Basic Information | |
---|---|
Family ID | F079533 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 115 |
Average Sequence Length | 48 residues |
Representative Sequence | VSTQLVLNKYNTNYEALRLADSTALAFKSWQNFIKANYYKLMNYH |
Number of Associated Samples | 88 |
Number of Associated Scaffolds | 115 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Unclassified |
% of genes with valid RBS motifs | 55.65 % |
% of genes near scaffold ends (potentially truncated) | 85.22 % |
% of genes from short scaffolds (< 2000 bps) | 99.13 % |
Associated GOLD sequencing projects | 88 |
AlphaFold2 3D model prediction | No |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Unclassified (93.043 % of family members) |
NCBI Taxonomy ID | N/A |
Taxonomy | N/A |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Switchgrass Phyllosphere (55.652 % of family members) |
Environment Ontology (ENVO) | Unclassified (78.261 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant surface (65.217 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 91.11% β-sheet: 0.00% Coil/Unstructured: 8.89% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 115 Family Scaffolds |
---|---|---|
PF07727 | RVT_2 | 0.87 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
Unclassified | root | N/A | 93.04 % |
All Organisms | root | All Organisms | 6.96 % |
Visualization |
---|
Powered by ApexCharts |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Switchgrass Phyllosphere | Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Switchgrass Phyllosphere | 55.65% |
Phyllosphere | Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Phyllosphere | 13.91% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 6.09% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 6.09% |
Switchgrass Associated | Host-Associated → Plants → Unclassified → Unclassified → Unclassified → Switchgrass Associated | 3.48% |
Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 2.61% |
Switchgrass Degrading | Engineered → Bioreactor → Unclassified → Unclassified → Unclassified → Switchgrass Degrading | 2.61% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 1.74% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 1.74% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 1.74% |
Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 0.87% |
Host-Associated | Host-Associated → Human → Digestive System → Large Intestine → Fecal → Host-Associated | 0.87% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.87% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.87% |
Switchgrass Associated | Host-Associated → Plants → Phyllosphere → Leaf → Endophytes → Switchgrass Associated | 0.87% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300004801 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 | Host-Associated | Open in IMG/M |
3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Host-Associated | Open in IMG/M |
3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Host-Associated | Open in IMG/M |
3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Host-Associated | Open in IMG/M |
3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Host-Associated | Open in IMG/M |
3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Environmental | Open in IMG/M |
3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Environmental | Open in IMG/M |
3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Environmental | Open in IMG/M |
3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Host-Associated | Open in IMG/M |
3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Host-Associated | Open in IMG/M |
3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Host-Associated | Open in IMG/M |
3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Host-Associated | Open in IMG/M |
3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Host-Associated | Open in IMG/M |
3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Host-Associated | Open in IMG/M |
3300009974 | Switchgrass associated microbial communities from Austin, Texas, USA - LS_119 metaG | Host-Associated | Open in IMG/M |
3300009976 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_186 metaG | Host-Associated | Open in IMG/M |
3300009978 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_199 metaG | Host-Associated | Open in IMG/M |
3300009993 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_106 metaG | Host-Associated | Open in IMG/M |
3300009995 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_227 metaG | Host-Associated | Open in IMG/M |
3300010267 | Switchgrass degrading microbial communities from high solid loading bioreactors in New Hampshire, USA - 12_48_3.3_201_A2 metaG | Engineered | Open in IMG/M |
3300010285 | Switchgrass degrading microbial communities from high solid loading bioreactors in New Hampshire, USA - 2_5_20_6_A2 metaG | Engineered | Open in IMG/M |
3300010371 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1 | Environmental | Open in IMG/M |
3300010400 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2 | Environmental | Open in IMG/M |
3300010403 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3 | Environmental | Open in IMG/M |
3300012949 | Switchgrass enrichment cultures co-assembly | Engineered | Open in IMG/M |
3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Host-Associated | Open in IMG/M |
3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Host-Associated | Open in IMG/M |
3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Host-Associated | Open in IMG/M |
3300015270 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_22AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015284 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_09MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015290 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_09MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015293 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_09MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015297 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_09MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015301 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_22AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015309 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_MAIN_09MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015310 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_MAIN_01AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015311 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_22AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015313 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_01AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015315 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_31MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015316 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_31MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015317 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_20JUN2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015324 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_20JUN2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015325 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_12JUL2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015326 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_01AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015327 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_MAIN_31MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015328 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_12JUL2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015329 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_20JUN2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015332 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_31MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015333 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_12JUL2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015334 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_20JUN2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015336 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_12JUL2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015337 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_12JUL2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015338 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_20JUN2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015340 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_20JUN2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015348 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_31MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015349 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_22AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015352 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_01AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015353 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_22AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
3300017408 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_12SEP2016_LD1 MG | Host-Associated | Open in IMG/M |
3300017412 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_12SEP2016_LD1 MG | Host-Associated | Open in IMG/M |
3300017414 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_12SEP2016_LD1 MG | Host-Associated | Open in IMG/M |
3300017422 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_12SEP2016_LD1 MG | Host-Associated | Open in IMG/M |
3300017435 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_MAIN_12SEP2016_LD1 MG | Host-Associated | Open in IMG/M |
3300017439 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_12SEP2016_LD1 MG | Host-Associated | Open in IMG/M |
3300017693 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_03OCT2016_LD1 MG | Host-Associated | Open in IMG/M |
3300028050 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_NF_17JUL2017_LD1 | Host-Associated | Open in IMG/M |
3300028053 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_NF_28AUG2017_LD1 | Host-Associated | Open in IMG/M |
3300028054 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_NF_15MAY2017_LD1 | Host-Associated | Open in IMG/M |
3300028055 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_NF_07AUG2017_LD1 | Host-Associated | Open in IMG/M |
3300028056 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_NF_17JUL2017_LD1 | Host-Associated | Open in IMG/M |
3300028058 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_MAIN_07AUG2017_LD1 | Host-Associated | Open in IMG/M |
3300028064 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_MAIN_28AUG2017_LD1 | Host-Associated | Open in IMG/M |
3300028142 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R4_NF_28AUG2017_LD1 | Host-Associated | Open in IMG/M |
3300028152 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_NF_07AUG2017_LD1 | Host-Associated | Open in IMG/M |
3300028154 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R2_MAIN_28AUG2017_LD1 | Host-Associated | Open in IMG/M |
3300028262 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_MAIN_05JUN2017_LD1 | Host-Associated | Open in IMG/M |
3300028529 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R4_MAIN_05JUN2017_LD1 | Host-Associated | Open in IMG/M |
3300032466 | Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R2_NF_12SEP2016_LR2 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
3300032697 | Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R2_MAIN_12SEP2016_LR1 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
3300032790 | Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_MAIN_26JUN2017_LR1 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
3300032844 | Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_17JUL2017_LR1 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
3300032875 | Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_26JUN2017_LR1 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
3300032918 | Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_05JUN2017_LR1 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
3300032934 | Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_17JUL2017_LR1 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
3300032959 | Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_26JUN2017_LR1 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
3300033534 | Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_28AUG2017_LR1 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
3300033542 | Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_18SEP2017_LR1 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
Ga0058860_118810571 | 3300004801 | Host-Associated | VSTQLVLNKYNTNYEALRLADSTALAFKCWQNFIKAIYYELMNYH* |
Ga0065704_100468612 | 3300005289 | Switchgrass Rhizosphere | VSTQLVLNKYNTNYEALRLADSTALAFKCWQDFIKAIYYELMNYH* |
Ga0070670_1013283492 | 3300005331 | Switchgrass Rhizosphere | VSTQLVLNKYNTNYEALRLADSTVLAFKSWQNFIKANYYKLMNYRKPSYIVINQNYP* |
Ga0070670_1015311242 | 3300005331 | Switchgrass Rhizosphere | RGKSREEARVSTQLVLNKYNTNYEALKLADSTALAFKSWQSFITTIYYKLMNYHKPSYIVINQN* |
Ga0070666_106971971 | 3300005335 | Switchgrass Rhizosphere | VSTQLVLNKYNTNYEALRLADSTALAFKSWQNFITAIYYKLVNYHKPS* |
Ga0070666_112195481 | 3300005335 | Switchgrass Rhizosphere | VSTQLVLNKYNTNYEALRLADSTALAFKSWQNFIKANYYKWMNYHKPSYIVINQN* |
Ga0070671_1011204782 | 3300005355 | Switchgrass Rhizosphere | VSTQLVLNKYNTNYEALRLADSTALAFKSWQNFIKANYYK |
Ga0070671_1011561311 | 3300005355 | Switchgrass Rhizosphere | VSTQLVLNKYNTNYEALRLADSTALAFKSWQNFITAIYYKLVNYHKPSYIVINQN* |
Ga0070667_1021918711 | 3300005367 | Switchgrass Rhizosphere | VSTQLVLNKYNTNYEALRLADSTALAFKSWQNFIKAIYYKWMNYHKPSYIVINQN* |
Ga0070708_1005332752 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | EARVSTQLVLNKYNTNYEALRLADSTALAFKSWQSFIKANYYKLMNYHEPRL* |
Ga0070686_1017692401 | 3300005544 | Switchgrass Rhizosphere | VSTQLVLNKYNTNYEDLRLADSTTLAFKSWQNFITAIYYKLVNYHKPSYIVINQN* |
Ga0070704_1017630391 | 3300005549 | Corn, Switchgrass And Miscanthus Rhizosphere | LNKYNTNYEALRLADSTALAFKSWQNFIKANYYKLMNYHKPNYIVINQN* |
Ga0068864_1021056491 | 3300005618 | Switchgrass Rhizosphere | VSTQLVLNKYNTNYEALRLADSTALAFKSWQYFIKAIYYELMNYH* |
Ga0068863_1023436702 | 3300005841 | Switchgrass Rhizosphere | KRTRGKSVEEARVSTQLVLNKYNTNYEALRLADSTALAFKPWQNFIKANYYKLMNYQKPSYIVINQN* |
Ga0068863_1024120992 | 3300005841 | Switchgrass Rhizosphere | VSTQLVLNKYNTSYEALRLADSTAFAFKCWQDFIKAIYYELMNYH* |
Ga0068858_1011948672 | 3300005842 | Switchgrass Rhizosphere | VSTQLVLNKYNTNYEALRLADSTALAFKSWQNFIKA |
Ga0068860_1012486781 | 3300005843 | Switchgrass Rhizosphere | VSTQLVLNKYNTNYEALMLADPIALAFKSWQNFIKANYYKLMYYHKPSYIVINQN* |
Ga0068862_1026445331 | 3300005844 | Switchgrass Rhizosphere | VSTQLVLNKYNTNYDALRLADSTALAFKSWQNFIKTIYYKLMNYHKPSYIVINQNLSCYY |
Ga0068862_1027291552 | 3300005844 | Switchgrass Rhizosphere | VSTQLVLNKYNTNYEALRLADSTVLAFKSWQSFIKANYYKWMNYHKLSYIVINQN* |
Ga0105247_112032642 | 3300009101 | Switchgrass Rhizosphere | AYPRGKSREEARVSTQLVLNKYNTNYEALRLADSTALAFKSWQNFIKAIYYKLMNYHKTQLHSN* |
Ga0105039_1109521 | 3300009974 | Switchgrass Associated | VSTQLVLNKYNTNYEALRLADSTALAFKCWQNFIKAIYYKLMNYH* |
Ga0105128_1138271 | 3300009976 | Switchgrass Associated | VSTQLVLNKYNTNYEALMLPDSTALAFKSWQNFIKTNYYKLVNYH |
Ga0105148_1190392 | 3300009978 | Switchgrass Associated | YPRGKSREEARVSTQLVLNKYNTNYEALRLADSTALAFKCWQNFIKAIYYELMNYH* |
Ga0105028_1217931 | 3300009993 | Switchgrass Associated | STQLVLNKYNTNYEALRLADSTALAFKSWQNFIKANYYKLMNYHKPSYIVINQN* |
Ga0105139_10923411 | 3300009995 | Switchgrass Associated | STQLVLNKYNTNYEALRLADSTALAFKCWQNFIKAIYYELMYYH* |
Ga0134101_10553961 | 3300010267 | Switchgrass Degrading | LNKYNTNYEALRLADSTAFAFKSWQDFIKAIYYELMNYH* |
Ga0134091_10643211 | 3300010285 | Switchgrass Degrading | VSTQLVLNKYNTNYEALRLADSTALAFKCWQNFIKAIYYELMKPLTQLHSN |
Ga0134125_113243151 | 3300010371 | Terrestrial Soil | MQLVLKKYNTNYEALRLADPTALAFKSWQNFIKANYYKLMYYHKPSYIVINQN* |
Ga0134122_124490131 | 3300010400 | Terrestrial Soil | VSTQLVLNKYNTNYEDLRLADSTTLAFKSWQNFITA |
Ga0134123_131757911 | 3300010403 | Terrestrial Soil | VSTQLVLNKYNTNYEALRLADSTALAFNLGKILLKLFYYKWMNYHKPSYI |
Ga0153798_102848761 | 3300012949 | Switchgrass Degrading | VSTQLVLNKYNTNYEALRLADSTALAFKSWQNFIKANY |
Ga0163162_129045391 | 3300013306 | Switchgrass Rhizosphere | VSTQLVLNKYNTNYEALRLADSTALAFKCWQNFIKAIYYEL |
Ga0163162_134204871 | 3300013306 | Switchgrass Rhizosphere | PRGKSREEARVSTQLVLNKYNTNYEALRLADSTALAFKCWQDFIKAIYYELMNYH* |
Ga0157380_128498291 | 3300014326 | Switchgrass Rhizosphere | VSTPLVLNKYNTNYEALRLADSTALAFKSWQNFIKANYY |
Ga0157379_119535431 | 3300014968 | Switchgrass Rhizosphere | ARVSTQLVLNKYNTNYEALRLADSTALAFKSWQNFIKANYYKLMIYHKPSYIVINHN* |
Ga0182183_10785572 | 3300015270 | Switchgrass Phyllosphere | ARVSTQLVLNKYNTNDEALRLADSTALAFTSWQNFIKANYYKLVNYHKPSYIVIN* |
Ga0182101_10946361 | 3300015284 | Switchgrass Phyllosphere | VSTQLVLNKYNTNYEALRLADSTALAFKCWQDFIKAI |
Ga0182105_10915211 | 3300015290 | Switchgrass Phyllosphere | VSTQLVLNKYNTNYEALRLAISTALAFKSWKNFIKANYYKLMIYHKPSYIVINQN* |
Ga0182103_10499161 | 3300015293 | Switchgrass Phyllosphere | VLNKYNTNYEALRLADSTSLAFKCWQNFIKAIYYELMNYHYPSYIVINQN* |
Ga0182104_11167991 | 3300015297 | Switchgrass Phyllosphere | MSTQLVLNKYNTNYEALRLADSTALAFNSWQNFIKANYYKWMSYHTPVT* |
Ga0182184_10713412 | 3300015301 | Switchgrass Phyllosphere | TQLVLNKYNTNYEALRLADSTALAFKCWQDFIKAIYYELMNYH* |
Ga0182098_11092021 | 3300015309 | Switchgrass Phyllosphere | LVLNKYNTNYEALRFADSTALAFKSWQSFIKANYYKLMNYQKPSYIVINQNLS* |
Ga0182098_11146401 | 3300015309 | Switchgrass Phyllosphere | QLVLNKYNTNYEGLRLADSTALAFKCWQNFIKAIYYELMNYH* |
Ga0182162_11039811 | 3300015310 | Switchgrass Phyllosphere | VSTQLVLNKYNTNCEALRLADSTAIAFKSWQNFIKTNFYKFVNYHKPSY |
Ga0182182_10239321 | 3300015311 | Switchgrass Phyllosphere | LNKYNTNYEALRLADSTALAFKSWQNFITAIYYKLVNYHKPS* |
Ga0182164_10333151 | 3300015313 | Switchgrass Phyllosphere | VSTQLVLNKYNTNYEALMLADPTALAFKSWQNFIKANYYKLMYYHK |
Ga0182120_11401881 | 3300015315 | Switchgrass Phyllosphere | VSTQLVLNKYNTNYEALRLADSTALAFKCWQNFIK |
Ga0182121_11337271 | 3300015316 | Switchgrass Phyllosphere | VSKQLVLNKYNTNYEALRLADSTALAFKSWQNFIIANYYKMMNYPKPSYIVINQNY |
Ga0182121_11380331 | 3300015316 | Switchgrass Phyllosphere | KRMEEARVSTQLVLKKYNTNYEALRLADSTALAFNLGKNFIKANYYKLTKLP* |
Ga0182136_10303891 | 3300015317 | Switchgrass Phyllosphere | REKSREEARVSTQLVLNKYNTNYEALRLADSTALDFKCWQNFIKAIYYELMNLP* |
Ga0182136_10675131 | 3300015317 | Switchgrass Phyllosphere | VSTQLVLNKYNTNYEALRLADSTALAFKSWQSFIRAIYYKL |
Ga0182134_10961131 | 3300015324 | Switchgrass Phyllosphere | LVLNKYNTNYEALRLADSTALAFKSWQNFIKAIYYKLMNYHKPCYIVINQI* |
Ga0182148_10485371 | 3300015325 | Switchgrass Phyllosphere | VSTQLVLNKYNTNYEALRLADSTALAFKSWQNFIKANYYKLMNYHKPSYIVIN |
Ga0182166_10797531 | 3300015326 | Switchgrass Phyllosphere | VLNKYNTNYEALRLADSTALAFKSWQNFIKANYYKLMKLPYPSCIEINQIN* |
Ga0182114_10802741 | 3300015327 | Switchgrass Phyllosphere | LSTQLVLNKYNTNYEALRLADSTALAFKSWQNFIK |
Ga0182114_11118261 | 3300015327 | Switchgrass Phyllosphere | VSTQLVLNKYNTNYLALRLADSTALAFKSWQNSIKANYCKLMIYHKPSCILINQN |
Ga0182153_10451661 | 3300015328 | Switchgrass Phyllosphere | MRYNDRVDKKNNRKRVEKVRVSTQLVLNKYNTNYEALRLADSTALAFKSWQSFIRAIYYKLVNYHKPSYIVINQN* |
Ga0182153_11160841 | 3300015328 | Switchgrass Phyllosphere | VSTQLVLNKYNTNCEALRLADSTALAFKSWQNFIKTNYYKL |
Ga0182135_10861551 | 3300015329 | Switchgrass Phyllosphere | VSTQLVLNKYNINYEALRLADSTALAFKCWQNFFKAIYYELM |
Ga0182117_10867823 | 3300015332 | Switchgrass Phyllosphere | KSIEEARVSTQLVLNKYNTNYEALRLADSTALAFKSWQNFITAIYYKLVNYHKPS* |
Ga0182147_10443061 | 3300015333 | Switchgrass Phyllosphere | VSTQLVLKKYNTNYEALRLADSTALAFKSWQNFIKAIYYKWMNYHKPS |
Ga0182132_11575011 | 3300015334 | Switchgrass Phyllosphere | VSTQLVLNKYNTNYEALRLADSTALAFKSWQNFIKANYYKLMIYHNPVT* |
Ga0182150_11181981 | 3300015336 | Switchgrass Phyllosphere | VSKQLVLNKYNTNYEALRLADSTALAFKSWQSFIRAIYYKLVNYHKPSY |
Ga0182151_11080481 | 3300015337 | Switchgrass Phyllosphere | VSTQLVLNKYNTNYEALRLADSTALAFKCWQNFIKAI |
Ga0182137_11112432 | 3300015338 | Switchgrass Phyllosphere | VSTQLVLNKHNTNYEALRLADSTALAFKYWQNFIKANYYKL |
Ga0182133_11878961 | 3300015340 | Switchgrass Phyllosphere | KYNTNYEALRLADSTALAFKSWQNFIKAIHYKLMNYHKPSYIVINQN* |
Ga0182115_11711171 | 3300015348 | Switchgrass Phyllosphere | TQLVLNKYNTNYEALRLADSTALAFKSWQDFIKTIY* |
Ga0182185_11507671 | 3300015349 | Switchgrass Phyllosphere | PRGKSREEARVSTQLVLNKYNTNYEALRLADSTALAFKSWQNFIKAIYYKLMNYH* |
Ga0182185_11796391 | 3300015349 | Switchgrass Phyllosphere | TNYEALRLANTTALAFMSWQNFIKANYYKFMNYHKPSYIVINQN* |
Ga0182185_12406301 | 3300015349 | Switchgrass Phyllosphere | LNKYNTNYEALRLADSTALAFKSWQNFIKANYYKLMNYHKPRYIVINQN* |
Ga0182169_12856131 | 3300015352 | Switchgrass Phyllosphere | VSTQLVLNKYNTNYEALRLADPTALAFKSWQNFIKTNYYKLVNYHEP |
Ga0182169_12951291 | 3300015352 | Switchgrass Phyllosphere | TQLVLNKYNTNYEALRLADSTTLAFKSWQNFIKANYYKLMNYHKPSYIVINQNYT* |
Ga0182179_10681771 | 3300015353 | Switchgrass Phyllosphere | MTRGKRVEKASVSTQLILNKYNTNYEALRLADSTALAFKSWQSFITAI |
Ga0182179_11516081 | 3300015353 | Switchgrass Phyllosphere | SREEARVSTQLVLNKYNTNYEALRLADSTALAFKCWQSFIKTNYYKLMNYH* |
Ga0182179_12542061 | 3300015353 | Switchgrass Phyllosphere | VSTQLVLNKYNTNYEAIRLADSTALAFKSWQNFIKANYYKLM |
Ga0182179_12817511 | 3300015353 | Switchgrass Phyllosphere | VSTQLVLNKYNTNYEALRLADSTALAFKCWQNFITAIYYELMNYH* |
Ga0182179_12999991 | 3300015353 | Switchgrass Phyllosphere | VLNKYNTNYEALRLADSTALAFKSWQNFIKAIYYKLMNYLKPSYIVINKN* |
Ga0182197_11284511 | 3300017408 | Switchgrass Phyllosphere | VSTKLVLNKYNTNYEALSLANSTALAFKSWQNFIKAIYYKLMNYHKPSYIVINQN |
Ga0182199_10189941 | 3300017412 | Switchgrass Phyllosphere | STQLVLNKYNTNYEALRLADSTALAFKSWQNFIKSICYKLMKYHKPSYIVINQN |
Ga0182199_12074551 | 3300017412 | Switchgrass Phyllosphere | VSTQLVLNKYNTNYEALKLADSTALAFKSWQSFITAIYYK |
Ga0182195_11622041 | 3300017414 | Switchgrass Phyllosphere | VSTQLVLNKYNTNYEALRLADSTTLAFKSWQNFIKANYYQLVNYHKPS |
Ga0182195_11656411 | 3300017414 | Switchgrass Phyllosphere | VSTQLILNKYNTNYEALRLADSTALAFKCWQNFIKAIYYE |
Ga0182201_10393591 | 3300017422 | Switchgrass Phyllosphere | NKYNTNYEALRLADSTALAFKCGQNFIKAIYYELMNYH |
Ga0182201_11186911 | 3300017422 | Switchgrass Phyllosphere | YNTNYEALRLADSTALAFKSWQNFIKANYYKLMNYHKPGYIVINQK |
Ga0182201_11451892 | 3300017422 | Switchgrass Phyllosphere | VSTQLVLNKYNTNYEALSLADSTALAFKSWQNFIKANYYKWMNYHKPSYIEINQN |
Ga0182194_10393712 | 3300017435 | Switchgrass Phyllosphere | VCTQLVLNKYNTNYEALRLANSTALASKSWQNFIKINYYKLVN |
Ga0182200_11407311 | 3300017439 | Switchgrass Phyllosphere | VSTKLLLNKYNTNYEALRLADSTALAFKSWQNFIKDIYYELMN |
Ga0182216_10758781 | 3300017693 | Switchgrass Phyllosphere | KSREEARVSTQLVLNKYNTNYEALRLADPTALAFKSWQNFIKTNYYKLMNYH |
Ga0182216_10993001 | 3300017693 | Switchgrass Phyllosphere | VSTPLVLNKYNTNYEALRLADSTALAFKSWQDFIK |
Ga0268328_10631701 | 3300028050 | Phyllosphere | VSTQLVLNKYNTNYEALMLADPIALAFKSWQNFIKANYYKL |
Ga0268346_10085791 | 3300028053 | Phyllosphere | RVSTQLVLNKYNTNYEALRLADSTALAFKCWQNFIKAIYYELVNYL |
Ga0268306_10024841 | 3300028054 | Phyllosphere | VSTQLVLNKYNTNYEALRLADSTALAFKSWQNFIKANYYKL |
Ga0268338_10414371 | 3300028055 | Phyllosphere | QLVLNKYNTNYEALRLADSTALAFKCWQNFIKAIYYKLMNYYKPSYIVISQN |
Ga0268330_10293891 | 3300028056 | Phyllosphere | VSTQLVLNKYNTNYEALRLADSTALAFKSWQNFITAIYYKLVNYHKPSYIVI |
Ga0268330_10459901 | 3300028056 | Phyllosphere | VSTQLVLNKYNTNYEALMLADPIALAFKSWQNFIKANYYKXYIT |
Ga0268332_10128401 | 3300028058 | Phyllosphere | TQLVLNKYNTNYEALRLADSTALAFKSWQNFITAIYYKLVNYHKPSYIVINQI |
Ga0268332_10715731 | 3300028058 | Phyllosphere | VSTQLVLNNYNTNYEALRLADSTALAFKSWQNFIKANYYKLMNYHKPSYIVINQ |
Ga0268340_10791291 | 3300028064 | Phyllosphere | VSTQLVLNKYNTNYEALRLADSTALAFKSWQNFIKAIYYKLMNY |
Ga0268347_10059791 | 3300028142 | Phyllosphere | GKRVEYARVSTQLVLNKYNTNYEALRLADSTALAFKSWKFFIKANYYKLMNYHKPSYIVINQN |
Ga0268347_10086041 | 3300028142 | Phyllosphere | EKSRGGKYNTNYEALRLADSTALAFKSWQNFITAIYYKLVNYHKPS |
Ga0268347_10155471 | 3300028142 | Phyllosphere | LNKYNTNYEALRLTNSTALPFKSWQNFIKTNYYKLVNYHEPSYIVINQN |
Ga0268336_10036212 | 3300028152 | Phyllosphere | KSGEEARVSTQLVLNKYNTNYEALRLADSTALAFKSWKNFIKANYYKLMN |
Ga0268341_10185131 | 3300028154 | Phyllosphere | EEARVSTQLVLNKYNTNYEALRLADSTALAFKCWQNFIKAIYYEMVNYL |
Ga0268310_10257941 | 3300028262 | Phyllosphere | VSTQLVLNNYNTNYEALRLADSTALAFKSWQNFIKANYYKLM |
Ga0268311_10249431 | 3300028529 | Phyllosphere | AYPRGNSREEARVSTQLVLNKYNTNYEALRLADSTALAFKCWQNFIKAIYYELMNYH |
Ga0214503_10205792 | 3300032466 | Switchgrass Phyllosphere | VRVSTQLLLNKYNTNYEALRLADSTALAFKCWQDFIKAIYY |
Ga0214499_10528943 | 3300032697 | Switchgrass Phyllosphere | VSTQLVLNKYNTNYEALRLADSTALAFKSWQNFIKANYYKLMNYH |
Ga0314731_10702641 | 3300032790 | Switchgrass Phyllosphere | VSTQLVLNKYNTNYEALRLADSTALAFKSWQNFVIAIYYKLMNYHKPTYI |
Ga0314743_10000609 | 3300032844 | Switchgrass Phyllosphere | VSTQLILNKYNTNYEALRLADSTALAFKSWQNFITAIYYKLVNYHKPGYIVINQN |
Ga0314737_10119371 | 3300032875 | Switchgrass Phyllosphere | KSREEARVSTQLVLNKYNTNYEALRLADSTALAFKSWQNFIKAIYYELMNYH |
Ga0314726_1228201 | 3300032918 | Switchgrass Phyllosphere | SREEARVSTQLVLNKYNTNYEALRLADSTALAFKYWQIFIKAIYYKLMNYL |
Ga0314741_11286741 | 3300032934 | Switchgrass Phyllosphere | VSTQLVLNKYNTNYEAIRLADSTALAFKSWQNFIKAIYYELMNYHKP |
Ga0314738_10459281 | 3300032959 | Switchgrass Phyllosphere | EARVSTQLVLNKYNTNYEALRLADSTALAFKCWQNFIKTIYYELMNYH |
Ga0314757_11560141 | 3300033534 | Switchgrass Phyllosphere | VSTQLVLNKYNTNYEALRLADSTALPFKSWQNFIKTNYNKLVDYHEPSYI |
Ga0314769_13333221 | 3300033542 | Switchgrass Phyllosphere | VSTQLVLNKYNTNYEALRLADSTALAFKCWQDFIK |
⦗Top⦘ |