | 2.59 |
COG2968 | Uncharacterized conserved protein YggE, contains kinase-interacting SIMPL domain | Function unknown [S] | 2.59 |
COG3471 | Predicted secreted (periplasmic) protein | Function unknown [S] | 2.59 |
COG0705 | Membrane-associated serine protease, rhomboid family | Posttranslational modification, protein turnover, chaperones [O] | 1.72 |
COG1398 | Fatty-acid desaturase | Lipid transport and metabolism [I] | 1.72 |
COG3239 | Fatty acid desaturase | Lipid transport and metabolism [I] | 1.72 |
COG0545 | FKBP-type peptidyl-prolyl cis-trans isomerase | Posttranslational modification, protein turnover, chaperones [O] | 0.86 |
COG1943 | REP element-mobilizing transposase RayT | Mobilome: prophages, transposons [X] | 0.86 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
Unclassified | root | N/A | 97.41 % |
All Organisms | root | All Organisms | 2.59 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300010337|Ga0134062_10045989 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1765 | Open in IMG/M |
3300012201|Ga0137365_10941592 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 629 | Open in IMG/M |
3300012210|Ga0137378_11155111 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 690 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 14.66% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 11.21% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 6.03% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 6.03% |
Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 5.17% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 4.31% |
Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 3.45% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 3.45% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 3.45% |
Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 3.45% |
Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 3.45% |
Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 3.45% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 2.59% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 2.59% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 2.59% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 2.59% |
Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 1.72% |
Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 1.72% |
Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 1.72% |
Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 1.72% |
Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 1.72% |
Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.86% |
Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 0.86% |
Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.86% |
Untreated Peat Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil | 0.86% |
Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.86% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 0.86% |
Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 0.86% |
Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 0.86% |
Bog | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Bog | 0.86% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.86% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.86% |
Miscanthus Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere | 0.86% |
Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 0.86% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.86% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 0.86% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300000893 | Forest soil microbial communities from Amazon forest - Pasture72 2010 replicate I A001 | Environmental | Open in IMG/M |
3300004635 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3 | Environmental | Open in IMG/M |
3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Host-Associated | Open in IMG/M |
3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Environmental | Open in IMG/M |
3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Environmental | Open in IMG/M |
3300005454 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_136 | Environmental | Open in IMG/M |
3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Environmental | Open in IMG/M |
3300005538 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1 | Environmental | Open in IMG/M |
3300005552 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_150 | Environmental | Open in IMG/M |
3300005560 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_119 | Environmental | Open in IMG/M |
3300005561 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148 | Environmental | Open in IMG/M |
3300005591 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1 | Environmental | Open in IMG/M |
3300005602 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 | Environmental | Open in IMG/M |
3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Host-Associated | Open in IMG/M |
3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Environmental | Open in IMG/M |
3300006176 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 | Environmental | Open in IMG/M |
3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) | Host-Associated | Open in IMG/M |
3300006755 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter | Environmental | Open in IMG/M |
3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
3300006903 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD5 | Host-Associated | Open in IMG/M |
3300006914 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Host-Associated | Open in IMG/M |
3300009156 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2) | Host-Associated | Open in IMG/M |
3300009522 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_5_LS metaG | Environmental | Open in IMG/M |
3300009792 | Tropical forest soil microbial communities from Panama - MetaG Plot_12 | Environmental | Open in IMG/M |
3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
3300010303 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09182015 | Environmental | Open in IMG/M |
3300010321 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09212015 | Environmental | Open in IMG/M |
3300010337 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09082015 | Environmental | Open in IMG/M |
3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
3300010396 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2 | Environmental | Open in IMG/M |
3300011120 | Combined assembly of Microbial Forest Soil metaT | Environmental | Open in IMG/M |
3300012096 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaG | Environmental | Open in IMG/M |
3300012198 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaG | Environmental | Open in IMG/M |
3300012201 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_40_16 metaG | Environmental | Open in IMG/M |
3300012205 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG | Environmental | Open in IMG/M |
3300012210 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaG | Environmental | Open in IMG/M |
3300012349 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Sage2_R_115_16 metaG | Environmental | Open in IMG/M |
3300012353 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_80_16 metaG | Environmental | Open in IMG/M |
3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
3300012363 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaG | Environmental | Open in IMG/M |
3300012923 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaG | Environmental | Open in IMG/M |
3300012925 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012958 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_221_MG | Environmental | Open in IMG/M |
3300012960 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MG | Environmental | Open in IMG/M |
3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Host-Associated | Open in IMG/M |
3300015242 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
3300016270 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 | Environmental | Open in IMG/M |
3300016357 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 | Environmental | Open in IMG/M |
3300016387 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 | Environmental | Open in IMG/M |
3300017654 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_2_24_1 metaG | Environmental | Open in IMG/M |
3300017823 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_3 | Environmental | Open in IMG/M |
3300017933 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_1 | Environmental | Open in IMG/M |
3300017972 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
3300017975 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
3300018005 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_17_150 | Environmental | Open in IMG/M |
3300018023 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_7_100 | Environmental | Open in IMG/M |
3300018035 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_17_10 | Environmental | Open in IMG/M |
3300018040 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_10_150 | Environmental | Open in IMG/M |
3300018085 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
3300018086 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_10_MG | Environmental | Open in IMG/M |
3300018433 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116 | Environmental | Open in IMG/M |
3300018468 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111 | Environmental | Open in IMG/M |
3300019890 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1c1 | Environmental | Open in IMG/M |
3300020004 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H1a2 | Environmental | Open in IMG/M |
3300020580 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-M | Environmental | Open in IMG/M |
3300021171 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-M | Environmental | Open in IMG/M |
3300021178 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-M | Environmental | Open in IMG/M |
3300021432 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M | Environmental | Open in IMG/M |
3300021474 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-O | Environmental | Open in IMG/M |
3300021477 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-O | Environmental | Open in IMG/M |
3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
3300022730 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic ? CZU2 | Host-Associated | Open in IMG/M |
3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026295 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 08_20_2013_1_20cm (SPAdes) | Environmental | Open in IMG/M |
3300026310 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_2_20cm (SPAdes) | Environmental | Open in IMG/M |
3300026315 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_126 (SPAdes) | Environmental | Open in IMG/M |
3300026318 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_128 (SPAdes) | Environmental | Open in IMG/M |
3300026322 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_136 (SPAdes) | Environmental | Open in IMG/M |
3300026361 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NL-03-B | Environmental | Open in IMG/M |
3300026557 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal | Environmental | Open in IMG/M |
3300026890 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 51 (SPAdes) | Environmental | Open in IMG/M |
3300027109 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF008 (SPAdes) | Environmental | Open in IMG/M |
3300027521 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM1H0_M1 (SPAdes) | Environmental | Open in IMG/M |
3300027667 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM3_M2 (SPAdes) | Environmental | Open in IMG/M |
3300027684 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM1H0_M2 (SPAdes) | Environmental | Open in IMG/M |
3300027729 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP04_OM1 (SPAdes) | Environmental | Open in IMG/M |
3300027869 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
3300027875 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
3300027889 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 (SPAdes) | Environmental | Open in IMG/M |
3300028536 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
3300028828 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_202 | Environmental | Open in IMG/M |
3300029945 | I_Bog_N2 coassembly | Environmental | Open in IMG/M |
3300030524 | II_Palsa_N3 coassembly | Environmental | Open in IMG/M |
3300030855 | Forest soil microbial communities from France for metatranscriptomics studies - Site 11 - Champenoux / Amance forest - OA9 Emin (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
3300030879 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300031057 | Oak Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
3300031748 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f22 | Environmental | Open in IMG/M |
3300031754 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515 | Environmental | Open in IMG/M |
3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
3300032783 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.3 | Environmental | Open in IMG/M |
3300032828 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.4 | Environmental | Open in IMG/M |
3300032829 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.3 | Environmental | Open in IMG/M |
3300032896 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.4 | Environmental | Open in IMG/M |
3300034124 | Peat soil microbial communities from wetlands in Alaska, United States - Goldstream_06D_14 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
AP72_2010_repI_A001DRAFT_10667041 | 3300000893 | Forest Soil | SLAEPKRLVIIEAADHFFEGRLREMRETVEGWAKEALTL* |
Ga0062388_1000068551 | 3300004635 | Bog Forest Soil | LVQTLPEPKKLVLIEAADHFFEGRLKELRETIEAWVREVLVAPTPKAES* |
Ga0070668_1014960252 | 3300005347 | Switchgrass Rhizosphere | GLVHSIPGPKKLVLVPGADHFFEGRLREMRDAIEQWVGEAVSL* |
Ga0070688_1013143342 | 3300005365 | Switchgrass Rhizosphere | DKAVGAMAEPKKLVIIEAGDHFFEGRLRELRDAIETWVRETIVS* |
Ga0070713_1008045392 | 3300005436 | Corn, Switchgrass And Miscanthus Rhizosphere | EALVASLPDPKRLVLIEGGDHFFEGRLREMRETIEVWVKEAVSA* |
Ga0066687_100879822 | 3300005454 | Soil | MVSSLPEPKKLVIIPAADHFFEGRLREMRETVETWAREVLS* |
Ga0066687_108873541 | 3300005454 | Soil | DSVAPPKELVLIEAGDHFFEGRLAELRRTIENWVRNAVLQQVAH* |
Ga0070697_1000627545 | 3300005536 | Corn, Switchgrass And Miscanthus Rhizosphere | SVPEPRRLVLIEGADHFFEGRLSELRETIESWIREVVLHG* |
Ga0070731_107271872 | 3300005538 | Surface Soil | EQVIQSLPEPKKLVLIEGGDHFFAGRLRELRETIEEWVRQVLGK* |
Ga0066701_109470232 | 3300005552 | Soil | LSEPKKLIIVEGADHFFEGRMRELRETIEAWLRELLST* |
Ga0066670_104300842 | 3300005560 | Soil | PKKLVIIEGADHFFEGRLHELRNAVESWIKEAQLA* |
Ga0066699_104176832 | 3300005561 | Soil | VNSLADPKKLVLIAGADHFFEGRLRELREKIENWVREFLVG* |
Ga0070761_104205401 | 3300005591 | Soil | EPKKLVLIEGADHFFEGRLRELRETIESWVKEAVNH* |
Ga0070762_110679892 | 3300005602 | Soil | PEPKKLVLIEGGDHFFEGRLREMREAVEAWVGTVRISC* |
Ga0068862_1015679181 | 3300005844 | Switchgrass Rhizosphere | KAVGAMAEPKKLVIIEAGDHFFEGRLRELRDAIETWVRETIVS* |
Ga0070716_1002972852 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | KKLVVIEGADHFFEGRLRELREAIEAWVKEQIVA* |
Ga0070765_1012936211 | 3300006176 | Soil | LIQGADHFFEGRLRELREAIEGWVRQEIVRDLSL* |
Ga0097621_1000037501 | 3300006237 | Miscanthus Rhizosphere | KGLIHSIPGPKKLILVPGADHFFEGRLREMRDAIEQWVSEAVNL* |
Ga0079222_109074262 | 3300006755 | Agricultural Soil | VASLPEPKRLLIIEGADHFFAGRLAELRKAIEEWVKEQVVVG* |
Ga0075425_1007026501 | 3300006854 | Populus Rhizosphere | EPKKLVMIESADHFFEGRLREMRDAIETWVRETGLG* |
Ga0075426_108575971 | 3300006903 | Populus Rhizosphere | KKLVIIEGADHFFEGRLHELRNAVESWIKEAQLG* |
Ga0075436_1001301821 | 3300006914 | Populus Rhizosphere | PKRLLIIEGADHFFAGRLAELRKAIEEWVKEQVVVG* |
Ga0111538_123611611 | 3300009156 | Populus Rhizosphere | AKLQEMVDALPEPRTLVFIESADHFFEGRLREMRESIEEWLRKTIISPP* |
Ga0116218_14177672 | 3300009522 | Peatlands Soil | LPEPKKLVIVEGADHFFEGRLRELREGIESWIKERIPD* |
Ga0126374_105470042 | 3300009792 | Tropical Forest Soil | ALVQSLAEPKKLVITDAADHFFEGRLREMRESVQGWAKEILQM* |
Ga0126384_119327122 | 3300010046 | Tropical Forest Soil | SVAEPKKLVTIGAADHFFEGRLREMREVVESWVKETVLQGEQ* |
Ga0134082_100535873 | 3300010303 | Grasslands Soil | PKKLIIVEGADHFFEGRMRELRETIEAWLRELLST* |
Ga0134067_100397133 | 3300010321 | Grasslands Soil | PKKLIIVEGADHFFEGRMRELRETIEAWLRECLST* |
Ga0134062_100459891 | 3300010337 | Grasslands Soil | ILSEPKKLIIVEGADHFFEGRMRELRETIEAWLRELLST* |
Ga0126376_103945291 | 3300010359 | Tropical Forest Soil | ELAHSAAGPKQLVIIDSADHFFEGRLREMREAMENWIRETLDLPS* |
Ga0134126_118752001 | 3300010396 | Terrestrial Soil | PEPKKLVIIESADHFFEGRLREMRESIEGWIQEARIV* |
Ga0150983_158068291 | 3300011120 | Forest Soil | KKLVIIEAADHFFEGRLREMREAVEGWVGETVRP* |
Ga0150983_164809732 | 3300011120 | Forest Soil | KKLVLIEGADHFFEGRLRELREAIEGWVRQEIVRDLSL* |
Ga0137389_107390872 | 3300012096 | Vadose Zone Soil | FVKSLPEPRKLVIIEGADHFFEGRVRELRETIEGWVREVVRLV* |
Ga0137364_109646811 | 3300012198 | Vadose Zone Soil | AELPEPKKLVIIEAADHFFEGRLREMRDVVEGWARDAVSNTRA* |
Ga0137365_109415921 | 3300012201 | Vadose Zone Soil | EPKKLIIVEGADHFFEGRMRELRETIEAWLRELLST* |
Ga0137362_111522492 | 3300012205 | Vadose Zone Soil | PEPKKLVLIEGADHFFEGRLRELRETIEVWVRQEIVRDPTL* |
Ga0137378_111551112 | 3300012210 | Vadose Zone Soil | LEKLVAILSEPKKLIIVEGADHFFEGRMRELRETIEAWLRELLST* |
Ga0137378_118630742 | 3300012210 | Vadose Zone Soil | LEKLVAILSEPKKLIIVEGADHFFEGRMRELRETIEAWLRECLST* |
Ga0137387_101080111 | 3300012349 | Vadose Zone Soil | KKLVIIDSADHFFEGRLREMREAIEAWIKDTIGT* |
Ga0137367_101621151 | 3300012353 | Vadose Zone Soil | LLSSLPEPKTLVIIDSADHFFEGRLREMRDAIAAWIREKGLA* |
Ga0137360_102765263 | 3300012361 | Vadose Zone Soil | VAILSEPKKLIIVEGADHFFEGRMRELRETIEAWLRECLST* |
Ga0137390_116845891 | 3300012363 | Vadose Zone Soil | QLEALVRTVSSPKKLVLIAGGDHFFEGRLRELRESIEQWVGEAVIP* |
Ga0137359_104295002 | 3300012923 | Vadose Zone Soil | SVPEPKKLVVIEGADHFFEGRLRELRDTIESWVRSEIVHD* |
Ga0137419_102219311 | 3300012925 | Vadose Zone Soil | PEPKKLIIIEAADHFFEGRLREMRDAVEGWTRNVVSNTW* |
Ga0137404_108363381 | 3300012929 | Vadose Zone Soil | LKALVNSVPEPKKLVLIAGADHFFEGRLREMRECVERWVGEAVNL* |
Ga0164299_101064801 | 3300012958 | Soil | HSIPGPKKLVLIPGADHFFEGRLREMRDAIEQWVSEAVNL* |
Ga0164301_101519733 | 3300012960 | Soil | LPEPKKLVMIEAADHFFEGRLRAMRETVENWTRETLHL* |
Ga0157372_106059293 | 3300013307 | Corn Rhizosphere | QSLPEPKKLVLIEAADHFFEGRLREMRDAIEPWVREITA* |
Ga0137412_106658991 | 3300015242 | Vadose Zone Soil | VPEPKKLVVIEGADHFFEGRLRELRETIEGWVRQEIVREVSL* |
Ga0132255_1013299371 | 3300015374 | Arabidopsis Rhizosphere | DALPKPKRLVLIESADHFFEGRLREMRESIEEWLRKTIVSPP* |
Ga0182036_100321974 | 3300016270 | Soil | FASLSEPKKLVIIPAADHFFEGRLREMRDAVETWTRETLNTPSSL |
Ga0182032_119352242 | 3300016357 | Soil | VAPLPGLKKLVIVEAADHFFEGRLREMREEVEGWAREVVREL |
Ga0182040_100464254 | 3300016387 | Soil | SEPKKLVIIPAADHFFEGRLREMRDAVETWTRETLNTPSAL |
Ga0134069_10078735 | 3300017654 | Grasslands Soil | PKKLIIVEGADHFFEGRMRELRETIEAWLRECLST |
Ga0187818_101651091 | 3300017823 | Freshwater Sediment | EPKKLVLIEGADHFFEGRLRELREAIEAWVRQAAAG |
Ga0187801_104718502 | 3300017933 | Freshwater Sediment | SVPEPKKLIVIEGADHFFGGRLRELRKAIEAWLREQVALTA |
Ga0187781_104807681 | 3300017972 | Tropical Peatland | LVVIDGADHFFEGRLRELRETIEGWVRQEILREVSL |
Ga0187782_114230081 | 3300017975 | Tropical Peatland | SLSQPKRLVLIEGADHFFEGRLRELREVIEGWIREVIVEEPRSS |
Ga0187878_10084241 | 3300018005 | Peatland | LVVIQGADHFFEGRLRELREAIESWVREEIVRDVSL |
Ga0187889_103642992 | 3300018023 | Peatland | LPEPKKLVVIEGADHFFEGRLRELREAIATWVEEEILQQASL |
Ga0187875_103215851 | 3300018035 | Peatland | EPKKLVMIQGADHFFEGRLRELRDAIEVWIKESIPR |
Ga0187862_101366941 | 3300018040 | Peatland | KKLVVIEGADHFFEGRLRELREAIATWVEEEILRQASL |
Ga0187772_102779182 | 3300018085 | Tropical Peatland | KLIRIEAADHFFEGRLKEMRETIEAWLRDFLATDQRPPGD |
Ga0187769_109294481 | 3300018086 | Tropical Peatland | EPKKLVVIDGGDHFFAGRLRELRGAIESWVREQVIKTP |
Ga0066667_121992132 | 3300018433 | Grasslands Soil | EPKKLVFVEGADHFFEGRLREVRATIESWVREEILG |
Ga0066662_101024531 | 3300018468 | Grasslands Soil | ELAATFPEPKKLVIIEGADHFFEGRLRELRDAIESWLKQAKLT |
Ga0193728_10243985 | 3300019890 | Soil | ASAAEAKKLVVIEGADHFFEGRLRELRETIEGWVRQEIERQGSL |
Ga0193755_11291141 | 3300020004 | Soil | VRSVSDPKKLILIAGGDHFFEGRLRELREAIEQWVGEAVIP |
Ga0210403_105509051 | 3300020580 | Soil | LVTSLPEPKKLVLIQGADHFFEGRLRELREAIEGWVRQEIVRDLSL |
Ga0210405_106707611 | 3300021171 | Soil | LPEPKKLVMIQGADHFFEGRLRELREAIEAWIKESIPH |
Ga0210408_105491371 | 3300021178 | Soil | LVRTVSSPKKLVLIAGGDHFFEGRLRELRESIEQWVGEAVIP |
Ga0210384_114483771 | 3300021432 | Soil | ALVASVPEPKKLVLIEAGDHFFEGRLRELREAIEAWVKDEVTHSA |
Ga0210384_115622741 | 3300021432 | Soil | PEPKKLVIVEGADHFFEGCLRELREAIEMWVREVLF |
Ga0210390_110790741 | 3300021474 | Soil | KKLVVIEGADHFFEGRLRELREAIESWVRQRIVGKPSI |
Ga0210398_105638061 | 3300021477 | Soil | ALVASVPEPKKLVIIEGADHFFEGRLRELREAIETWMKEAI |
Ga0210402_103413523 | 3300021478 | Soil | LPEPKRLHIVEGADHFFAGRLEEVGATITDWLAQT |
Ga0210402_106807852 | 3300021478 | Soil | QLPEPKKLVIIPAADHFFEGRLREMREAVETWTRETLASQVR |
Ga0210402_111316271 | 3300021478 | Soil | TVSSPKKLVLIAGGDHFFEGRLRELRESVEQWVGEAVIP |
Ga0224570_1030722 | 3300022730 | Rhizosphere | IPEPKKLVLIEGGDHFFEGRLRELRETIEAWLKEAVG |
Ga0207667_101148244 | 3300025949 | Corn Rhizosphere | RVLLGKAVGAMAEPKKLVIIEAGDHFFEGRLRELRDAIETWVRETIVS |
Ga0207640_106607271 | 3300025981 | Corn Rhizosphere | SERKKLVIIESADHFFEGRLKEMREATEAWVKEMIQ |
Ga0209234_100079212 | 3300026295 | Grasslands Soil | LEKLVAILSEPKKLIIVEGADHFFEGRMRELRETIEAWLRECLST |
Ga0209239_10947903 | 3300026310 | Grasslands Soil | AILSEPKKLIIVEGADHFFEGRMRELRETIEAWLRELLST |
Ga0209686_10917542 | 3300026315 | Soil | ENLGANVPEPKKLVFVEGADHFFEGRLREVRATIESWVREEILG |
Ga0209471_13256332 | 3300026318 | Soil | PEPKKLVLIEGADHFFAGRLRELREGIEKWAKETVAI |
Ga0209687_11037131 | 3300026322 | Soil | PEPKKLLLIEGADHFFAGRLRELREAIEKWVKEVVAI |
Ga0257176_10569982 | 3300026361 | Soil | PKKLVLVGGADHFFEGRLREMRETVVQWVGDVVNL |
Ga0179587_103814251 | 3300026557 | Vadose Zone Soil | ALVAGLPEPKKLIIIEAADHFFEGRLREMRDAVEGWTRNVVSNTW |
Ga0207781_10234172 | 3300026890 | Tropical Forest Soil | VASTPEPKKLVTIEGADHFFEGRLRELRDAIETWTKEVTRSA |
Ga0208603_10077791 | 3300027109 | Forest Soil | PEPKKLVLIAGADHFFAGRLRELREAIETWVTETRT |
Ga0209524_11374452 | 3300027521 | Forest Soil | PKKLVLIEGADHFFEGRLRELREAIESFIREQVVV |
Ga0209009_11963901 | 3300027667 | Forest Soil | PKKLVLIAGADHFFEGRLREMRETVEQWVGEAVNL |
Ga0209626_10220732 | 3300027684 | Forest Soil | VVAELPEPKKLVIVEGADHFFEGRLLELRESIEGWIKESVHA |
Ga0209248_101855882 | 3300027729 | Bog Forest Soil | EALVASAPEPKKLVLIEGGDHFFEGRLRELRETIEGWVKEAISCQPLAIS |
Ga0209579_100689601 | 3300027869 | Surface Soil | IPEPKKLVLIEGADHFFEGRLREMRESMEAWVKEAVTS |
Ga0209283_100144846 | 3300027875 | Vadose Zone Soil | QGLVESLSAPRKLVLIEGADHFFEGRLRELREAIETWVREVVRLV |
Ga0209380_101237771 | 3300027889 | Soil | VLIEGADHFFEGRLRELRETIEVWVRQAIVQDQSL |
Ga0137415_104025031 | 3300028536 | Vadose Zone Soil | ATRLRALVGSVPEPKKLVLIAGGDHFFEGRLRELREIVEQWVGDVVNL |
Ga0307312_108621552 | 3300028828 | Soil | SAQLKVLVGSLPQPKTLVLIGGADHFFEGRLRELRETIEQWLADAVNL |
Ga0311330_112211761 | 3300029945 | Bog | IASLPEPKKLVVIEGADHFFEGRLRELRETIESWVREEIVRAMSL |
Ga0311357_101582891 | 3300030524 | Palsa | KKLVVIEGADHFFEGRLRELRDAIEDWVRQVIVRDPSL |
Ga0075374_105050291 | 3300030855 | Soil | KKLVLIEGADHFFEGRLREMRETIEAWVKEADGCL |
Ga0265765_10016163 | 3300030879 | Soil | VVIEGADHFFEGRLRELREAIEGWVRETIVEGPSI |
Ga0170834_1124318711 | 3300031057 | Forest Soil | EPKKLVVIEGADHFFEGRLRELRETIEEWVRQTVIGNPAV |
Ga0310686_1007732552 | 3300031708 | Soil | VPEPKKLVLIEGADHFFEGRLRELRETIEAWVKEAVNS |
Ga0318492_102754831 | 3300031748 | Soil | AALVACLPEPKELVIIEAADHFFEGRLREMREAIEHWVRDVGLAV |
Ga0307475_104207291 | 3300031754 | Hardwood Forest Soil | EPKKLVLIAGADHFFEGRLRELRETIVEWIGDAVNL |
Ga0307471_1033353721 | 3300032180 | Hardwood Forest Soil | PKPRKLVLIQGADHFFEGRLREMRETVEQWVGDAVNL |
Ga0307471_1039530851 | 3300032180 | Hardwood Forest Soil | KLEALVASVSQPKKLIVIEGADHLCEGRLRELREAIEVWVRQQIVREVSA |
Ga0335079_110128432 | 3300032783 | Soil | GPCKLAFIEGADHFFEGRLRELREVIEAWVRESVLVIGKAV |
Ga0335079_117910821 | 3300032783 | Soil | KKLVLIEAADHFFEGRLREMRTAIEDWIRETLPQPL |
Ga0335080_101166264 | 3300032828 | Soil | AKLQALVHSLPEPRKLELIEGADHFFDGHLREMREAVEKWVKGVL |
Ga0335070_101270234 | 3300032829 | Soil | GMVDALPEPRKLVIIEGADHFFEGRLRELREAIENWIKQTVLRRADS |
Ga0335075_116683762 | 3300032896 | Soil | PKKLVIIEGADHFFEGRLHELREAIEKWIRETLSR |
Ga0370483_0249051_478_603 | 3300034124 | Untreated Peat Soil | LAEALPEPKKLVIIEGGDHFFEGRLQAMREAIETWVSETLR |
⦗Top⦘ |