Basic Information | |
---|---|
Family ID | F079569 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 115 |
Average Sequence Length | 40 residues |
Representative Sequence | MKFFEWENAKDLSKYKSMTSAQVEAELKASNYLTKWVD |
Number of Associated Samples | 79 |
Number of Associated Scaffolds | 115 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Eukaryota |
% of genes with valid RBS motifs | 25.22 % |
% of genes near scaffold ends (potentially truncated) | 72.17 % |
% of genes from short scaffolds (< 2000 bps) | 99.13 % |
Associated GOLD sequencing projects | 73 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.37 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Eukaryota (74.783 % of family members) |
NCBI Taxonomy ID | 2759 |
Taxonomy | All Organisms → cellular organisms → Eukaryota |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine (58.261 % of family members) |
Environment Ontology (ENVO) | Unclassified (80.870 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Saline → Water (saline) (85.217 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 27.27% β-sheet: 0.00% Coil/Unstructured: 72.73% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.37 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 115 Family Scaffolds |
---|---|---|
PF02773 | S-AdoMet_synt_C | 25.22 |
PF12974 | Phosphonate-bd | 0.87 |
PF08240 | ADH_N | 0.87 |
PF02772 | S-AdoMet_synt_M | 0.87 |
PF11523 | DUF3223 | 0.87 |
PF00338 | Ribosomal_S10 | 0.87 |
PF00179 | UQ_con | 0.87 |
COG ID | Name | Functional Category | % Frequency in 115 Family Scaffolds |
---|---|---|---|
COG0192 | S-adenosylmethionine synthetase | Coenzyme transport and metabolism [H] | 26.09 |
COG0051 | Ribosomal protein S10 | Translation, ribosomal structure and biogenesis [J] | 0.87 |
COG5078 | Ubiquitin-protein ligase | Posttranslational modification, protein turnover, chaperones [O] | 0.87 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 76.52 % |
Unclassified | root | N/A | 23.48 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300008832|Ga0103951_10253693 | All Organisms → cellular organisms → Eukaryota | 887 | Open in IMG/M |
3300008832|Ga0103951_10687301 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae | 558 | Open in IMG/M |
3300008832|Ga0103951_10822555 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Suessiales → Symbiodiniaceae → Symbiodinium → Symbiodinium microadriaticum | 505 | Open in IMG/M |
3300008834|Ga0103882_10073285 | Not Available | 558 | Open in IMG/M |
3300008835|Ga0103883_1008586 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae | 890 | Open in IMG/M |
3300008835|Ga0103883_1053190 | Not Available | 554 | Open in IMG/M |
3300008929|Ga0103732_1032680 | All Organisms → cellular organisms → Eukaryota | 776 | Open in IMG/M |
3300008938|Ga0103741_1037747 | All Organisms → cellular organisms → Eukaryota → Sar | 901 | Open in IMG/M |
3300009006|Ga0103710_10146831 | All Organisms → cellular organisms → Eukaryota → Sar | 618 | Open in IMG/M |
3300009006|Ga0103710_10202478 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae | 546 | Open in IMG/M |
3300009023|Ga0103928_10150263 | All Organisms → cellular organisms → Eukaryota → Sar | 788 | Open in IMG/M |
3300009023|Ga0103928_10434841 | Not Available | 516 | Open in IMG/M |
3300009023|Ga0103928_10468056 | Not Available | 501 | Open in IMG/M |
3300009025|Ga0103707_10019877 | All Organisms → cellular organisms → Eukaryota → Sar | 994 | Open in IMG/M |
3300009025|Ga0103707_10175042 | Not Available | 526 | Open in IMG/M |
3300009028|Ga0103708_100228463 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Suessiales → Symbiodiniaceae → Symbiodinium → Symbiodinium microadriaticum | 556 | Open in IMG/M |
3300009028|Ga0103708_100233204 | All Organisms → cellular organisms → Eukaryota | 552 | Open in IMG/M |
3300009263|Ga0103872_1069150 | Not Available | 540 | Open in IMG/M |
3300009269|Ga0103876_1055319 | All Organisms → cellular organisms → Eukaryota | 574 | Open in IMG/M |
3300009269|Ga0103876_1070051 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Suessiales → Symbiodiniaceae → Symbiodinium → Symbiodinium natans | 527 | Open in IMG/M |
3300009269|Ga0103876_1074192 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Suessiales → Symbiodiniaceae → Symbiodinium → Symbiodinium microadriaticum | 516 | Open in IMG/M |
3300009274|Ga0103878_1001755 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda → Gymnoplea → Calanoida → Temoridae → Eurytemora → Eurytemora affinis | 1292 | Open in IMG/M |
3300009274|Ga0103878_1039482 | Not Available | 546 | Open in IMG/M |
3300009276|Ga0103879_10021739 | Not Available | 635 | Open in IMG/M |
3300009276|Ga0103879_10038610 | All Organisms → cellular organisms → Eukaryota → Sar | 560 | Open in IMG/M |
3300009544|Ga0115006_11016327 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae | 736 | Open in IMG/M |
3300009679|Ga0115105_10729365 | Not Available | 607 | Open in IMG/M |
3300009679|Ga0115105_11357144 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae | 555 | Open in IMG/M |
3300010987|Ga0138324_10051284 | All Organisms → cellular organisms → Eukaryota | 1556 | Open in IMG/M |
3300010987|Ga0138324_10313237 | All Organisms → cellular organisms → Eukaryota → Sar | 753 | Open in IMG/M |
3300011329|Ga0138367_1168940 | Not Available | 564 | Open in IMG/M |
3300012700|Ga0157576_1015927 | All Organisms → Viruses → Predicted Viral | 1113 | Open in IMG/M |
3300012935|Ga0138257_1026641 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae | 510 | Open in IMG/M |
3300017061|Ga0186077_113615 | All Organisms → cellular organisms → Eukaryota → Sar | 501 | Open in IMG/M |
3300018625|Ga0192842_1039431 | All Organisms → cellular organisms → Eukaryota → Sar | 509 | Open in IMG/M |
3300018647|Ga0192913_1036399 | Not Available | 542 | Open in IMG/M |
3300018678|Ga0193007_1046089 | All Organisms → cellular organisms → Eukaryota → Sar | 594 | Open in IMG/M |
3300018678|Ga0193007_1060117 | Not Available | 503 | Open in IMG/M |
3300018711|Ga0193069_1051810 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Suessiales → Symbiodiniaceae → Symbiodinium → Symbiodinium microadriaticum | 504 | Open in IMG/M |
3300018713|Ga0192887_1056530 | Not Available | 523 | Open in IMG/M |
3300018714|Ga0193349_1044730 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae | 628 | Open in IMG/M |
3300018716|Ga0193324_1050532 | Not Available | 517 | Open in IMG/M |
3300018730|Ga0192967_1085568 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae | 508 | Open in IMG/M |
3300018733|Ga0193036_1057399 | All Organisms → cellular organisms → Eukaryota | 575 | Open in IMG/M |
3300018758|Ga0193058_1026506 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae | 836 | Open in IMG/M |
3300018765|Ga0193031_1072269 | Not Available | 583 | Open in IMG/M |
3300018802|Ga0193388_1048293 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Suessiales → Symbiodiniaceae → Symbiodinium | 679 | Open in IMG/M |
3300018822|Ga0193368_1066559 | All Organisms → cellular organisms → Eukaryota → Sar | 514 | Open in IMG/M |
3300018827|Ga0193366_1017283 | All Organisms → cellular organisms → Eukaryota | 900 | Open in IMG/M |
3300018827|Ga0193366_1063068 | All Organisms → cellular organisms → Eukaryota → Sar | 544 | Open in IMG/M |
3300018827|Ga0193366_1066867 | Not Available | 529 | Open in IMG/M |
3300018837|Ga0192927_1026518 | All Organisms → cellular organisms → Eukaryota | 873 | Open in IMG/M |
3300018850|Ga0193273_1064508 | All Organisms → cellular organisms → Eukaryota → Sar | 554 | Open in IMG/M |
3300018871|Ga0192978_1038615 | All Organisms → cellular organisms → Eukaryota | 899 | Open in IMG/M |
3300018880|Ga0193337_1045191 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Suessiales → Symbiodiniaceae → Symbiodinium | 567 | Open in IMG/M |
3300018881|Ga0192908_10018422 | All Organisms → cellular organisms → Eukaryota → Sar | 683 | Open in IMG/M |
3300018913|Ga0192868_10092064 | All Organisms → cellular organisms → Eukaryota → Sar | 507 | Open in IMG/M |
3300018928|Ga0193260_10122850 | All Organisms → cellular organisms → Eukaryota → Sar | 561 | Open in IMG/M |
3300018967|Ga0193178_10086142 | All Organisms → cellular organisms → Eukaryota → Sar | 501 | Open in IMG/M |
3300018974|Ga0192873_10052280 | All Organisms → cellular organisms → Eukaryota | 1553 | Open in IMG/M |
3300018974|Ga0192873_10267167 | All Organisms → cellular organisms → Eukaryota → Sar | 737 | Open in IMG/M |
3300018975|Ga0193006_10198969 | All Organisms → cellular organisms → Eukaryota → Sar | 588 | Open in IMG/M |
3300018975|Ga0193006_10221110 | Not Available | 551 | Open in IMG/M |
3300018988|Ga0193275_10241839 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Gonyaulacales → Pyrocystaceae → Alexandrium → Alexandrium andersonii | 567 | Open in IMG/M |
3300018994|Ga0193280_10297378 | All Organisms → cellular organisms → Eukaryota → Sar | 594 | Open in IMG/M |
3300018997|Ga0193257_10218013 | Not Available | 546 | Open in IMG/M |
3300019001|Ga0193034_10120803 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae | 617 | Open in IMG/M |
3300019027|Ga0192909_10048920 | All Organisms → cellular organisms → Eukaryota | 908 | Open in IMG/M |
3300019027|Ga0192909_10258798 | All Organisms → cellular organisms → Eukaryota | 538 | Open in IMG/M |
3300019031|Ga0193516_10286379 | Not Available | 530 | Open in IMG/M |
3300019032|Ga0192869_10157528 | All Organisms → cellular organisms → Eukaryota | 940 | Open in IMG/M |
3300019032|Ga0192869_10307866 | All Organisms → cellular organisms → Eukaryota → Sar | 692 | Open in IMG/M |
3300019032|Ga0192869_10389864 | All Organisms → cellular organisms → Eukaryota | 606 | Open in IMG/M |
3300019032|Ga0192869_10423609 | Not Available | 577 | Open in IMG/M |
3300019036|Ga0192945_10298495 | All Organisms → cellular organisms → Eukaryota → Sar | 503 | Open in IMG/M |
3300019039|Ga0193123_10225449 | All Organisms → cellular organisms → Eukaryota | 736 | Open in IMG/M |
3300019039|Ga0193123_10357572 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Suessiales → Symbiodiniaceae → Symbiodinium → Symbiodinium natans | 572 | Open in IMG/M |
3300019039|Ga0193123_10387848 | All Organisms → cellular organisms → Eukaryota → Sar | 547 | Open in IMG/M |
3300019039|Ga0193123_10396345 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae | 540 | Open in IMG/M |
3300019039|Ga0193123_10436673 | Not Available | 512 | Open in IMG/M |
3300019045|Ga0193336_10008460 | All Organisms → cellular organisms → Eukaryota | 1555 | Open in IMG/M |
3300019045|Ga0193336_10019628 | All Organisms → cellular organisms → Eukaryota | 1347 | Open in IMG/M |
3300019045|Ga0193336_10032304 | All Organisms → Viruses → Predicted Viral | 1227 | Open in IMG/M |
3300019045|Ga0193336_10107016 | All Organisms → cellular organisms → Eukaryota | 947 | Open in IMG/M |
3300019045|Ga0193336_10290278 | All Organisms → cellular organisms → Eukaryota | 714 | Open in IMG/M |
3300019045|Ga0193336_10328760 | All Organisms → cellular organisms → Eukaryota → Sar | 684 | Open in IMG/M |
3300019045|Ga0193336_10602387 | Not Available | 540 | Open in IMG/M |
3300019045|Ga0193336_10650632 | All Organisms → cellular organisms → Eukaryota → Sar | 522 | Open in IMG/M |
3300019050|Ga0192966_10265779 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae | 608 | Open in IMG/M |
3300019055|Ga0193208_10331434 | All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Pelagophyceae → Pelagomonadales → Aureococcus → Aureococcus anophagefferens | 790 | Open in IMG/M |
3300019055|Ga0193208_10444732 | All Organisms → cellular organisms → Eukaryota | 679 | Open in IMG/M |
3300019112|Ga0193106_1038248 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Suessiales → Symbiodiniaceae → Symbiodinium → Symbiodinium microadriaticum | 578 | Open in IMG/M |
3300019117|Ga0193054_1074057 | Not Available | 509 | Open in IMG/M |
3300019125|Ga0193104_1055019 | Not Available | 554 | Open in IMG/M |
3300019150|Ga0194244_10118309 | Not Available | 514 | Open in IMG/M |
3300020416|Ga0211644_10447355 | All Organisms → cellular organisms → Eukaryota | 534 | Open in IMG/M |
3300021345|Ga0206688_10458650 | All Organisms → cellular organisms → Eukaryota → Sar | 585 | Open in IMG/M |
3300021954|Ga0063755_1059787 | All Organisms → cellular organisms → Eukaryota | 985 | Open in IMG/M |
3300028338|Ga0247567_1117859 | All Organisms → cellular organisms → Eukaryota → Sar | 575 | Open in IMG/M |
3300030670|Ga0307401_10359720 | All Organisms → cellular organisms → Eukaryota → Sar | 661 | Open in IMG/M |
3300030749|Ga0073969_11383318 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Suessiales → Symbiodiniaceae → Symbiodinium → Symbiodinium microadriaticum | 531 | Open in IMG/M |
3300030912|Ga0073987_11093942 | All Organisms → cellular organisms → Eukaryota → Sar | 538 | Open in IMG/M |
3300031007|Ga0073975_1558158 | All Organisms → cellular organisms → Eukaryota → Sar | 546 | Open in IMG/M |
3300031121|Ga0138345_10048141 | All Organisms → cellular organisms → Eukaryota | 1030 | Open in IMG/M |
3300031522|Ga0307388_11018945 | All Organisms → cellular organisms → Eukaryota → Sar | 560 | Open in IMG/M |
3300031557|Ga0308148_1032974 | All Organisms → cellular organisms → Eukaryota | 586 | Open in IMG/M |
3300031710|Ga0307386_10698749 | All Organisms → cellular organisms → Eukaryota → Sar | 542 | Open in IMG/M |
3300031710|Ga0307386_10824590 | Not Available | 502 | Open in IMG/M |
3300031738|Ga0307384_10612380 | All Organisms → cellular organisms → Eukaryota → Sar | 522 | Open in IMG/M |
3300032517|Ga0314688_10777418 | All Organisms → cellular organisms → Eukaryota | 511 | Open in IMG/M |
3300032519|Ga0314676_10729467 | Not Available | 576 | Open in IMG/M |
3300032708|Ga0314669_10339050 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Suessiales → Symbiodiniaceae → Symbiodinium → Symbiodinium natans | 815 | Open in IMG/M |
3300032743|Ga0314707_10702175 | All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Pelagophyceae → Pelagomonadales → Aureococcus → Aureococcus anophagefferens | 516 | Open in IMG/M |
3300032747|Ga0314712_10028482 | All Organisms → cellular organisms → Eukaryota | 2018 | Open in IMG/M |
3300032748|Ga0314713_10505783 | All Organisms → cellular organisms → Eukaryota → Sar | 510 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Marine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine | 58.26% |
Marine | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine | 13.04% |
Surface Ocean Water | Environmental → Aquatic → Marine → Oceanic → Unclassified → Surface Ocean Water | 9.57% |
Seawater | Environmental → Aquatic → Marine → Oceanic → Unclassified → Seawater | 5.22% |
Ocean Water | Environmental → Aquatic → Marine → Oceanic → Unclassified → Ocean Water | 5.22% |
Coastal Water | Environmental → Aquatic → Marine → Coastal → Unclassified → Coastal Water | 2.61% |
Ice Edge, Mcmurdo Sound, Antarctica | Environmental → Aquatic → Marine → Oceanic → Unclassified → Ice Edge, Mcmurdo Sound, Antarctica | 1.74% |
Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 0.87% |
Seawater | Environmental → Aquatic → Marine → Oceanic → Unclassified → Seawater | 0.87% |
Seawater | Environmental → Aquatic → Marine → Coastal → Unclassified → Seawater | 0.87% |
Host-Associated | Host-Associated → Human → Digestive System → Large Intestine → Fecal → Host-Associated | 0.87% |
Polar Marine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Polar Marine | 0.87% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300008832 | Eukaryotic communities of water collected during the Tara Oceans expedition - TARA_A200000150 | Environmental | Open in IMG/M |
3300008834 | Eukaryotic communities of water from the North Atlantic ocean - ACM26 | Environmental | Open in IMG/M |
3300008835 | Eukaryotic communities of water from the North Atlantic ocean - ACM44 | Environmental | Open in IMG/M |
3300008929 | Eukaryotic and microbial communities from ice edge, McMurdo Sound, Antarctica - 1A | Environmental | Open in IMG/M |
3300008938 | Eukaryotic and microbial communities from ice edge, McMurdo Sound, Antarctica - 4A | Environmental | Open in IMG/M |
3300009006 | Eukaryotic communities from seawater of the North Pacific Subtropical Gyre - HoeDylan_E2 | Environmental | Open in IMG/M |
3300009023 | Planktonic microbial communities from coastal waters of California, USA - Canon-29 | Environmental | Open in IMG/M |
3300009025 | Eukaryotic communities from seawater of the North Pacific Subtropical Gyre - HoeDylan_S2 | Environmental | Open in IMG/M |
3300009028 | Eukaryotic communities from seawater of the North Pacific Subtropical Gyre - HoeDylan_S3 | Environmental | Open in IMG/M |
3300009263 | Eukaryotic communities of water from the North Atlantic ocean - ACM27 | Environmental | Open in IMG/M |
3300009269 | Eukaryotic communities of water from the North Atlantic ocean - ACM28 | Environmental | Open in IMG/M |
3300009274 | Eukaryotic communities of water from the North Atlantic ocean - ACM10 | Environmental | Open in IMG/M |
3300009276 | Eukaryotic communities of water from the North Atlantic ocean - ACM57 | Environmental | Open in IMG/M |
3300009544 | Marine eukaryotic phytoplankton communities from Arctic Ocean - Arctic Ocean- Svalbard ARC20M Metagenome | Environmental | Open in IMG/M |
3300009679 | Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - CN13ID_155_C17_100m_0.8um Metatranscriptome (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300010987 | Metatranscriptome of Marine eukaryotic phytoplankton communities from the Antarctic Ocean - ANT-7 (Eukaryote Community Metatranscriptome) (version 6) | Environmental | Open in IMG/M |
3300011329 | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - KN S9 250_B metaT (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
3300012700 | Dystrophic lake water microbial communities from Trout Bog Lake, Wisconsin, USA - GEODES079 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300012935 | Metatranscriptomics of polar marine prokaryotic and eukaryotic communities from Arthur Harbor ice station, Antarctica - RNA5.ICE_1m.20151110 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300017061 | Metatranscriptome of marine eukaryotic communities from unknown location in MLH medium with 10g/L glucose, double vitamins, at 27 C, 30 psu salinity and 658 ?mol photons light - Crypthecodinium cohnii Seligo (MMETSP0323_2) | Host-Associated | Open in IMG/M |
3300018625 | Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_052 - TARA_N000000598 (ERX1782204-ERR1712199) | Environmental | Open in IMG/M |
3300018647 | Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_072 - TARA_N000000833 (ERX1782439-ERR1712057) | Environmental | Open in IMG/M |
3300018678 | Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_131 - TARA_N000002350 (ERX1782149-ERR1712036) | Environmental | Open in IMG/M |
3300018711 | Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_143 - TARA_N000003139 (ERX1782287-ERR1712099) | Environmental | Open in IMG/M |
3300018713 | Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_068 - TARA_N000000703 (ERX1782432-ERR1712119) | Environmental | Open in IMG/M |
3300018714 | Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_111 - TARA_N000001812 (ERX1782478-ERR1711985) | Environmental | Open in IMG/M |
3300018716 | Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_109 - TARA_N000001728 (ERX1789726-ERR1719299) | Environmental | Open in IMG/M |
3300018730 | Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_084 - TARA_N000001438 (ERX1782285-ERR1712028) | Environmental | Open in IMG/M |
3300018733 | Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_040 - TARA_N000000067 (ERX1782259-ERR1711890) | Environmental | Open in IMG/M |
3300018758 | Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_135 - TARA_N000002171 (ERX1782363-ERR1712059) | Environmental | Open in IMG/M |
3300018765 | Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_152 - TARA_N000002803 (ERX1782330-ERR1712010) | Environmental | Open in IMG/M |
3300018802 | Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_123 - TARA_N000001996 (ERX1789649-ERR1719297) | Environmental | Open in IMG/M |
3300018822 | Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_122 - TARA_N000001938 (ERX1782327-ERR1711869) | Environmental | Open in IMG/M |
3300018827 | Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_122 - TARA_N000001938 (ERX1782415-ERR1712182) | Environmental | Open in IMG/M |
3300018837 | Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_076 - TARA_N000000871 (ERX1782235-ERR1712073) | Environmental | Open in IMG/M |
3300018850 | Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_098 - TARA_N000001578 (ERX1782388-ERR1711941) | Environmental | Open in IMG/M |
3300018871 | Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_085 - TARA_N000001026 (ERX1789475-ERR1719345) | Environmental | Open in IMG/M |
3300018880 | Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_110 - TARA_N000001752 (ERX1782455-ERR1712124) | Environmental | Open in IMG/M |
3300018881 | Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_070 - TARA_N000000678 (ERX1782151-ERR1712094) | Environmental | Open in IMG/M |
3300018913 | Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_066 - TARA_N000000805 (ERX1782451-ERR1712205) | Environmental | Open in IMG/M |
3300018928 | Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_093 - TARA_N000001111 (ERX1789573-ERR1719386) | Environmental | Open in IMG/M |
3300018967 | Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_036 - TARA_N000000316 (ERX1789557-ERR1719488) | Environmental | Open in IMG/M |
3300018974 | Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_066 - TARA_N000000809 (ERX1782160-ERR1711971) | Environmental | Open in IMG/M |
3300018975 | Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_131 - TARA_N000002350 (ERX1782140-ERR1711881) | Environmental | Open in IMG/M |
3300018988 | Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_098 - TARA_N000001580 (ERX1782315-ERR1711974) | Environmental | Open in IMG/M |
3300018994 | Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_098 - TARA_N000001586 (ERX1789578-ERR1719368) | Environmental | Open in IMG/M |
3300018997 | Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_092 - TARA_N000001303 (ERX1789387-ERR1719468) | Environmental | Open in IMG/M |
3300019001 | Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_009 - TARA_X000001043 (ERX1782383-ERR1712007) | Environmental | Open in IMG/M |
3300019027 | Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_070 - TARA_N000000678 (ERX1782477-ERR1711924) | Environmental | Open in IMG/M |
3300019031 | Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_142 - TARA_N000003104 (ERX1782386-ERR1711939) | Environmental | Open in IMG/M |
3300019032 | Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_066 - TARA_N000000805 (ERX1782188-ERR1712216) | Environmental | Open in IMG/M |
3300019036 | Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_082 - TARA_N000001382 (ERX1782404-ERR1712086) | Environmental | Open in IMG/M |
3300019039 | Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_011 - TARA_X000001286 (ERX1782333-ERR1712137) | Environmental | Open in IMG/M |
3300019045 | Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_110 - TARA_N000001752 (ERX1782348-ERR1712224) | Environmental | Open in IMG/M |
3300019050 | Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_084 - TARA_N000001438 (ERX1782371-ERR1711865) | Environmental | Open in IMG/M |
3300019055 | Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_041 - TARA_N000000073 (ERX1782414-ERR1711963) | Environmental | Open in IMG/M |
3300019112 | Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_072 - TARA_N000000836 (ERX1782266-ERR1711948) | Environmental | Open in IMG/M |
3300019117 | Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_131 - TARA_N000002348 (ERX1782351-ERR1711912) | Environmental | Open in IMG/M |
3300019125 | Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_152 - TARA_N000002761 (ERX1782425-ERR1712222) | Environmental | Open in IMG/M |
3300019150 | Eukaryotic communities of water from different depths collected during the Tara Oceans expedition - TARA_N000000616 (ERX1782105-ERR1711908) | Environmental | Open in IMG/M |
3300020416 | Marine microbial communities from Tara Oceans - TARA_B100001109 (ERX556137-ERR599039) | Environmental | Open in IMG/M |
3300021345 | Metatranscriptome of ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 80m 12015 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300021954 | Marine eukaryotic phytoplankton communities from the Norwegian Sea - 10m ARK-5M Euk ARK-5-1 (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
3300028338 | Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 15R (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300030670 | Metatranscriptome of marine eukaryotic phytoplankton communities from Antarctic Ocean - PS103-23 (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
3300030749 | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - DeepDOM_E6_V_5 metaT (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
3300030912 | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - DeepDOM_S15_0.2 metaT (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
3300031007 | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - DeepDOM_E7_S_0.2 metaT (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
3300031121 | Marine microbial communities from the Southern Atlantic ocean transect - DeepDOM_S15_Trap_metaT (Eukaryote Community Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
3300031522 | Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean ? PS103-3.R2 (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
3300031557 | Metatranscriptome of marine microbial communities from Western Arctic Ocean, Canada - CBN3_328_20m (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300031710 | Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean ? PS103-2.R3 (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
3300031738 | Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean ? PS103-2.R1 (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
3300032517 | Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red4_24May_deep (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
3300032519 | Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red3_22May_surf (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
3300032708 | Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red2_22May_surf (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
3300032743 | Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Shad10_24May_surf (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
3300032747 | Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Shad11_28May_surf (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
3300032748 | Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Amb12_24May_surf (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
Ga0103951_102536931 | 3300008832 | Marine | VTKNGIKFFEWENAKDLSKYKSMSSEQVGAELKASNYLTKWVD* |
Ga0103951_106873011 | 3300008832 | Marine | PETKNGIKYFEWENAKDLSQYAAFTSRQVTAALKKSNYLTKWVD* |
Ga0103951_108225551 | 3300008832 | Marine | HGEWENAKDLKKYAPMTSDQVTAALTSSNYLTKWVD* |
Ga0103882_100732851 | 3300008834 | Surface Ocean Water | EWENAKDMAKYAKQTPAEITAALKASNYLQKWVD* |
Ga0103883_10085863 | 3300008835 | Surface Ocean Water | KYFEWENAKDLSKYKGMNSSQVASELKSSNYLTKWVD* |
Ga0103883_10531901 | 3300008835 | Surface Ocean Water | FEWENAKDMAKYAKQTPAEITAALKASNYLQKWVD* |
Ga0103732_10326802 | 3300008929 | Ice Edge, Mcmurdo Sound, Antarctica | MDGIKFFEWENAKDISKYASMDSEQVTTALKASNYLTKWVD* |
Ga0103741_10377471 | 3300008938 | Ice Edge, Mcmurdo Sound, Antarctica | MKFFEWENAKDLSKYKSMNSAQVEAELKASNYLTKWVD* |
Ga0103710_101468311 | 3300009006 | Ocean Water | KDGIKFFEWENAKDLKKYAGMSSAQVSAELERSNFKQKWVD* |
Ga0103710_102024782 | 3300009006 | Ocean Water | GIKFFEWENAKDLTKFKSMTSEQVTSELKGSNYLTKWVD* |
Ga0103928_101502631 | 3300009023 | Coastal Water | GKKYFEWENAKDVKKYASMDSAEVTAALKASNYLTKWVD* |
Ga0103928_104348411 | 3300009023 | Coastal Water | RTEDGKKYFEWENTKNLSKYKKKSSEQVTAELKKSDFLTKWVD* |
Ga0103928_104680561 | 3300009023 | Coastal Water | FEWENAKDLSKYAKMNSAQVSAELKTSNYLEKWVD* |
Ga0103707_100198771 | 3300009025 | Ocean Water | KDGIKFFEWENAKDLTKYASMDSAQVEQALKSSNYLTKWVD* |
Ga0103707_101750423 | 3300009025 | Ocean Water | FEWENPKDLKKYAPMTSEQVGAALASSNYLTKYVD* |
Ga0103708_1002284631 | 3300009028 | Ocean Water | IKFFEWENAKNLSKYSSMDSAQVTTALKSSNYLTKWVD* |
Ga0103708_1002332042 | 3300009028 | Ocean Water | FEWENAKDLSKYQPLSSAQVGAELKASNYLAKWVD* |
Ga0103872_10691501 | 3300009263 | Surface Ocean Water | EWENAKDLAKYKSMDSTQVASALKASNYLTKWVD* |
Ga0103876_10553192 | 3300009269 | Surface Ocean Water | DGIKFFEWENAKDLTKYAPMDSAQVEQALKSSNYLTKWVD* |
Ga0103876_10700511 | 3300009269 | Surface Ocean Water | GIKFFEWENAKDLSKYKGMNPSQVEAELKSSNYLTKWVD* |
Ga0103876_10741921 | 3300009269 | Surface Ocean Water | FEWENPKDLKKYASMNSAQVTAELTASNYLQKWVD* |
Ga0103878_10017552 | 3300009274 | Surface Ocean Water | GIKFFEWENAKDLTKYAPMTSEQISAALVASNYLTKFVD* |
Ga0103878_10394822 | 3300009274 | Surface Ocean Water | FEWENAKDLSKYAKMNTSEVDAALKASNYLTKWVD* |
Ga0103879_100217391 | 3300009276 | Surface Ocean Water | FFEWENAKDVSKYKGMSSAEVTAALTASNYLTKWVD* |
Ga0103879_100386101 | 3300009276 | Surface Ocean Water | EWENAKDLSKYKGMTSAQVDAALKGSNYLTKWVD* |
Ga0115006_110163272 | 3300009544 | Marine | YTKDGVKFFEWENAKDCSKYKSMNSEQVTAALKSSNYLTKWVD* |
Ga0115105_107293651 | 3300009679 | Marine | RKYFEWENAKDLSKYAKMSPEEVTAALKASNYLQKWVD* |
Ga0115105_113571441 | 3300009679 | Marine | FEWENAKDVSKYKNMTSEQVAAALKGSNYLQKWVD* |
Ga0138324_100512842 | 3300010987 | Marine | VQTGRAPYTKDGIKFFEWENAKDLLKYKDTNSEQVTAALNASNYRSK |
Ga0138324_103132371 | 3300010987 | Marine | LFEWENAYDLSKYVAMTPEQVDTALKGSNYLQKWVD* |
Ga0138367_11689401 | 3300011329 | Marine | KYFEWENAKDLSKYAKMSPEEVTAALKASNYLQKWVD* |
Ga0157576_10159272 | 3300012700 | Freshwater | MKFFEWENAKDLAKYKSLNSDQVTAALKASNFLTKWVD* |
Ga0138257_10266411 | 3300012935 | Polar Marine | ENGIKFFEWENAKYLSKYKAMTSVQVGAELKSSNYLQKWVD* |
Ga0186077_1136151 | 3300017061 | Host-Associated | GIKFFEWENPKDLSKYQKMTSAQVDAALKGSNFLTKWVD |
Ga0192842_10394311 | 3300018625 | Marine | ENGMKCFEWENAKDLSKYAAMSPDAVSAELKKSNYLEKWVD |
Ga0192913_10363991 | 3300018647 | Marine | FEWENAKNLAKYKSMSSTEVSKALKSSNYLTKWVD |
Ga0193007_10460891 | 3300018678 | Marine | GMKLFEWENAKDMAKYAKMSPDEITAALKGSNYLQKWVD |
Ga0193007_10601171 | 3300018678 | Marine | GMKLFEWENAKDMAKYAKQSPAEITAALKASNYLQKWVD |
Ga0193069_10518101 | 3300018711 | Marine | DGVKFFEWENAKDVSKYGKMNSDEVAAALKASNYLTKWVD |
Ga0192887_10565301 | 3300018713 | Marine | FFEWENAKDLSKYAKMNSEQVSAELKSSNFLSKWVD |
Ga0193349_10447301 | 3300018714 | Marine | PYTKDGIKYFEWENAKDLRQYKGMSSAQVTSELTGSNYLQKWVD |
Ga0193324_10505321 | 3300018716 | Marine | FEWENAKDMAKYAKMSPDEITAALKGSNYLQKWVD |
Ga0192967_10855681 | 3300018730 | Marine | NGMKFFEWENAKDLAKYKKMTTAQVTAELKGSNYLQKWVD |
Ga0193036_10573992 | 3300018733 | Marine | VTKNGIKFFEWENAKDLSKYKSMNSAQVEAELTASNYLTKWVD |
Ga0193058_10265061 | 3300018758 | Marine | VKVSTKDGIKFFEWENAKDLSRFKSMNSAQVEAELKASNYLTKWVD |
Ga0193031_10722691 | 3300018765 | Marine | FEWENPTDLSKYQKMQPAEVEAQLKGSNYLQKWVD |
Ga0193388_10482931 | 3300018802 | Marine | VTKDGIKFFEWENAEDLSKYSGMNSEQVTAALKESNYPTKWVD |
Ga0193368_10665591 | 3300018822 | Marine | HGGMKYFEWESAKDLSKYKAMDPAGVGAELKKSNYLQKWVD |
Ga0193366_10172832 | 3300018827 | Marine | MKLFEWENAKDLSKYTAMTTDQVDAELKKSDFLQKWVD |
Ga0193366_10630681 | 3300018827 | Marine | FGREAYTKDGMKFFEWENAKELSKYKSMSSAEVSAALKKSNYLTKWVD |
Ga0193366_10668671 | 3300018827 | Marine | YFEWERPHDLSKYAKMSSANVSAELATSNVLEKWVD |
Ga0192927_10265182 | 3300018837 | Marine | VTKDGMKFFEWENAKDLKKYSLMNSAQVTAALKESNYLTKWVD |
Ga0193273_10645081 | 3300018850 | Marine | GVKFFEWENAKDLSKYSSMSSEQVMSALKSSNYLTKWVD |
Ga0192978_10386152 | 3300018871 | Marine | LGGSQRLTPETKDGKKFFEWENAKDLAKYKAMSPEEVGAALKASNYLQKWVD |
Ga0193337_10451911 | 3300018880 | Marine | MKFFEWENAKDLAKYASMDSAQVTAALKGSNYLTKWVD |
Ga0192908_100184221 | 3300018881 | Marine | MKLFEWENAKDMAKYAKMSPDEITAALKGSNYLQKWVD |
Ga0192868_100920642 | 3300018913 | Marine | VTKDGKKYFEWENAKDVSKYKGMKTAEVTAALKASNYLTKWVD |
Ga0193260_101228501 | 3300018928 | Marine | PETKNGCKFFEWENAKDLKKFAAMSPEEVTAALKASNYLEKWVD |
Ga0193178_100861421 | 3300018967 | Marine | KDGKKFFEWENAKDMSKYAKMSPAEVSAALKSSNYLTKWVD |
Ga0192873_100522801 | 3300018974 | Marine | VTKNGIKFFEWENAKDLSKYKSMNSAQVDAALKASNYLTKWVD |
Ga0192873_102671671 | 3300018974 | Marine | VQTGRAPYTEDGIKLFEWENAKDLSKYKDTNSEQVTAALNASNYRSKWVD |
Ga0193006_101989691 | 3300018975 | Marine | KDGKKFFEWENAKDMSKYGKMAPEEVSTALKASNFLQKWVD |
Ga0193006_102211101 | 3300018975 | Marine | LFEWENAKDMSKYAKMSPDEITAALKGSNYLQKWVD |
Ga0193275_102418392 | 3300018988 | Marine | VKFFEWENAKDLSKYAKMNSSQVSAELKGSNYLTKWVD |
Ga0193280_102973781 | 3300018994 | Marine | KDGVKFFEWENAKDLSKYSSMSSEQVMSALKSSNYLTKWVD |
Ga0193257_102180132 | 3300018997 | Marine | GRAAYTSKEGHTFFEWENSKDLSKFALMTSEQVTGELKSSNYLTMWTD |
Ga0193034_101208032 | 3300019001 | Marine | FGRAPVTKNGIKFFEWENAKDVSKYKAMTSAQLTAALKSSNYLTKWVD |
Ga0192909_100489201 | 3300019027 | Marine | MTRNGMKFFEWENAKDLKKYAAMDSAQVAAALKASNYLQKWVD |
Ga0192909_102587982 | 3300019027 | Marine | MVKFFEWENAKDLKKYASMKSAQVTAELNSSNFLKKWVD |
Ga0193516_102863791 | 3300019031 | Marine | LFEWENAKDMAKYAKMSPAEITAALKASNYLQKWVD |
Ga0192869_101575282 | 3300019032 | Marine | MGTLAGNHTPNGIKFFEWESAKDLTKYQKMSSAQVTAELTSSNYLTKWVD |
Ga0192869_103078661 | 3300019032 | Marine | TWGEPYTKNSIKFFEWENAKDLKKYTSMKSAQVTAELSSSNYLQKWVD |
Ga0192869_103898641 | 3300019032 | Marine | VTKAGIKFFEWENAKDLSKYKPMTSAQVEAELKSSNYLTKWVD |
Ga0192869_104236091 | 3300019032 | Marine | MGKDGKKFFEWENAKDMSKYTKMSPTEVAAALKASNYLTKLVD |
Ga0192945_102984952 | 3300019036 | Marine | GMKFFEWENAKDVSKYKGMNSAQVTSALNASTYLKKWVD |
Ga0193123_102254492 | 3300019039 | Marine | MKFFEWENAKDLKKYAAMDSAQVAAALKASNYLQKWVD |
Ga0193123_103575721 | 3300019039 | Marine | REPVTKSGVKFFEWESAKDVSKYAEMTSAQVDAALKASNYLTKWVD |
Ga0193123_103878481 | 3300019039 | Marine | FGREAVTKNGVKFFEWENAKDVSKYAKMTSAEVDAALKASNYLSKWVD |
Ga0193123_103963451 | 3300019039 | Marine | YTKEGIKYFEWENAKDLSKYAKMNSAQVSAELKTSNYLEKWVD |
Ga0193123_104366731 | 3300019039 | Marine | YFEWENAKDVSKYAKMTSEQVTSELKASNYLTKWVD |
Ga0193336_100084602 | 3300019045 | Marine | MKFFEWENAKDLAKYVSMDSAQVTAALKGSNYLTKWVD |
Ga0193336_100196281 | 3300019045 | Marine | MKFFEWENAKDLSKYSAMTPASVDAELKKSDFLQKWVD |
Ga0193336_100323042 | 3300019045 | Marine | VTKDGKKYFEWENAKDVSKYKAMKSEEVTAALKASNYLTKWVD |
Ga0193336_101070161 | 3300019045 | Marine | MKCFEWENAKDLSKYVAMTPEAVSKELKASNYLTKWVD |
Ga0193336_102902782 | 3300019045 | Marine | MKFFEWENAKDLSKYKSMNSDQVLAELKASNYLTKWVD |
Ga0193336_103287602 | 3300019045 | Marine | EPYTKDGKKFFEWESPVDLKKYGGMSTDQVNVELKASNYLNKWVD |
Ga0193336_106023872 | 3300019045 | Marine | QPYESFGVKYFEWENAKDPSKYAQMGSANVSRELAASNFLDKWVD |
Ga0193336_106506321 | 3300019045 | Marine | RQPYEKDGVKHFVWEQPKDLSKYKSMTSSQVKDTLKASNYLQK |
Ga0192966_102657791 | 3300019050 | Marine | YTKDGMKFFEWENAKDLAKYKSMTSAQVDATLKSSNYLTKWVD |
Ga0193208_103314341 | 3300019055 | Marine | VKFFEWENAKDLKKYADMDSAQVSAALKSSNYLTKWVD |
Ga0193208_104447321 | 3300019055 | Marine | VTKDGVKFFEWENAKDLSRFAPMTSEQVLTELKSSNYLTKWVD |
Ga0193106_10382481 | 3300019112 | Marine | DGIKFFEWENAKDLKKYAPMTSAQVTAALKASTYLTKWVD |
Ga0193054_10740572 | 3300019117 | Marine | PETKDGKKFFEWESAKDMSKYAKMSPAEITAALTASNYLTKWVD |
Ga0193104_10550192 | 3300019125 | Marine | TWGENAKDLSKYKPMTSDQVTAALKSSTYLTKWVD |
Ga0194244_101183091 | 3300019150 | Marine | MGWENAKDMSKYAKMSPTEVAAALKASNYLTKWVD |
Ga0211644_104473552 | 3300020416 | Marine | MKFFSWENAKDLSKYASMTADQVEAALKGSDYLTKWVD |
Ga0206688_104586501 | 3300021345 | Seawater | PETKNGKKFFEWENAKDMSKYKAMSPEEVGAALKASNYLQKWVD |
Ga0063755_10597872 | 3300021954 | Marine | MKFFEWENAKDLSKYKSMTSAQVEAELKASNYLTKWVD |
Ga0247567_11178591 | 3300028338 | Seawater | VTKDGMKFFEWENAKDMSKYSKMSSEEVSAALKASNYLTKWVD |
Ga0307401_103597201 | 3300030670 | Marine | MKFFEWEHAKDLSNYKSMNSAQVESELKASSYLTKW |
Ga0073969_113833181 | 3300030749 | Marine | TKDGIKFFEWENAKDLKKYAPMTSAEVTAALKASTYLTKWVD |
Ga0073987_110939421 | 3300030912 | Marine | HFGRKPETKDGMKLFEWENAKDMAKYAKQSPAEITAALKASNYLQKWVD |
Ga0073975_15581581 | 3300031007 | Marine | CKFFEWENAKDMKKYAGMSAEEVGAALKSSNFLDKWVD |
Ga0138345_100481412 | 3300031121 | Marine | VTKNGIKFFEWENAKDLSKYKSMSSAQVDAALTASNYLTKWVD |
Ga0307388_110189451 | 3300031522 | Marine | KFFEWENAKDLAKYSKMTPAEVDADLKKSDFLTKWVD |
Ga0308148_10329741 | 3300031557 | Marine | MFFVWENAIDLSKYKAMNSTQVDAALTASNHTNKWVD |
Ga0307386_106987491 | 3300031710 | Marine | DPVTKNGIKFFEWENAKDLSRFAKMTSVEVAQELKASNYLTKWVD |
Ga0307386_108245902 | 3300031710 | Marine | DGKKFFEWESAKDMAKYAKMSPAEITAALTASNYLQKWVD |
Ga0307384_106123801 | 3300031738 | Marine | TEGGKKFFEWENAKDLGKYKSMKSADVSAALKSSNYLTKWVD |
Ga0314688_107774182 | 3300032517 | Seawater | MKYFEWENAKDLSKYKAMTGAQVEAELKASNYLTKWVD |
Ga0314676_107294672 | 3300032519 | Seawater | FEWENAKDLSRFAKMTSAEVAQELKASNYLTKWVD |
Ga0314669_103390501 | 3300032708 | Seawater | PVTKDGLKFFEWENAKDVSKYKGMNSGEVAAALKASNYLTKWVD |
Ga0314707_107021751 | 3300032743 | Seawater | FGRDPVTKNGIKFFEWENAKDLSRFAKMTSAEVAQELKASNYLTKWVD |
Ga0314712_100284822 | 3300032747 | Seawater | VTKNGIKFFEWENAKDLSKYKTMNSEQVAAELKASNYLTKWVD |
Ga0314713_105057831 | 3300032748 | Seawater | THQGIKYFEWENSKDLSEFKGMTSAQVGAALKSSNYLTKWVD |
⦗Top⦘ |