NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome Family F079230

Metagenome Family F079230

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F079230
Family Type Metagenome
Number of Sequences 116
Average Sequence Length 86 residues
Representative Sequence MIDSLIYGIIASSFVIGITRSVLLLYKRFPRLGFGLIYGSLGVKMFALGAFTLLAKPYIDNIVIYASIILSAIIYSNVYVLLKLHRK
Number of Associated Samples 91
Number of Associated Scaffolds 116

Quality Assessment
Transcriptomic Evidence No
Most common taxonomic group Unclassified
% of genes with valid RBS motifs 0.00 %
% of genes near scaffold ends (potentially truncated) 24.14 %
% of genes from short scaffolds (< 2000 bps) 69.83 %
Associated GOLD sequencing projects 80
AlphaFold2 3D model prediction No

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Unclassified (66.379 % of family members)
NCBI Taxonomy ID N/A
Taxonomy N/A

Most Common Ecosystem
GOLD Ecosystem Environmental → Aquatic → Marine → Strait → Unclassified → Seawater
(37.069 % of family members)
Environment Ontology (ENVO) Unclassified
(87.931 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Saline → Water (saline)
(94.828 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Transmembrane (alpha-helical) Signal Peptide: No Secondary Structure distribution: α-helix: 85.06%    β-sheet: 0.00%    Coil/Unstructured: 14.94%
Feature Viewer
Powered by Feature Viewer

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 116 Family Scaffolds
PF14902DUF4494 3.45
PF04545Sigma70_r4 1.72
PF13476AAA_23 0.86
PF04965GPW_gp25 0.86


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
UnclassifiedrootN/A66.38 %
All OrganismsrootAll Organisms33.62 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300000116|DelMOSpr2010_c10000687All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage21212Open in IMG/M
3300001450|JGI24006J15134_10121899All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium898Open in IMG/M
3300001589|JGI24005J15628_10125647Not Available818Open in IMG/M
3300002488|JGI25128J35275_1007486All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage2921Open in IMG/M
3300004457|Ga0066224_1012588All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage3617Open in IMG/M
3300004461|Ga0066223_1064785All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → unclassified Flavobacteriales → Flavobacteriales bacterium5223Open in IMG/M
3300006026|Ga0075478_10012752Not Available2861Open in IMG/M
3300006027|Ga0075462_10241672Not Available536Open in IMG/M
3300006164|Ga0075441_10012703All Organisms → Viruses → environmental samples → uncultured virus3555Open in IMG/M
3300006352|Ga0075448_10007129All Organisms → Viruses3663Open in IMG/M
3300006484|Ga0070744_10201438Not Available566Open in IMG/M
3300006735|Ga0098038_1066037Not Available1286Open in IMG/M
3300006737|Ga0098037_1031027Not Available1970Open in IMG/M
3300006749|Ga0098042_1001400Not Available9169Open in IMG/M
3300006752|Ga0098048_1002811All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage7219Open in IMG/M
3300006802|Ga0070749_10307748Not Available887Open in IMG/M
3300006810|Ga0070754_10278313Not Available757Open in IMG/M
3300006868|Ga0075481_10106876All Organisms → Viruses → Predicted Viral1037Open in IMG/M
3300006874|Ga0075475_10147892Not Available1032Open in IMG/M
3300006916|Ga0070750_10190584Not Available912Open in IMG/M
3300006919|Ga0070746_10121930Not Available1287Open in IMG/M
3300006947|Ga0075444_10034321All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium2506Open in IMG/M
3300007345|Ga0070752_1002155All Organisms → Viruses12898Open in IMG/M
3300007345|Ga0070752_1043876All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage2091Open in IMG/M
3300007346|Ga0070753_1135413Not Available941Open in IMG/M
3300008012|Ga0075480_10174788Not Available1150Open in IMG/M
3300009079|Ga0102814_10868901Not Available500Open in IMG/M
3300009086|Ga0102812_10261624Not Available941Open in IMG/M
3300009472|Ga0115554_1366550Not Available565Open in IMG/M
3300009495|Ga0115571_1074015Not Available1519Open in IMG/M
3300009505|Ga0115564_10543512Not Available555Open in IMG/M
3300009550|Ga0115013_10451709Not Available830Open in IMG/M
3300010148|Ga0098043_1018375Not Available2258Open in IMG/M
3300012920|Ga0160423_10160008Not Available1578Open in IMG/M
3300012936|Ga0163109_11286247Not Available533Open in IMG/M
3300012954|Ga0163111_10473417Not Available1150Open in IMG/M
3300017708|Ga0181369_1003897Not Available4068Open in IMG/M
3300017708|Ga0181369_1011757All Organisms → Viruses → environmental samples → uncultured virus2226Open in IMG/M
3300017708|Ga0181369_1029326Not Available1302Open in IMG/M
3300017708|Ga0181369_1042018All Organisms → Viruses → Predicted Viral1045Open in IMG/M
3300017708|Ga0181369_1061738Not Available822Open in IMG/M
3300017708|Ga0181369_1100664Not Available600Open in IMG/M
3300017709|Ga0181387_1015838All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1456Open in IMG/M
3300017709|Ga0181387_1072055Not Available696Open in IMG/M
3300017709|Ga0181387_1096202Not Available606Open in IMG/M
3300017710|Ga0181403_1003855Not Available3317Open in IMG/M
3300017710|Ga0181403_1018825All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1469Open in IMG/M
3300017710|Ga0181403_1030209Not Available1144Open in IMG/M
3300017713|Ga0181391_1026254Not Available1433Open in IMG/M
3300017714|Ga0181412_1133815Not Available565Open in IMG/M
3300017717|Ga0181404_1001234All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → unclassified Flavobacteriales → Flavobacteriales bacterium7606Open in IMG/M
3300017717|Ga0181404_1032948Not Available1326Open in IMG/M
3300017719|Ga0181390_1013764Not Available2778Open in IMG/M
3300017719|Ga0181390_1038201All Organisms → Viruses → Predicted Viral1465Open in IMG/M
3300017719|Ga0181390_1067320All Organisms → Viruses → Predicted Viral1015Open in IMG/M
3300017724|Ga0181388_1045601All Organisms → Viruses → Predicted Viral1063Open in IMG/M
3300017726|Ga0181381_1056833Not Available853Open in IMG/M
3300017730|Ga0181417_1026717Not Available1434Open in IMG/M
3300017732|Ga0181415_1014120Not Available1878Open in IMG/M
3300017732|Ga0181415_1056098Not Available894Open in IMG/M
3300017734|Ga0187222_1004629All Organisms → Viruses → environmental samples → uncultured virus3634Open in IMG/M
3300017734|Ga0187222_1022335Not Available1531Open in IMG/M
3300017735|Ga0181431_1010911All Organisms → Viruses → Predicted Viral2175Open in IMG/M
3300017738|Ga0181428_1000316All Organisms → Viruses11217Open in IMG/M
3300017738|Ga0181428_1082328Not Available751Open in IMG/M
3300017739|Ga0181433_1017464Not Available1926Open in IMG/M
3300017739|Ga0181433_1051143All Organisms → Viruses → Predicted Viral1052Open in IMG/M
3300017743|Ga0181402_1037895Not Available1326Open in IMG/M
3300017746|Ga0181389_1010306All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage3108Open in IMG/M
3300017759|Ga0181414_1030138Not Available1469Open in IMG/M
3300017759|Ga0181414_1158491Not Available591Open in IMG/M
3300017764|Ga0181385_1070076Not Available1081Open in IMG/M
3300017765|Ga0181413_1073633Not Available1047Open in IMG/M
3300017768|Ga0187220_1023235Not Available1865Open in IMG/M
3300017769|Ga0187221_1008203All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → unclassified Flavobacteriales → Flavobacteriales bacterium4084Open in IMG/M
3300017769|Ga0187221_1024569Not Available2077Open in IMG/M
3300017771|Ga0181425_1177299Not Available672Open in IMG/M
3300017772|Ga0181430_1037680All Organisms → Viruses → Predicted Viral1529Open in IMG/M
3300017773|Ga0181386_1086743Not Available983Open in IMG/M
3300017781|Ga0181423_1327344Not Available561Open in IMG/M
3300017782|Ga0181380_1052242Not Available1462Open in IMG/M
3300017782|Ga0181380_1056563Not Available1396Open in IMG/M
3300017783|Ga0181379_1077899Not Available1234Open in IMG/M
3300018416|Ga0181553_10550446Not Available612Open in IMG/M
3300018420|Ga0181563_10065110All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage2500Open in IMG/M
3300021957|Ga0222717_10206303All Organisms → Viruses → Predicted Viral1164Open in IMG/M
3300021959|Ga0222716_10466351Not Available718Open in IMG/M
3300022074|Ga0224906_1000106All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage45877Open in IMG/M
3300022074|Ga0224906_1001466All Organisms → Viruses11518Open in IMG/M
3300022187|Ga0196899_1088958Not Available932Open in IMG/M
(restricted) 3300023109|Ga0233432_10055286Not Available2472Open in IMG/M
3300024346|Ga0244775_10529769All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium960Open in IMG/M
3300024346|Ga0244775_10681015Not Available830Open in IMG/M
3300025048|Ga0207905_1013896All Organisms → Viruses → Predicted Viral1376Open in IMG/M
3300025079|Ga0207890_1040209Not Available824Open in IMG/M
3300025086|Ga0208157_1134024Not Available561Open in IMG/M
3300025101|Ga0208159_1009543Not Available2678Open in IMG/M
3300025120|Ga0209535_1111250Not Available954Open in IMG/M
3300025127|Ga0209348_1062056All Organisms → Viruses → Predicted Viral1229Open in IMG/M
3300025127|Ga0209348_1227071Not Available507Open in IMG/M
3300025132|Ga0209232_1004155Not Available6681Open in IMG/M
3300025137|Ga0209336_10119852Not Available722Open in IMG/M
3300025276|Ga0208814_1018711All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium2337Open in IMG/M
3300025759|Ga0208899_1119178Not Available952Open in IMG/M
3300025769|Ga0208767_1202699Not Available664Open in IMG/M
3300025828|Ga0208547_1005574All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage6172Open in IMG/M
3300025828|Ga0208547_1128493Not Available745Open in IMG/M
3300025849|Ga0209603_1003953All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage12651Open in IMG/M
3300025853|Ga0208645_1215441Not Available667Open in IMG/M
3300027196|Ga0208438_1081992Not Available523Open in IMG/M
3300028194|Ga0257106_1092080Not Available1100Open in IMG/M
3300031519|Ga0307488_10043935All Organisms → Viruses → environmental samples → uncultured virus3501Open in IMG/M
3300034374|Ga0348335_194382Not Available500Open in IMG/M
3300034375|Ga0348336_020695All Organisms → Viruses → Predicted Viral3414Open in IMG/M
3300034375|Ga0348336_213870Not Available502Open in IMG/M
3300034418|Ga0348337_123816Not Available787Open in IMG/M

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SeawaterEnvironmental → Aquatic → Marine → Strait → Unclassified → Seawater37.07%
MarineEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Marine20.69%
AqueousEnvironmental → Aquatic → Marine → Coastal → Unclassified → Aqueous18.97%
Pelagic MarineEnvironmental → Aquatic → Marine → Pelagic → Unclassified → Pelagic Marine3.45%
Surface SeawaterEnvironmental → Aquatic → Marine → Oceanic → Photic Zone → Surface Seawater2.59%
EstuarineEnvironmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine2.59%
MarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Marine2.59%
EstuarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine2.59%
MarineEnvironmental → Aquatic → Marine → Coastal → Unclassified → Marine1.72%
Salt MarshEnvironmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh1.72%
Estuarine WaterEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water1.72%
Deep OceanEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Deep Ocean0.86%
MarineEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Marine0.86%
SeawaterEnvironmental → Aquatic → Marine → Inlet → Unclassified → Seawater0.86%
Sackhole BrineEnvironmental → Aquatic → Marine → Coastal → Unclassified → Sackhole Brine0.86%
MarineEnvironmental → Aquatic → Marine → Neritic Zone → Unclassified → Marine0.86%

Visualization
Powered by ApexCharts



Associated Samples

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Taxon OIDSample NameHabitat TypeIMG/M Link
3300000116Marine microbial communities from Delaware Coast, sample from Delaware MO Spring March 2010EnvironmentalOpen in IMG/M
3300001450Marine viral communities from the Pacific Ocean - LP-53EnvironmentalOpen in IMG/M
3300001589Marine viral communities from the Pacific Ocean - LP-40EnvironmentalOpen in IMG/M
3300002488Marine viral communities from the Pacific Ocean - ETNP_2_60EnvironmentalOpen in IMG/M
3300004457Marine viral communities from Newfoundland, Canada MC-1EnvironmentalOpen in IMG/M
3300004461Marine viral communities from Newfoundland, Canada BC-2EnvironmentalOpen in IMG/M
3300006026Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_D_<0.8_DNAEnvironmentalOpen in IMG/M
3300006027Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_30_<0.8_DNAEnvironmentalOpen in IMG/M
3300006164Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG002-DNAEnvironmentalOpen in IMG/M
3300006352Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG108-DNAEnvironmentalOpen in IMG/M
3300006484Estuarine microbial communities from the Columbia River estuary, USA - metaG S.535EnvironmentalOpen in IMG/M
3300006735Marine viral communities from the Subarctic Pacific Ocean - 5B_ETSP_OMZ_AT15132_CsCl metaGEnvironmentalOpen in IMG/M
3300006737Marine viral communities from the Subarctic Pacific Ocean - 5_ETSP_OMZ_AT15132 metaGEnvironmentalOpen in IMG/M
3300006749Marine viral communities from the Subarctic Pacific Ocean - 9_ETSP_OMZ_AT15188 metaGEnvironmentalOpen in IMG/M
3300006752Marine viral communities from the Subarctic Pacific Ocean - 13_ETSP_OMZ_AT15268 metaGEnvironmentalOpen in IMG/M
3300006802Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18EnvironmentalOpen in IMG/M
3300006810Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Sep_01EnvironmentalOpen in IMG/M
3300006868Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_N_>0.8_DNAEnvironmentalOpen in IMG/M
3300006874Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_D_>0.8_DNAEnvironmentalOpen in IMG/M
3300006916Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_24EnvironmentalOpen in IMG/M
3300006919Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_21EnvironmentalOpen in IMG/M
3300006947Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG017-DNAEnvironmentalOpen in IMG/M
3300007345Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_30EnvironmentalOpen in IMG/M
3300007346Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_31EnvironmentalOpen in IMG/M
3300008012Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_N_<0.8_DNAEnvironmentalOpen in IMG/M
3300009079Estuarine microbial communities from the Columbia River estuary - Flood tide ETM metaG S.741EnvironmentalOpen in IMG/M
3300009086Estuarine microbial communities from the Columbia River estuary - Flood tide ETM metaG S.713EnvironmentalOpen in IMG/M
3300009472Pelagic marine microbial communities from North Sea - COGITO_mtgs_110404EnvironmentalOpen in IMG/M
3300009495Pelagic marine microbial communities from North Sea - COGITO_mtgs_120531EnvironmentalOpen in IMG/M
3300009505Pelagic marine microbial communities from North Sea - COGITO_mtgs_110523EnvironmentalOpen in IMG/M
3300009550Marine eukaryotic phytoplankton communities from Atlantic Ocean - South Atlantic ANT15 MetagenomeEnvironmentalOpen in IMG/M
3300010148Marine viral communities from the Subarctic Pacific Ocean - 9B_ETSP_OMZ_AT15188_CsCl metaGEnvironmentalOpen in IMG/M
3300012920Marine microbial communities from the Costa Rica Dome - CRUD Field 142mm St8 metaGEnvironmentalOpen in IMG/M
3300012936Marine microbial communities from the Costa Rica Dome - CRUD Field 142mm St13 metaGEnvironmentalOpen in IMG/M
3300012954Marine microbial communities from the Costa Rica Dome - CRUD Field 142mm St18 metaGEnvironmentalOpen in IMG/M
3300017708Marine viral communities from the Subarctic Pacific Ocean - Lowphox_04 viral metaGEnvironmentalOpen in IMG/M
3300017709Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 10 SPOT_SRF_2010-04-27EnvironmentalOpen in IMG/M
3300017710Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 26 SPOT_SRF_2011-09-28EnvironmentalOpen in IMG/M
3300017713Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 14 SPOT_SRF_2010-08-11EnvironmentalOpen in IMG/M
3300017714Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 35 SPOT_SRF_2012-08-15EnvironmentalOpen in IMG/M
3300017717Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 27 SPOT_SRF_2011-10-25EnvironmentalOpen in IMG/M
3300017719Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 13 SPOT_SRF_2010-07-21EnvironmentalOpen in IMG/M
3300017724Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 11 SPOT_SRF_2010-05-17EnvironmentalOpen in IMG/M
3300017726Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 4 SPOT_SRF_2009-09-24EnvironmentalOpen in IMG/M
3300017730Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 40 SPOT_SRF_2013-02-13EnvironmentalOpen in IMG/M
3300017732Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 38 SPOT_SRF_2012-12-11EnvironmentalOpen in IMG/M
3300017734Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 4 SPOT_SRF_2009-09-24 (version 2)EnvironmentalOpen in IMG/M
3300017735Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 54 SPOT_SRF_2014-05-21EnvironmentalOpen in IMG/M
3300017738Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 51 SPOT_SRF_2014-02-12EnvironmentalOpen in IMG/M
3300017739Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 56 SPOT_SRF_2014-09-10EnvironmentalOpen in IMG/M
3300017743Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 25 SPOT_SRF_2011-08-17EnvironmentalOpen in IMG/M
3300017746Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 12 SPOT_SRF_2010-06-29EnvironmentalOpen in IMG/M
3300017759Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 37 SPOT_SRF_2012-11-28EnvironmentalOpen in IMG/M
3300017764Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 8 SPOT_SRF_2010-02-11EnvironmentalOpen in IMG/M
3300017765Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 36 SPOT_SRF_2012-09-28EnvironmentalOpen in IMG/M
3300017768Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 6 SPOT_SRF_2009-12-23 (version 2)EnvironmentalOpen in IMG/M
3300017769Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 5 SPOT_SRF_2009-10-22 (version 2)EnvironmentalOpen in IMG/M
3300017771Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 48 SPOT_SRF_2013-11-13EnvironmentalOpen in IMG/M
3300017772Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 53 SPOT_SRF_2014-04-10EnvironmentalOpen in IMG/M
3300017773Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 9 SPOT_SRF_2010-03-24EnvironmentalOpen in IMG/M
3300017781Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 46 SPOT_SRF_2013-08-14EnvironmentalOpen in IMG/M
3300017782Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 3 SPOT_SRF_2009-08-19EnvironmentalOpen in IMG/M
3300017783Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 2 SPOT_SRF_2009-07-10EnvironmentalOpen in IMG/M
3300018416Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011502XT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300018420Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011512CT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300021957Estuarine water microbial communities from San Francisco Bay, California, United States - C33_18DEnvironmentalOpen in IMG/M
3300021959Estuarine water microbial communities from San Francisco Bay, California, United States - C33_13DEnvironmentalOpen in IMG/M
3300022074Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 56 SPOT_SRF_2014-09-10 (v2)EnvironmentalOpen in IMG/M
3300022187Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Sep_01 (v3)EnvironmentalOpen in IMG/M
3300023109 (restricted)Seawater microbial communities from Saanich Inlet, British Columbia, Canada - SI_122_August2016_10_MGEnvironmentalOpen in IMG/M
3300024346Whole water sample coassemblyEnvironmentalOpen in IMG/M
3300025048Marine viral communities from the Subarctic Pacific Ocean - LP-49 (SPAdes)EnvironmentalOpen in IMG/M
3300025079Marine viral communities from the Pacific Ocean - LP-48 (SPAdes)EnvironmentalOpen in IMG/M
3300025086Marine viral communities from the Subarctic Pacific Ocean - 5_ETSP_OMZ_AT15132 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025101Marine viral communities from the Subarctic Pacific Ocean - 9_ETSP_OMZ_AT15188 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025120Marine viral communities from the Pacific Ocean - LP-28 (SPAdes)EnvironmentalOpen in IMG/M
3300025127Marine viral communities from the Pacific Ocean - ETNP_2_30 (SPAdes)EnvironmentalOpen in IMG/M
3300025132Marine viral communities from the Pacific Ocean - ETNP_2_60 (SPAdes)EnvironmentalOpen in IMG/M
3300025137Marine viral communities from the Pacific Ocean - LP-32 (SPAdes)EnvironmentalOpen in IMG/M
3300025276Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG Antarct_55 (SPAdes)EnvironmentalOpen in IMG/M
3300025759Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_24 (SPAdes)EnvironmentalOpen in IMG/M
3300025769Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_21 (SPAdes)EnvironmentalOpen in IMG/M
3300025828Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_N_<0.8_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300025849Pelagic marine microbial communities from North Sea - COGITO_mtgs_120607 (SPAdes)EnvironmentalOpen in IMG/M
3300025853Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Sep_01 (SPAdes)EnvironmentalOpen in IMG/M
3300027196Estuarine microbial communities from the Columbia River estuary - Flood tide non-ETM metaG S.545 (SPAdes)EnvironmentalOpen in IMG/M
3300028194Marine microbial communities from Northeast Subartic Pacific Ocean, Canada - LP_J_2011_P26_10mEnvironmentalOpen in IMG/M
3300031519Sea-ice brine microbial communities from Beaufort Sea near Barrow, Alaska, United States - SB 0.2EnvironmentalOpen in IMG/M
3300034374Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_31 (v4)EnvironmentalOpen in IMG/M
3300034375Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_30 (v4)EnvironmentalOpen in IMG/M
3300034418Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_28 (v4)EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Protein ID Sample Taxon ID Habitat Sequence
DelMOSpr2010_10000687373300000116MarineMIDSLIYGTIASSFVIGITRSVLLLYAKFPRLGFGLIYGSLGVKMFAIGAFTLLAKPYIENIVIYAALILSAIIYSNVYVLLKLHGK*
JGI24006J15134_1012189913300001450MarineYGTIASSFVIGITRSVLLLYAKFPRLGFGLIYGSLGVKMFAIGAFTLLAKPYIENIVIYAALILSAIIYSNVYVLLKLHGK*
JGI24005J15628_1012564713300001589MarineMIDSLIYGTIASSFVIGITRSVLLLYAKFPRLGFGLIYGSLGVKMFAIGAFTLLAKPYIENVAIYAALILAAIIYSNVYVLLKLHGK*
JGI25128J35275_100748613300002488MarineMIDSLIYGVVASSFVIGITRSVLLLYKQFPRLGFGLVYGSLGVKMFALGAFTLLARPYIENVIIYCFIILSS
Ga0066224_101258883300004457MarineMIDSLIYGIIASSFILGITRSVLLLYARYPRLGFGLVYGSLGVKMFALGAFTLLAKPYIDNVVIYAALILSAIIYSNVYLLLKLRRK*
Ga0066223_106478593300004461MarineMIDSLIYGILASSFVIGITRSVLLLYAKFPRLGFGLIYGSLGVKMFAIGAFTLLAKPYIENVAIYAALILAAIIYSNVYVLLKLHGK*
Ga0075478_1001275233300006026AqueousMIDSLIYGIIASSFVIGITRSVLLLYKRFPRLGFGLIYGSLGVKMFALGAFTLLAKPYIENIVIYASIILSAIIYSNVYVLLKLHGK*
Ga0075462_1024167223300006027AqueousMIDSLIYGIIASSFVIGITRSVLLLYKRFPRLGFGLVYGSLGVKMFALGAFTLLAKPYIENIVIYASIILSAIIYSNVYVLLKLHGK*
Ga0075441_1001270333300006164MarineMIDSLIYGIIASSFVIGITRSVLLVYAKFPHLGFGLIYGSLGVKMFALGAFTLLAKPYIEDVVVYAALILSSIIYSNVYILIKLYRK*
Ga0075448_1000712913300006352MarineEYIKRFSIIYINMIDSLIYGIIASSFVIGITRSVLLVYAKFPHLGFGLIYGSLGVKMFALGAFTLLAKPYIEDVVVYAALILSSIIYSNVYILIKLYRK*
Ga0070744_1020143823300006484EstuarineMIDSLIYGAIASSFVIGITRSVLLLYKQFPRLGFGLIYGSLGVKMFALGAFTLLSKPYIDNVVIYAAFILSAIIYSNVYLLLKLRHK*
Ga0098038_106603733300006735MarineMIDSLIYGLIASSFVIGITRSVLLLYKRFPSLRFGLVYGSLGVKMFALGAFTLLAKPYIDNIVIYASIILSAIIYSNVYVLLKLHKK*
Ga0098037_103102743300006737MarineMIDSLIYGIVASSFVIGITRSVLLLYKRFPRLGFGLVYGSLGVKMFALGAFTLLAKPYIDNIIIYCSIILSSIIYSNVYLALKLHRK*
Ga0098042_1001400203300006749MarineMIDSLIYGVVASSFVIGITRSVLLLYKRFPRLGFGLVYGSLGVKMFALGAFTLLSKPYIDNIIIYCSIILSSIIYSNVYLALKLHRK*
Ga0098048_1002811123300006752MarineMIDSLIYGIVASSFVIGITRSVLLLYKRFPRLGFGLIYGSLGVKMFALGAFTLLAKPYIDNIVIYASIILSAIIYSNVYVLLKLHGK*
Ga0070749_1030774823300006802AqueousMIDSLIYGVVASSFVIGITRSVLLLYKRFPRLGFGLIYGSLGVKMFALGAFTLLAKPYIENIVIYASIILSAIIYSNVYVLLKLHGK*
Ga0070754_1027831323300006810AqueousMIDSLIYGIIASSFVIGITRCVLLLYARLPHLGFGLVYGSLGVKMFALGAFTLLARPYIDNVVIYASSILSAIIYSNVYLLLKLYRK*
Ga0075481_1010687623300006868AqueousMIDSLIYGIIASSFVIGITRCVLLLYARFPHLGFGLVYGSLGVKMFALGAFTLLARPYIDNVVIYASSILSAIIYSNVYLLLKLYRK*
Ga0075475_1014789213300006874AqueousMIDSLIYGIVASSFVIGITRSVLLLYKRFPRLGFGLIYGSLGVKMFALGAFTLLAKPYIENIVIYASIILSAIIYSNVYVLLKLHGK*
Ga0070750_1019058413300006916AqueousMIDSLIYGIIASSFVIGITRSVLLLYKRFPRLGFGLVYGSLGVKMFALGAFTLLAKPYIDNIVIYASIILSAIIYSNVYVLLKLHKK*
Ga0070746_1012193023300006919AqueousMIDSLIYGIIASSFVIGITRSVLLLYERFPRLGFGLIYGSLGVKMFALGAFTLLAKPYIENIVIYASIILSAIIYSNVYVLLKLHGK*
Ga0075444_1003432123300006947MarineMIDSLIYGIIASSFVIGITRSVLLVYAKFPRLGFGLIYGSLGVKMFALGAFTLLAKPYIEDVVVYAALILSSIIYSNVYILIKLYRK*
Ga0070752_100215513300007345AqueousMIDSLIYGIIASSFVIGITRSVLLLYKRFPRLGFGLIYGSLGVKMFALGVFTLLAKPYIENIVIYASIILSAIIYSNVYVLLKLHGK*
Ga0070752_104387653300007345AqueousMIDSLIYGIIASSFIIGITRCVLLLYARLPHLGFGLVYGSLGVKMFALGAFTLLARPYIDNVVIYASSILSAIIYSNVYLLLKLYRK*
Ga0070753_113541313300007346AqueousMIDSLIYGIIASSFIIGITRSVLLVYARFPHLGFGLVYGSLGVKMFALGAFTLLARPYIDNVVIYASSILSAIIYSNVYLLLKLYRK*
Ga0075480_1017478833300008012AqueousMIDSLIYGIIASSFVIGITRCVLLLYARFPHLGFGLVYGSLGVKMFALGAFTLLSKPYIDNVVIYASSILSAIIYSNVYLLLKLYRK*
Ga0102814_1086890113300009079EstuarineMIDSLIYGTIASSFVIGITRSVLLLYAKFPRLGFGLIYGSLGVKMFAIGAFTLLAKPYIENIVIYAALILSAIIYSNVYV
Ga0102812_1026162433300009086EstuarineMIDSLIYGIIASSFILGITRSVLLLYAKFPRLGFGLVYGSLGVKMFALGAFTLLSKPYINNVVIYAALILSAIIYSNVYLLLKLSRK*
Ga0115554_136655013300009472Pelagic MarineMIDSLIYGTIASSFVIGITRSVLLLYAKFPRLGFGLIYGSLGVKMFAIGAFTLLAKPYIENIVIYAALILSAIIYSNVY
Ga0115571_107401533300009495Pelagic MarineMIDSLIYGTIASSFVIGITRSVLLLYAKFPRLGFGLIYGSLGVKMFAIGAFTLLAKPYIENIVIYAALILSAIIYSNVYVLLKLHRK*
Ga0115564_1054351213300009505Pelagic MarineMIDSLIYGIIASSFVIGITRSVLLLYKRFPHLGFGLVYGSLGVKMFALGAFTLLARPHIENVIIYCFIILSSIIYSNVYLALKLHRK*
Ga0115013_1045170923300009550MarineMIDSLIYGIVASSFVIGITCSVLLLYKRFPRLGFGLVYGSLGVKMFALGAFTLLSRPYIENVIIYCFIILSSIIYSNVYLALKLHRK*
Ga0098043_101837543300010148MarineMIDSLIYGIIASSFVIGITRSVLLLYKRFPSLRFGLVYGSLGVKMFALGAFTLLAKPYIDNIVIYASIILSAIIYSNVYVLLKLHKK*
Ga0160423_1016000813300012920Surface SeawaterMIDSLIYGVLASSFVIGITRSVLLLYKRFPRLGFGLIYGSLGVKMFALGAFTLLAKPYIKDTIIYAFLILSAIIYSNVYVLLKLHRK*
Ga0163109_1128624723300012936Surface SeawaterMIDSLIYGIVASSFVIGITRSVLLLYKRFPRLGFGLIYGSLGVKMFALGAFTLLSSPYIENFIIYCFIILSSIIYSNVYLALKLHRK*
Ga0163111_1047341733300012954Surface SeawaterMIDSLIYGIVASSFVIGITRSVLLLYKRFPRLGFGLVYGSLGVKMFALGAFTLLSKPYIDNIIIYCSIILSSIIYSNVYLALKLHRK*
Ga0181369_100389713300017708MarineIYINMIDSLIYGAIASSFVIGITRSVLLLYKRYPRLGFGLIYGSLGVKMFTLGAFTLLAKPYIENIVIYASIILSAIIYSNVYVLLKLHRK
Ga0181369_101175763300017708MarineMIDSLIYGLIASSFVIGITRSVLLLYKRFPSLGFGLVYGSLGVKMFALGAFTLLAKPYIDNIVIYASIILSAIIYSNVYVLLKLHKK
Ga0181369_102932643300017708MarineMIDSLIYGIVASSFVIGITRSVLLLYKRFPRLGFGLVYGSLGVKMFALGAFTLLAKPYIDNIIIYCSIILSSIIYSNVYLALKLHRK
Ga0181369_104201813300017708MarineMIDSLIYGLIASSFVIGITRSVLLLYKRFPRLGFGLIYGSLGVKMFALGAFTLLAKPYIDNIVIYASIILSAIIYSNVY
Ga0181369_106173823300017708MarineMIDSLIYGIVASSFVIGITRSVLLLYKRFPRLGFGLIYGSLGVKMFALGAFTLLAKPYIDNIVIYASIILSAIIYSNVYVFLKLHGK
Ga0181369_110066413300017708MarineMIDSLIYGVIASSFVIGITRSVLLLYKRFPSLGFGLIYGSLGVKMFALGAFTLLAKPYIDNIVIYASIILSAIIYSNVYV
Ga0181387_101583813300017709SeawaterMIDSLIYGTIASSFVIGITRSVLLLYAKFPRLGFGLIYGSLGVKMFAIGAFTLLAKPCIENIVIYAALILSAIIYSNVYVLLKLHGK
Ga0181387_107205513300017709SeawaterMIDSLIYGIIASSFVIGITRSVLLLYKRFPRLGFGLIYGSLGVKMFALGAFTLLAKPYIDNIVIYASIILSAIIYSNVYVLLKLHRK
Ga0181387_109620223300017709SeawaterFFDNIHYFSIIYINMIDSLIYGIIASSFILGITRSVLLLYAKFPRLGFGLIYGSLGVKMFALGAFTLLSKPYIDNVVIYAAFILSAIIYSNVYLLLKLRHK
Ga0181403_100385513300017710SeawaterSFVIGITRSVLLLYKRFPRLGFGLIYGSLGVKMFALGAFTLLSKPYIDNIVIYASIILSAIIYSNVYVLLKLHGK
Ga0181403_101882543300017710SeawaterMIDSLIYGTIASSFVIGITCSVLLLYAKFPRLGFGLIYGSLGVKMFAIGAFTLLAKPYIENIVIYAALILSAIIYSNVYVLLKLHGK
Ga0181403_103020943300017710SeawaterSFVIGITRSVLLLYKRFPRLGFGLIYGSLGVKMFALGAFTLLAKPYIDNIVIYASIILSAIIYSNVYVLLKLHGK
Ga0181391_102625413300017713SeawaterMIDSLIYGIVASSFVIGITRSVLLLYKRFPRLGFGLIYGSLGVKMFALGAFTLLAKPYIDNIVIYASIILSAIIYSNVYVLLKLHRK
Ga0181412_113381513300017714SeawaterMIDSLIYGTIASSFVIGITRSVLLLYKRFPRLGFGLIYGSLGVKMFALGAFTLLSKPYIDNIVIYASIILSAIIYSNVYVLLKLRL
Ga0181404_1001234123300017717SeawaterMIDSLIYGIIASSFILGITRSVLLLYAKFPRLGFGLVYGSLGVKMFALGAFTLLSKPYINNVVIYAALILSAIIYSNVYLLLKLRRK
Ga0181404_103294843300017717SeawaterMIDSLIYGIVASSFVIGITRSVLLLYKRYPRLGFGLIYGSLGVKMFVLGAFTLLAKPYIENIVIYASIILSAIIYSNVYVLLKLRL
Ga0181390_101376463300017719SeawaterMIDSLIYGIIASSFILGITRSVLLLYAKFPRLGFGLVYGSLGVKMFALGAFTLLSKPYIDNVVIYAAFILSAIIYSNVYLLLKLRRK
Ga0181390_103820143300017719SeawaterMIDSLIYGIVASSFVIGITRSVLLLYKRFPRLGFGLIYGSLGVKMFALGAFTLLSKPYIDNIVIYASIILSAIIYSNVYVLLKLHRK
Ga0181390_106732023300017719SeawaterMIDSLIYGAIASSFVIGITRSVLLLYAKFPRLGFGLVYGSLGVKMFALGAFTLLSKPYIDNVVIYAAFILSAIIYSNVYLLLKLRHK
Ga0181388_104560123300017724SeawaterMIDSLIYGIIASSFILGITRSVLLLYAKFPRLGFGLVYGSLGVKMFALGAFTLLARPYIENVIIYCFIILSSIIYSNVYLALKLHRK
Ga0181381_105683323300017726SeawaterMIDSLIYGIVASSFVIGITRSVLLLYKRFPRLGFGLIYGSLGVKMFALGAFTLLAKPYIDNIVIYASIILSAIIYSNVYVLLK
Ga0181417_102671723300017730SeawaterMIDSLIYGIVASSFVIGITRSVLLLYKRFPRLGFGLIYGSLGVKMFALGAFTLLSKPYIDNIVIYASIILSAIIYSNVYVLLKLHGK
Ga0181415_101412063300017732SeawaterVIGITRSVLLLYKRFPRLGFGLIYGSLGVKMFALGAFTLLAKPYIDNIVIYASIILSAIIYSNVYVLLKLHGK
Ga0181415_105609813300017732SeawaterNMIDSLIYGVVASSFVIGITRSVLLLYKQFPRLGFGLVYGSLGVKMFALGAFTLLARPYIENVIIYCFIILSSIIYSNVYLALKLHRK
Ga0187222_100462913300017734SeawaterMIDSLIYGIVVSSFVIGITRSVLLLYKRFPSLGFGLVYGSLGVKMFALGAFTLLARPYIENVIIYCFIILSSIIYSNVYLALKLHRK
Ga0187222_102233543300017734SeawaterFDNTHYFSIIYINMIDSLIYGAIASSFVIGITRSVLLLYKQFPRLGFGLIYGSLGVKMFALGAFTLLSKPYIDNVVIYAAFILSAIIYSNVYLLLKLRHK
Ga0181431_101091133300017735SeawaterMIDSLIYGIIASSFVIGITRSVLLLYKRFPRLGFGLIYGSLGVKMFALGAFTLLSKPYIDNIVIYASIILSAIIYSNVYVLLKLHGK
Ga0181428_1000316243300017738SeawaterMIDSLIYGIVASSFVIGITRSVLLLYKRFPSLGFGLVYGSLGVKMFALGAFTLLARPYIENVIIYCFIILSSIIYSNVYLALKLHRN
Ga0181428_108232823300017738SeawaterMIDSLIYGVVASSFVIGITRSVLLLYKQFPRLGFGLVYGSLGVKMFALGAFTLLARPYIENVIIYCFMILSSIIYSNVYLALKLHRK
Ga0181433_101746443300017739SeawaterMIDSLIYGVIASSFVIGITRSVLLLYKRYPRLGFGLIYGSLGVKMFVLGAFTLLAKPYIENIVIYASIILSAIIYSNVYVLLKLRL
Ga0181433_105114313300017739SeawaterMIDSLIYGVVASSFVIGITRSVLLLYKRFPSLGFGLVYGSLGVKMFALGAFTLLARPYINNVVIYAALILSAIIYSNVYLLLKLRRK
Ga0181402_103789533300017743SeawaterMIDSLIYGAIASSFVIGITRSVLLLYKQFPRLGFGLVYGSLGVKMFALGAFTLLSKPYIDNVVIYAAFILSAIIYSNVYLLLKLRHK
Ga0181389_101030643300017746SeawaterMIDSLIYGTIASSFVIGITRSVLLLYAKFPRLGFGLIYGLLGVKMFAIGAFTLLAKPCIENIVIYAALILSAIIYSNVYVLLKLHGK
Ga0181414_103013833300017759SeawaterMIDSLIYGIVASSFVIGITRSILLLYKRYPRLGFGLIYGSLGVKMFVLGAFTLLAKPYIENIVIYASIILSAIIYSNVYVLLKLHGK
Ga0181414_115849113300017759SeawaterMIDSLIYGIIASSFILGITRSVLLLYAKFPRLGFGLVYGSLGVKMFALGAFTLLSKPYIDNVVIYAALILSA
Ga0181385_107007633300017764SeawaterMIDTLIYGIVASSFVIGITRSVLLLYKRFPRLGFGLIYGSLGVKMFALGAFTLLAKPYIDNIVIYASIILSAIIYSNVYVLLKLHGK
Ga0181413_107363343300017765SeawaterIVASSFVIGITRSVLLLYKRFPRLGFGLIYGSLGVKMFALGAFTLLAKPYIDNIVIYASIILSAIIYSNVYVLLKLHGK
Ga0187220_102323543300017768SeawaterMIDSLIYGIIASSFILGITRSVLLLYAKFPRLGFGLVYGSLGVKMFALGAFTLLSKPYINNVVIYAALILSAIIYSNVYLLLKLRHK
Ga0187221_100820383300017769SeawaterMIDSLIYGIVASSFVIGITRSVLLLYKRFPRLGFGLVYGSLGVKMFALGAFTLLARPLIENVIIYCFIILSSIIYSNVYLALKLHRK
Ga0187221_102456933300017769SeawaterMIDSLIYGAIASSLVIGITRSVLLLYKQFPRLGFGLIYGSLGVKMFALGAFTLLSKPYIDNVVIYAAFILSAIIYSNVYLLLKLRHK
Ga0181425_117729913300017771SeawaterMIDSLIYGAIASSFVIGITRSVLLLYKQFPRLGFGLIYGSLGVKMFALGAFTLLSKPYINNVVIYAALILSAIIYSNVYLLLKLRRK
Ga0181430_103768023300017772SeawaterMIDSLIYGTIASSFVIGITRSVLLLYAKFPRLGLGLIYGSLGVKMFAIGAFTLLAKPYIENIVIYAALILSAIIYSNVYVLLKLHGK
Ga0181386_108674313300017773SeawaterMIDSLIYGIIASSFILGITRSVLLLYAKFPRLGFGLVYGSLGVKMFALGAFTLLSKPYINNVVIYAAFILSAIIYSNVYLLLKLRRK
Ga0181423_132734413300017781SeawaterMIDSLIYGIVASSFVIGITRSVLLLYKRFPRLGFGLIYGSLGVKMFALGAFTLLARPYIENVIIYCFIILSSIIYSNVYLALK
Ga0181380_105224213300017782SeawaterYFSIIYINMIDSLIYGAIASSFVIGITRSVLLLYAKFPRLGFGLVYGSLGVKMFALGAFTLLSKPYIDNVVIYAAFILSAIIYSNVYLLLKLRHK
Ga0181380_105656313300017782SeawaterSSFVIGITRSVLLLYKRFPRLGFGLIYGSLGVKMFALGAFTLLSKPYIDNVVIYAALILSAIIYSNVYVLLKLHGK
Ga0181379_107789913300017783SeawaterMIDSLIYGIIASSFILGITRSVLLLYAKFPRLGFGLVYGSLGVKMFALGAFTLLSKPYIDNVVIYAALILSAIIYSNVYLLLKLRRK
Ga0181553_1055044623300018416Salt MarshMIDSLIYGIIASSFVIGITRSVLLLYKRFPRLGFGLIYGSLGVKMFALGAFTLLAKPYIKDTIIYAFLILSAIIYSNVYVLLKLHGK
Ga0181563_1006511053300018420Salt MarshMIDSLIYGIIASSFVIGITRSVLLLYKRFPRLGFGLIYGSLGVKMFALGAFTLLAKPYIENIVIYASIILSAIIYSNVYVLLKLHGK
Ga0222717_1020630323300021957Estuarine WaterMIDSLIYGAIASSFVIGITRSVLLLYKQFPRLGFGLIYGSLGVKMFALGAFTLLSKPYIDNVVIYAAFILSAIIYSNVYLLLKLRHK
Ga0222716_1046635123300021959Estuarine WaterMIDSLIYGIIASSFILGITRSVLLLYAKFPRLGFGLVYGSLGVKMFALGAFTLLSKPYIDNVVIYAAFILSAIIYSNVYLLLKLRHK
Ga0224906_100010623300022074SeawaterMIDSLIYGIVASSFVIGITRSVLLLYKRFPRLGFGLIYGSLGVKMFALGAFTLLAKPYIDNIVIYASIILSAIIYSNVYVLLKLHGK
Ga0224906_100146613300022074SeawaterMIDSLIYGIVASSFVIGITRSVLLLYKRFPSLGFGLVYGSLGVKMFALGAFTLLARPYIENVIIYCFIILSSIIYSNVYLALKLHRK
Ga0196899_108895823300022187AqueousMIDSLIYGVVASSFVIGITRSVLLLYERFPRLGFGLIYGSLGVKMFALGAFTLLAKPYIENIVIYASIILSAIIYSNVYVLLKLHGK
(restricted) Ga0233432_1005528613300023109SeawaterMIDSLIYGIIASSFILGITRSVLLLYAKFPRLGFGLVYGSLGVKMFALGAFTLLSKPYINNVVIYAALILSAIIYSNVYLLLKLSRK
Ga0244775_1052976913300024346EstuarineMIDSLIYGTIASSFVIGITRSVLLLYAKFPRLGFGLIYGSLGVKMFAIGAFTLLAKPYIENIVIYAALILSAIIYSNVYVLLKLHGK
Ga0244775_1068101523300024346EstuarineLIYGAIASSFVIGITRSVLLLYKQFPRLGFGLIYGSLGVKMFALGAFTLLSKPYIDNVVIYAAFILSAIIYSNVYLLLKLRHK
Ga0207905_101389633300025048MarineMIDSLIYGVIASSFILGITRSVLLLYARYPRLGFGLVYGSLGVKMFALGAFTLLARPYIDNVVIYAALILSAIIYSNVYLLLKLRRK
Ga0207890_104020923300025079MarineMIDSLIYGTIASSFVIGITRSVLLLYAKFPRLGFGLIYGSLGVKMFAIGAFTLLAKPYIENVAIYAALILAAIIYSNVYVLLKLHGK
Ga0208157_113402413300025086MarineMIDSLIYGIIASSFVIGITRSVLLLYKRFPSLRFGLVYGSLGVKMFALGAFTLLAKPYIDNIVIYASIILSAIIYSNVYVLLKLHKK
Ga0208159_100954333300025101MarineMIDSLIYGVVASSFVIGITRSVLLLYKRFPRLGFGLVYGSLGVKMFALGAFTLLSKPYIDNIIIYCSIILSSIIYSNVYLALKLHRK
Ga0209535_111125013300025120MarineMIDSLIYGLIASSFVIGITRSVLLLYKRFPRLGFGLVYGSLGVKMFALGAFTLLARPYIENVIIYCFIILSSIIYSNVYLALKLHHK
Ga0209348_106205613300025127MarineMIDSLIYGVVASSFVIGITRSVLLLYKQFPRLGFGLVYGSLGVKMFALGAFTLLARPYIENVIIYCFIILSSIIYSNVYLALKLHRK
Ga0209348_122707123300025127MarineIDSLIYGIVASSFVIGITRSVLLLYKRFPRLGFGLVYGSLGVKMFALGAFTLLSKPYIDNIIIYCSIILSSIIYSNVYLALKLHRK
Ga0209232_100415543300025132MarineMIDSLIYGIVASSFVIGITRSVLLLYKRFPRLGFGLVYGSLGVKMFALGAFTLLSKPYIDNIIIYCSIILSSIIYSNVYLALKLHRK
Ga0209336_1011985223300025137MarineMIDSLIYGLIASSFVIGITRSVLLLYKRFPRLGFGLVYGSLGVKMFALGAFTLLARPYIENVIIYCFIILSSIIYSNVYLALKLYHK
Ga0208814_101871143300025276Deep OceanMIDSLIYGIIASSFVIGITRSVLLVYAKFPHLGFGLIYGSLGVKMFALGAFTLLAKPYIEDVVVYAALILSSIIYSNVYILIKLYRK
Ga0208899_111917833300025759AqueousMIDSLIYGIIASSFVIGITRSVLLLYKRFPRLGFGLVYGSLGVKMFALGAFTLLAKPYIDNIVIYASIILSAIIYSNVYVLLKLHKK
Ga0208767_120269923300025769AqueousHMIDSLIYGIIASSFVIGITRSVLLLYKRFPRLGFGLIYGSLGVKMFALGAFTLLAKPYIENIVIYASIILSAIIYSNVYVLLKLHGK
Ga0208547_1005574143300025828AqueousMIDSLIYGVVASSFVIGITRSVLLLYKRFPRLGFGLIYGSLGVKMFALGAFTLLAKPYIENIVIYASIILSAIIYSNVYVLLKLHGK
Ga0208547_112849313300025828AqueousMIDSLIYGIIASSFMIGITRCVLLLYARFPHLGFGLVYGSLGVKMFALGAFTLLARPYIDNVVIYASSILSAIIYSNVYLLLKLYRK
Ga0209603_1003953143300025849Pelagic MarineMIDSLIYGIIASSFVIGITRSVLLLYKRFPHLGFGLVYGSLGVKMFALGAFTLLARPYIENVIIYCFIILSSIIYSNVYLALKLHRK
Ga0208645_121544113300025853AqueousMIDSLIYGIIASSFIIGITRSVLLVYARFPHLGFGLVYGSLGVKMFALGAFTLLARPYIDNVVIYASSILS
Ga0208438_108199223300027196EstuarineIYGTIASSFVIGITRSVLLLYAKFPRLGFGLIYGSLGVKMFAIGAFTLLAKPYIENIVIYAALILSAIIYSNVYVLLKLHGK
Ga0257106_109208033300028194MarineMIDSLIYGIIASSFVIGITRSVLLLYAKFPRLGFGLIYGSLGVKMFAIGAFTLLAKPYIENVAIYAALILAAIIYSNVYVLLKLHGK
Ga0307488_1004393523300031519Sackhole BrineMIDSLIYGIIASSFILGITRSVLLLYARYPRLGFGLVYGSLGVKMFALGAFTLLAKPYIENIVIYAALILSSIIYSNVYLLLKLRRK
Ga0348335_194382_233_4963300034374AqueousMIDSLIYGIIASSFIIGITRSVLLVYARFPHLGFGLVYGSLGVKMFALGAFTLLARPYIDNVVIYASSILSAIIYSNVYLLLKLYRK
Ga0348336_020695_418_6813300034375AqueousMIDSLIYGVVASSFVIGITRSVLLLYKRFPRLGFGLVYGSLGVKMFALGAFTLLAKPYIENIVIYASIILSAIIYSNVYVLLKLHGK
Ga0348336_213870_216_5003300034375AqueousFSIIYINMIDSLIYGIIASSFIIGITRCVLLLYARLPHLGFGLVYGSLGVKMFALGAFTLLARPYIDNVVIYASSILSAIIYSNVYLLLKLYRK
Ga0348337_123816_299_5623300034418AqueousMIDSLIYGIIASSFVIGITRCVLLLYARLPHLGFGLVYGSLGVKMFALGAFTLLARPYIDNVVIYASSILSAIIYSNVYLLLKFYRK

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.