NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F079744

Metagenome / Metatranscriptome Family F079744

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F079744
Family Type Metagenome / Metatranscriptome
Number of Sequences 115
Average Sequence Length 43 residues
Representative Sequence MTTNGESKFSYLLIGLGLGAVGGLMAAILARKETRELLRERSGK
Number of Associated Samples 111
Number of Associated Scaffolds 115

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 95.54 %
% of genes near scaffold ends (potentially truncated) 84.35 %
% of genes from short scaffolds (< 2000 bps) 91.30 %
Associated GOLD sequencing projects 107
AlphaFold2 3D model prediction Yes
3D model pTM-score0.49

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (88.696 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil
(13.043 % of family members)
Environment Ontology (ENVO) Unclassified
(39.130 % of family members)
Earth Microbiome Project Ontology (EMPO) Host-associated → Plant → Plant rhizosphere
(34.783 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Transmembrane (alpha-helical) Signal Peptide: No Secondary Structure distribution: α-helix: 54.17%    β-sheet: 0.00%    Coil/Unstructured: 45.83%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  		pTM-score: 0.49
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 115 Family Scaffolds
PF04972BON 51.30
PF08085Entericidin 6.09
PF01553Acyltransferase 6.09
PF01435Peptidase_M48 5.22
PF05494MlaC 3.48
PF02915Rubrerythrin 1.74
PF04366Ysc84 0.87
PF04191PEMT 0.87
PF01734Patatin 0.87
PF02867Ribonuc_red_lgC 0.87
PF13439Glyco_transf_4 0.87
PF02922CBM_48 0.87

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 115 Family Scaffolds
COG5510Predicted small secreted proteinFunction unknown [S] 6.09
COG2854Periplasmic subunit MlaC of the ABC-type intermembrane phospholipid transporter MlaCell wall/membrane/envelope biogenesis [M] 3.48
COG0209Ribonucleotide reductase alpha subunitNucleotide transport and metabolism [F] 0.87
COG1752Predicted acylesterase/phospholipase RssA, containd patatin domainGeneral function prediction only [R] 0.87
COG2930Lipid-binding SYLF domain, Ysc84/FYVE familyLipid transport and metabolism [I] 0.87
COG3621Patatin-like phospholipase/acyl hydrolase, includes sporulation protein CotRGeneral function prediction only [R] 0.87
COG4667Predicted phospholipase, patatin/cPLA2 familyLipid transport and metabolism [I] 0.87

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms88.70 %
UnclassifiedrootN/A11.30 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2199352025|deepsgr__Contig_29043All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria1003Open in IMG/M
2209111006|2214922443All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium546Open in IMG/M
3300000550|F24TB_16424608All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria682Open in IMG/M
3300003994|Ga0055435_10155226All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria640Open in IMG/M
3300004009|Ga0055437_10135059All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria754Open in IMG/M
3300004114|Ga0062593_100518279All Organisms → cellular organisms → Bacteria1111Open in IMG/M
3300004156|Ga0062589_101939867All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium595Open in IMG/M
3300005289|Ga0065704_10026570All Organisms → cellular organisms → Bacteria → Proteobacteria1783Open in IMG/M
3300005295|Ga0065707_10679497All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium639Open in IMG/M
3300005295|Ga0065707_10773528All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria609Open in IMG/M
3300005330|Ga0070690_101080501Not Available635Open in IMG/M
3300005335|Ga0070666_10932100All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria643Open in IMG/M
3300005354|Ga0070675_101309721All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria668Open in IMG/M
3300005355|Ga0070671_100559420All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium987Open in IMG/M
3300005364|Ga0070673_100464969All Organisms → cellular organisms → Bacteria1139Open in IMG/M
3300005366|Ga0070659_101038729All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria720Open in IMG/M
3300005406|Ga0070703_10231244All Organisms → cellular organisms → Bacteria741Open in IMG/M
3300005507|Ga0074259_10415156All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria759Open in IMG/M
3300005536|Ga0070697_100445191All Organisms → cellular organisms → Bacteria → Proteobacteria1128Open in IMG/M
3300005546|Ga0070696_100323187All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1188Open in IMG/M
3300005549|Ga0070704_100968977All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium768Open in IMG/M
3300005618|Ga0068864_100824521All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium913Open in IMG/M
3300005830|Ga0074473_10157246All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria567Open in IMG/M
3300006845|Ga0075421_101150067All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium869Open in IMG/M
3300006847|Ga0075431_101756535Not Available577Open in IMG/M
3300006914|Ga0075436_101305058Not Available549Open in IMG/M
3300007004|Ga0079218_13361203All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium542Open in IMG/M
3300009131|Ga0115027_11299298All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria587Open in IMG/M
3300009147|Ga0114129_11557777All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria810Open in IMG/M
3300009148|Ga0105243_10891902All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria884Open in IMG/M
3300009157|Ga0105092_10063810All Organisms → cellular organisms → Bacteria → Proteobacteria1989Open in IMG/M
3300009168|Ga0105104_10584096All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium635Open in IMG/M
3300009551|Ga0105238_12374795All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium566Open in IMG/M
3300009610|Ga0105340_1035038All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria1952Open in IMG/M
3300009801|Ga0105056_1000825All Organisms → cellular organisms → Bacteria → Proteobacteria2403Open in IMG/M
3300009812|Ga0105067_1015079All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria1024Open in IMG/M
3300009821|Ga0105064_1001850All Organisms → cellular organisms → Bacteria → Proteobacteria3097Open in IMG/M
3300009837|Ga0105058_1036151All Organisms → cellular organisms → Bacteria → Proteobacteria1079Open in IMG/M
3300010399|Ga0134127_10542166All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria1182Open in IMG/M
3300010399|Ga0134127_10596684All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1132Open in IMG/M
3300010401|Ga0134121_10536702All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria1084Open in IMG/M
3300011398|Ga0137348_1030254All Organisms → cellular organisms → Bacteria → Proteobacteria879Open in IMG/M
3300011443|Ga0137457_1344084All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria508Open in IMG/M
3300012035|Ga0137445_1033483All Organisms → cellular organisms → Bacteria → Proteobacteria976Open in IMG/M
3300012203|Ga0137399_11691532All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium521Open in IMG/M
3300012225|Ga0137434_1041602All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria680Open in IMG/M
3300012906|Ga0157295_10048073All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1004Open in IMG/M
3300012960|Ga0164301_10354883All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria1009Open in IMG/M
3300013307|Ga0157372_10346623All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1730Open in IMG/M
3300013308|Ga0157375_10888491Not Available1036Open in IMG/M
3300014870|Ga0180080_1018349All Organisms → cellular organisms → Bacteria → Proteobacteria981Open in IMG/M
3300014873|Ga0180066_1012558All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria1473Open in IMG/M
3300014878|Ga0180065_1035690All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria1043Open in IMG/M
3300014880|Ga0180082_1112243All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria622Open in IMG/M
3300014883|Ga0180086_1153628All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria599Open in IMG/M
3300014884|Ga0180104_1261813All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria514Open in IMG/M
3300014885|Ga0180063_1221415Not Available607Open in IMG/M
3300014885|Ga0180063_1304371All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria505Open in IMG/M
3300015252|Ga0180075_1025527All Organisms → cellular organisms → Bacteria871Open in IMG/M
3300015259|Ga0180085_1240876All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria533Open in IMG/M
3300017936|Ga0187821_10058508All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1388Open in IMG/M
3300018031|Ga0184634_10027187All Organisms → cellular organisms → Bacteria → Proteobacteria2232Open in IMG/M
3300018052|Ga0184638_1315096All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria527Open in IMG/M
3300018054|Ga0184621_10085765All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria1100Open in IMG/M
3300018056|Ga0184623_10265877All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria781Open in IMG/M
3300018072|Ga0184635_10059244All Organisms → cellular organisms → Bacteria → Proteobacteria1485Open in IMG/M
3300018075|Ga0184632_10404270All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria573Open in IMG/M
3300018079|Ga0184627_10084217All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1670Open in IMG/M
3300021063|Ga0206227_1053875All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria739Open in IMG/M
3300021080|Ga0210382_10387440All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria618Open in IMG/M
3300021081|Ga0210379_10424237All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria588Open in IMG/M
3300025289|Ga0209002_10297286Not Available952Open in IMG/M
3300025319|Ga0209520_10834747All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria503Open in IMG/M
3300025537|Ga0210061_1092392All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium533Open in IMG/M
3300025551|Ga0210131_1071876Not Available583Open in IMG/M
3300025899|Ga0207642_10184120All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1140Open in IMG/M
3300025903|Ga0207680_10550557All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria824Open in IMG/M
3300025914|Ga0207671_10148971All Organisms → cellular organisms → Bacteria → Acidobacteria1807Open in IMG/M
3300025918|Ga0207662_10070495All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium2114Open in IMG/M
3300025921|Ga0207652_11620354All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium552Open in IMG/M
3300025925|Ga0207650_10568313All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria952Open in IMG/M
3300025942|Ga0207689_10056769All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium3222Open in IMG/M
3300025953|Ga0210068_1026620All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria849Open in IMG/M
3300025961|Ga0207712_11019099All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium735Open in IMG/M
3300025972|Ga0207668_10222111All Organisms → cellular organisms → Bacteria → Proteobacteria1518Open in IMG/M
3300026023|Ga0207677_10434958All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1121Open in IMG/M
3300026088|Ga0207641_10859013All Organisms → cellular organisms → Bacteria900Open in IMG/M
3300026089|Ga0207648_10256838All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1559Open in IMG/M
3300027006|Ga0209896_1010123All Organisms → cellular organisms → Bacteria1013Open in IMG/M
3300027056|Ga0209879_1029079All Organisms → cellular organisms → Bacteria → Proteobacteria918Open in IMG/M
3300027815|Ga0209726_10016801All Organisms → cellular organisms → Bacteria6550Open in IMG/M
3300027821|Ga0209811_10014525All Organisms → cellular organisms → Bacteria → Proteobacteria2539Open in IMG/M
3300027840|Ga0209683_10229510All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium853Open in IMG/M
3300027907|Ga0207428_10980230All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria595Open in IMG/M
3300027907|Ga0207428_11308016All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria502Open in IMG/M
3300027909|Ga0209382_11395967All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium704Open in IMG/M
3300028884|Ga0307308_10208635All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria936Open in IMG/M
3300030006|Ga0299907_10366257Not Available1164Open in IMG/M
3300030540|Ga0247649_1020232Not Available701Open in IMG/M
3300030551|Ga0247638_1015655All Organisms → cellular organisms → Bacteria → Proteobacteria1103Open in IMG/M
3300030634|Ga0247636_10256990All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria578Open in IMG/M
3300031229|Ga0299913_10932589All Organisms → cellular organisms → Bacteria837Open in IMG/M
3300031538|Ga0310888_10840038All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium571Open in IMG/M
3300031944|Ga0310884_10840495All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria563Open in IMG/M
3300032180|Ga0307471_103708237Not Available540Open in IMG/M
3300032211|Ga0310896_10712342All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria569Open in IMG/M
3300032770|Ga0335085_11796617All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria628Open in IMG/M
3300033412|Ga0310810_11367173All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria547Open in IMG/M
3300033486|Ga0316624_11852773All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria558Open in IMG/M
3300033513|Ga0316628_104086984All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria520Open in IMG/M
3300034147|Ga0364925_0426945All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria504Open in IMG/M
3300034354|Ga0364943_0026308All Organisms → cellular organisms → Bacteria → Proteobacteria1830Open in IMG/M


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Soil13.04%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment6.96%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere6.09%
Groundwater SandEnvironmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand5.22%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere5.22%
Natural And Restored WetlandsEnvironmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands4.35%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil4.35%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil3.48%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere3.48%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere3.48%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil2.61%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil2.61%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil2.61%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil2.61%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment1.74%
Groundwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment1.74%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Switchgrass Rhizosphere1.74%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil1.74%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere1.74%
SedimentEnvironmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment1.74%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere1.74%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere1.74%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere1.74%
WetlandEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Wetland0.87%
Wetland SedimentEnvironmental → Aquatic → Freshwater → Wetlands → Unclassified → Wetland Sediment0.87%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment0.87%
GroundwaterEnvironmental → Aquatic → Freshwater → Groundwater → Contaminated → Groundwater0.87%
Sediment (Intertidal)Environmental → Aquatic → Sediment → Unclassified → Unclassified → Sediment (Intertidal)0.87%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil0.87%
Surface SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil0.87%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil0.87%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil0.87%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Uranium Contaminated → Soil0.87%
Rice Paddy SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil0.87%
SoilEnvironmental → Terrestrial → Soil → Loam → Grasslands → Soil0.87%
Corn RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere0.87%
Deep Subsurface SedimentEnvironmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface Sediment0.87%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Switchgrass Rhizosphere0.87%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere0.87%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.87%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere0.87%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.87%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere0.87%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere0.87%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
2199352025Soil microbial communities from Rothamsted, UK, for project Deep Soil - DEEP SOILEnvironmentalOpen in IMG/M
2209111006Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0Host-AssociatedOpen in IMG/M
3300000550Amended soil microbial communities from Kansas Great Prairies, USA - BrdU amended with acetate total DNA F2.4 TB clc assemlyEnvironmentalOpen in IMG/M
3300003994Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_ThreeSqA_D2EnvironmentalOpen in IMG/M
3300004009Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_ThreeSqC_D2EnvironmentalOpen in IMG/M
3300004114Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5EnvironmentalOpen in IMG/M
3300004156Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 1EnvironmentalOpen in IMG/M
3300005289Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2Host-AssociatedOpen in IMG/M
3300005295Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3EnvironmentalOpen in IMG/M
3300005330Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaGEnvironmentalOpen in IMG/M
3300005335Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaGHost-AssociatedOpen in IMG/M
3300005354Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaGHost-AssociatedOpen in IMG/M
3300005355Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaGHost-AssociatedOpen in IMG/M
3300005364Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaGHost-AssociatedOpen in IMG/M
3300005366Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaGHost-AssociatedOpen in IMG/M
3300005406Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaGEnvironmentalOpen in IMG/M
3300005507Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Mutant cpr5Host-AssociatedOpen in IMG/M
3300005536Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaGEnvironmentalOpen in IMG/M
3300005546Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaGEnvironmentalOpen in IMG/M
3300005549Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaGEnvironmentalOpen in IMG/M
3300005618Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2Host-AssociatedOpen in IMG/M
3300005830Microbial communities from Youngs Bay mouth sediment, Columbia River estuary, Oregon - S.178_YBMEnvironmentalOpen in IMG/M
3300006845Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5Host-AssociatedOpen in IMG/M
3300006847Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5Host-AssociatedOpen in IMG/M
3300006914Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5Host-AssociatedOpen in IMG/M
3300007004Agricultural soil microbial communities from Utah to study Nitrogen management - NC CompostEnvironmentalOpen in IMG/M
3300009131Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Open_0915_D1EnvironmentalOpen in IMG/M
3300009147Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2)Host-AssociatedOpen in IMG/M
3300009148Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaGHost-AssociatedOpen in IMG/M
3300009157Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 19-21cm March2015EnvironmentalOpen in IMG/M
3300009168Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 19-21cm September2015EnvironmentalOpen in IMG/M
3300009551Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaGHost-AssociatedOpen in IMG/M
3300009610Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT700EnvironmentalOpen in IMG/M
3300009801Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S2_20_30EnvironmentalOpen in IMG/M
3300009812Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N2_50_60EnvironmentalOpen in IMG/M
3300009821Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S1_20_30EnvironmentalOpen in IMG/M
3300009837Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N1_20_30EnvironmentalOpen in IMG/M
3300010399Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3EnvironmentalOpen in IMG/M
3300010400Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2EnvironmentalOpen in IMG/M
3300010401Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1EnvironmentalOpen in IMG/M
3300011398Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT600_2EnvironmentalOpen in IMG/M
3300011443Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT630_2EnvironmentalOpen in IMG/M
3300012035Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT338_2EnvironmentalOpen in IMG/M
3300012203Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaGEnvironmentalOpen in IMG/M
3300012225Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT860_2EnvironmentalOpen in IMG/M
3300012906Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S212-509R-1EnvironmentalOpen in IMG/M
3300012960Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MGEnvironmentalOpen in IMG/M
3300013307Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaGHost-AssociatedOpen in IMG/M
3300013308Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaGHost-AssociatedOpen in IMG/M
3300014870Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT560_16_10DEnvironmentalOpen in IMG/M
3300014873Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT200B_16_10DEnvironmentalOpen in IMG/M
3300014878Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT200A_16_10DEnvironmentalOpen in IMG/M
3300014880Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT660_16_10DEnvironmentalOpen in IMG/M
3300014883Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT760_16_10DEnvironmentalOpen in IMG/M
3300014884Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT730_16_1DaEnvironmentalOpen in IMG/M
3300014885Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLIBT47_16_10DEnvironmentalOpen in IMG/M
3300015252Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT399_16_10DEnvironmentalOpen in IMG/M
3300015259Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT730_16_10DEnvironmentalOpen in IMG/M
3300017936Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_1EnvironmentalOpen in IMG/M
3300018031Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_200_b1EnvironmentalOpen in IMG/M
3300018052Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_50_b2EnvironmentalOpen in IMG/M
3300018054Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_30_b1EnvironmentalOpen in IMG/M
3300018056Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_100_b1EnvironmentalOpen in IMG/M
3300018063Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_127_b2EnvironmentalOpen in IMG/M
3300018072Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_30_b2EnvironmentalOpen in IMG/M
3300018075Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_50_b1EnvironmentalOpen in IMG/M
3300018079Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_127_b1EnvironmentalOpen in IMG/M
3300021063Subsurface sediment microbial communities from Mancos shale, Colorado, United States - Mancos D4EnvironmentalOpen in IMG/M
3300021080Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_60_coex redoEnvironmentalOpen in IMG/M
3300021081Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_32_coex redoEnvironmentalOpen in IMG/M
3300025289Soil microbial communities from Rifle, Colorado, USA - sediment 16ft 2EnvironmentalOpen in IMG/M
3300025319Soil microbial communities from Rifle, Colorado, USA - sediment 16ft 1EnvironmentalOpen in IMG/M
3300025537Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_CattailC_D1 (SPAdes)EnvironmentalOpen in IMG/M
3300025551Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_ThreeSqA_D2 (SPAdes)EnvironmentalOpen in IMG/M
3300025899Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025903Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025914Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025918Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025921Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025925Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025942Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025953Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushOxbow_ThreeSqA_D2 (SPAdes)EnvironmentalOpen in IMG/M
3300025961Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025972Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026003Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_20C_80N_201 (SPAdes)EnvironmentalOpen in IMG/M
3300026023Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026088Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026089Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300027006Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S2_20_30 (SPAdes)EnvironmentalOpen in IMG/M
3300027056Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N3_20_30 (SPAdes)EnvironmentalOpen in IMG/M
3300027815Subsurface groundwater microbial communities from S. Glens Falls, New York, USA - GMW46 contaminated, 5.4 m (SPAdes)EnvironmentalOpen in IMG/M
3300027821Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire. - Coalmine Soil_Cen17_06102014_R1 (SPAdes)EnvironmentalOpen in IMG/M
3300027840Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T4Bare2Fresh (SPAdes)EnvironmentalOpen in IMG/M
3300027907Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes)Host-AssociatedOpen in IMG/M
3300027909Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 (SPAdes)Host-AssociatedOpen in IMG/M
3300028884Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_195EnvironmentalOpen in IMG/M
3300030006Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT152D67EnvironmentalOpen in IMG/M
3300030540Metatranscriptome of soil fungal communities from truffle orchard in Rollainville, France - Db2 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030551Metatranscriptome of soil fungal communities from truffle orchard in Rollainville, France - Cb3 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030634Metatranscriptome of soil fungal communities from truffle orchard in Rollainville, France - Cb1 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031229Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT155D38EnvironmentalOpen in IMG/M
3300031538Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D1EnvironmentalOpen in IMG/M
3300031944Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D1EnvironmentalOpen in IMG/M
3300032180Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515EnvironmentalOpen in IMG/M
3300032211Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8D1EnvironmentalOpen in IMG/M
3300032770Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5EnvironmentalOpen in IMG/M
3300033412Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - NCEnvironmentalOpen in IMG/M
3300033486Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_N3_C1_D5_AEnvironmentalOpen in IMG/M
3300033513Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M2_C1_D5_CEnvironmentalOpen in IMG/M
3300034147Sediment microbial communities from East River floodplain, Colorado, United States - 44_j17EnvironmentalOpen in IMG/M
3300034354Sediment microbial communities from East River floodplain, Colorado, United States - 23_s17EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
deepsgr_000949502199352025SoilMTTNGESKFSYLLVGLGLGAIGGLMAAILGRKETREVLRERGGKSLDY
22139829512209111006Arabidopsis RhizosphereMTTNSESKVSYLLIGLGLGAVGGLMAALLVRKETREAI
F24TB_1642460813300000550SoilMTTNGESKFSYLLVGLGLGAIGGFMAAILGRRETREVLRERGGKGLDYLN
Ga0055435_1015522613300003994Natural And Restored WetlandsKFSYLLIGLGLGAIGALMFALVARKETRELPRERSKTLD*
Ga0055437_1013505933300004009Natural And Restored WetlandsMETNGESKFSYLLIGLGLGAIGGLMAALLARKETRELLRERSTETLD
Ga0062593_10051827913300004114SoilMRTNSESKFSYLLIGLGLGAVGGLMAALLVRKETREIIRDSSRKSLDYLNQQ
Ga0062589_10193986723300004156SoilMRTNSESKFSYLLIGLGLGAVGGLMAALLVRKETREIIRDSSRK
Ga0065704_1002657023300005289Switchgrass RhizosphereMKNNGESKFSYLLIGLGLGAIGALMFALVARKETRELPRERTSKTLD*
Ga0065707_1067949713300005295Switchgrass RhizosphereMTTNGESKFSHLLIGLGLGAIGGLVAAILANKESRDLLRERSGKS
Ga0065707_1077352813300005295Switchgrass RhizosphereMKTNGESKFSYLLIGLGLGAIGALMFALVARKETRELPRERSSKSLD*
Ga0070690_10108050113300005330Switchgrass RhizosphereMTTNSESKVSYLLVGLGLGAVGGLMAALLVRKETREIIRDR
Ga0070666_1093210013300005335Switchgrass RhizosphereMTTNGESKFSYLLIGLGLGAVGGLMAAILARKETREVLRERSGKS
Ga0070675_10130972113300005354Miscanthus RhizosphereMTTNGESKFSYLLIGLGAVGGLMAAILARKETRELLRERSGKSLDYLNQQA
Ga0070671_10055942013300005355Switchgrass RhizosphereMAANGESKFSYLFIALGLGAVGGLMAAIIARKETREVLRERSGKSLDYLNQQ
Ga0070673_10046496913300005364Switchgrass RhizosphereMTTNGESKFSYLLIGLGLGAVGGLMAAILARKETRETLRERSGKSLDYLNQQ
Ga0070659_10103872913300005366Corn RhizosphereMTTNGESKFSYLLIGLGLGAVGGLMAAILARKETRELLRERSGK
Ga0070703_1023124413300005406Corn, Switchgrass And Miscanthus RhizosphereMTTNSESKVSYLLVGLGLGAVGGLMAALLVRKETREIIRD
Ga0074259_1041515623300005507Arabidopsis RhizosphereMRTNDESKFSFLLIGLGLGVIGGMMAVLLARKETRESLNERSRKT
Ga0070697_10044519133300005536Corn, Switchgrass And Miscanthus RhizosphereMTTNDESKFSYLLVGLGLGAIGGLMAALLARKETRELLRER
Ga0070696_10032318713300005546Corn, Switchgrass And Miscanthus RhizosphereMTTNGESKFSYLLIGLGLGAVGGLMAAILARKETRELLRERSGKS
Ga0070704_10096897713300005549Corn, Switchgrass And Miscanthus RhizosphereMRTNSESKFSYLLIGLGLGAVGGLMAALLVRKETREIIRERSP*
Ga0068864_10082452123300005618Switchgrass RhizosphereMTTNSESKVSYLLVGLGLGAVGGLMAALLVRKETREI
Ga0074473_1015724613300005830Sediment (Intertidal)MTTNGESKFSYLLIGLGLGAIGGLMSALLARKETREL
Ga0075421_10115006723300006845Populus RhizosphereMTTNSESKVSYLLIGLGLGAVGGLMAALLVRKETREAIRERSRKSLDY
Ga0075431_10175653533300006847Populus RhizosphereMKTNDESKFSFLLIGLGLGVIGGMMAVLLARKETRESLSER
Ga0075436_10130505833300006914Populus RhizosphereMTTNDESKFSYLLVGLGLGVIGGVMATLLARKETRELLRER
Ga0079218_1336120313300007004Agricultural SoilMTNNDESKFSYLLIGLGLGAVGGLMAAMLAHKETRE
Ga0115027_1129929813300009131WetlandMRTNDDGKLFFLLIGLGLGAIGGLIAALLAREENREALREGGAKSLEYLNE
Ga0114129_1155777733300009147Populus RhizosphereMTTNGESKFSYLLIGLGLGAIGGLMSALLARKETRELLRERSGKSLDYLNQ
Ga0105243_1089190223300009148Miscanthus RhizosphereMTTNGESKFSYLLIGLGLGAVGGLMAAILARKETRETLRERSGKSLDYL
Ga0105092_1006381023300009157Freshwater SedimentMTNGESKFSYLLIGLGLGAIGALMFALVARKETRELPRERS*
Ga0105104_1058409613300009168Freshwater SedimentMKTNGESKFSYLLIGLGLGAIGALMFALVARKETRELPRERSSETLD*
Ga0105238_1237479513300009551Corn RhizosphereMAANGESKFSYLFIALGLGAVGGLMAAIIARKETREVLR
Ga0105340_103503813300009610SoilMTTRGGSRFSYLLTGLGLGAIGGILAAILARKETREAFRERRA
Ga0105056_100082543300009801Groundwater SandMKTNGESKFSYLLIGLGLGAIGALMFALLAREETRELPRERSSKTLD*
Ga0105067_101507933300009812Groundwater SandSKFSYLLIGLGLGAIGALMFALLAREETRELPRERSSKTLD*
Ga0105064_100185053300009821Groundwater SandMKTNGESKFSYLLIGLGLGAIGALMFALVARKETRELPRERSSKTLD*
Ga0105058_103615133300009837Groundwater SandMKTNGESKFSYLLIGLGLGAIGALMFALLAREETRELPRERSSKPLD*
Ga0134127_1054216613300010399Terrestrial SoilMRTNDESKLSFLLIGLGLGVIGGMMAVLLPRKETRESLSERS
Ga0134127_1059668433300010399Terrestrial SoilMTTNGEAKISYLVIGLGLGAIGGLMAAVFASKETRQLLRERSGKSL
Ga0134122_1196232923300010400Terrestrial SoilMRERNERGDKRMETNDESKFSYLLIGLGLAAIGGLMAGLLARREIRELLRERSG
Ga0134121_1053670213300010401Terrestrial SoilMRTNDESKFSFLLIGLGLGVIGGMMAVLLARKETRES
Ga0137348_103025433300011398SoilMTTRGESRFSYLLTGLGLGAIGGILAAILARKETREAF
Ga0137457_134408423300011443SoilMKPNGESKNSFLLIGLGLAAIGALMAALLARKETRES
Ga0137445_103348333300012035SoilMRTNGESKNSVLLIGLGLAAIGALMAALLARKETRESL
Ga0137399_1169153213300012203Vadose Zone SoilMTTNGESKFSYLLVGLGLGAIGGLMAAILGRKETREVLRERGGK
Ga0137434_104160233300012225SoilMRTKGESRFALLLIGLGLGAMGALVAGLLARKETRELLRERSTEALDYL
Ga0157295_1004807333300012906SoilMTTNSESKFSYLLIGLGLGAVGGLMAALLVRKETREIIRERS
Ga0164301_1035488323300012960SoilMTTNGESKFSYLLVGLGLGAIGGFMAAILGRKETR*
Ga0157372_1034662313300013307Corn RhizosphereMTTNSESKVSYLLVGLGLGAVGGLMAALLVRKETRE
Ga0157375_1088849113300013308Miscanthus RhizosphereMRTNDESKLSFLLIGLGLGVIGGMMAVLLARKETRESLSERSRKTID
Ga0180080_101834913300014870SoilMRTNGESKFSFLLIGLGLGAIGGLMFALLARKETRKYLREQSDKGLDILN
Ga0180066_101255843300014873SoilMTTNGESKFSYLLIGLGLGAIGGLMSALLGRKETR
Ga0180065_103569023300014878SoilMRTNGESKFSFLLIGLGLGAIGGLMAALLARKETRELLRQRGGKTVDY
Ga0180082_111224313300014880SoilMTTNGESKFSYLFIGLGLGLGAIGGLMFALLARKETRELLRERSSKTLDYLNQH
Ga0180086_115362823300014883SoilMTTNDESKFSYLLVGLGLGAVGGLMAAILARKETRDV
Ga0180104_126181323300014884SoilMRTNGEAKFSVLLIGLSLGAIGALMGALLARKETRESLR
Ga0180063_122141513300014885SoilMQKEEKLMSTNGESKFSYLLIGLGLGAIGGLLSALLGRKETRELL
Ga0180063_130437123300014885SoilMRTNGEAKFSFLLIGLGLGAIGALMAALLARKETRE
Ga0180075_102552713300015252SoilMQKEEKLMTTNGESKFSYLLIGLGLGAIGGLMAALLARNET
Ga0180085_124087623300015259SoilMEKEEKLMTTNGESKFSYLLIGLGLGAIGGLMSALLGRKDTRELLRERSNKCLDY
Ga0187821_1005850843300017936Freshwater SedimentMTTNGESKFSYLLIGLGMGAIGGLMAAILAHKETR
Ga0184634_1002718753300018031Groundwater SedimentMRTKGEAKFFFLLIGLGLGAIGALMAALLARKETRE
Ga0184638_131509623300018052Groundwater SedimentMTTNGESKFSYLLIGLALGAIGGLMSALLARKETRDVLRERSGKSLDYL
Ga0184621_1008576513300018054Groundwater SedimentMTTNGESKFSDLLIGLGLGAIGGLMSALLARKETRE
Ga0184623_1026587733300018056Groundwater SedimentMTTNGESKFSYLLIGLGLGAIGGLMAAILARKETREALRERGGKSLDYLNQ
Ga0184637_1028981633300018063Groundwater SedimentMTTNGESKFSYLLIGLGLGAIGGLISAALARKETRELL
Ga0184635_1005924433300018072Groundwater SedimentMSTNGESKFSYLFIGLGLGLGAIGGLMFALLARKETRELLRERSSKT
Ga0184632_1040427013300018075Groundwater SedimentMTTNGESKFSFLLISLGLGAIGGLMFALLARKETRDLLRERSRKTL
Ga0184627_1008421743300018079Groundwater SedimentMTTNGESKFSYLLIGLGLGAIGGLISAALARKETRELIRERGRSSLDYLN
Ga0206227_105387513300021063Deep Subsurface SedimentMRMESATMRSNGEFRFPYFLVGLGRGAIGGPMSALLGRKETREFLRERS
Ga0210382_1038744033300021080Groundwater SedimentMTTNGESKFSYLLIGLALGAIGGLMSALLARKETRDVLR
Ga0210379_1042423723300021081Groundwater SedimentMRTNGESKFSFLLIGLGLGAIGGLMAALLARKETRELLRQRGGKT
Ga0209002_1029728623300025289SoilMKTNVETKFSYFLVGLGLGAIGGLMAALLARQEGRELL
Ga0209520_1083474723300025319SoilMTTNGESKFSHLLIGLGLGAVGGLIAAILARKETREELRERS
Ga0210061_109239213300025537Natural And Restored WetlandsMTTNGESKVSYLLIGLGLGAVGGLLAALLVRKETREIIRERSRESLDYLNQK
Ga0210131_107187633300025551Natural And Restored WetlandsKFSYLLIGLGLGAIGALMFALVARKETRELPRERSKTLD
Ga0207642_1018412023300025899Miscanthus RhizosphereMTTNGESKFSYLLIGLGLGAVGGLMAAILARKETRETLRE
Ga0207680_1055055723300025903Switchgrass RhizosphereMTTNGESKFSYLLIGLGLGAVGGLMAAILARKETREVLRERSGKSLDY
Ga0207671_1014897133300025914Corn RhizosphereMTTNSESKVSYLLVGLGLGAVGGLMAALLVRKETREIIRDRSRKSLD
Ga0207662_1007049523300025918Switchgrass RhizosphereMTTNSESKVSYLLVGLGLGAVGGLMAALLVRKETREIIRERSP
Ga0207652_1162035413300025921Corn RhizosphereMRTNSESKFSYLLIGLGLGAVGGLMAALLVRKETREII
Ga0207650_1056831333300025925Switchgrass RhizosphereMRTNDESKFSFLLIGLGLGVIGGMMAVLLARKETRESLSERSRKT
Ga0207689_1005676923300025942Miscanthus RhizosphereMTTNSESKVSYLLIGLGLGAVGGLMAALLVRKETREIIRERSP
Ga0210068_102662033300025953Natural And Restored WetlandsMTTNGESKFSYLFIGLCLGLGAIGGLVFALLARKE
Ga0207712_1101909913300025961Switchgrass RhizosphereMTTNGESKLSYLLIGLGLGAVGGLMAAILARKETRELL
Ga0207668_1022211113300025972Switchgrass RhizosphereMTTNGESKFSYLLVGLGLGAIGGFMAAIPGRRETR
Ga0208284_101987613300026003Rice Paddy SoilMKTNGETKFFYFLGGLGLGAIGGLISGLLARKDTRD
Ga0207677_1043495813300026023Miscanthus RhizosphereMTTNSESKVSYLLVGLGLGAVGGLMAALLVRKETREII
Ga0207641_1085901323300026088Switchgrass RhizosphereSGSKVSYLLIGLGLGAVGGLMAALLVRKETREIIRERSP
Ga0207648_1025683813300026089Miscanthus RhizosphereMTTNSESKVSYLLVGLGLGAVGGLMAALLVRKETREIIRDRS
Ga0209896_101012333300027006Groundwater SandMKTNGESKFSYLLIGLGLGAIGALMFALLAREETRELPRERSSKTLD
Ga0209879_102907913300027056Groundwater SandMKTNGESKFSYLLIGLGLGAIGALMFALLAREETRELPRERSSKPLD
Ga0209726_10016801133300027815GroundwaterMRTDSEFKFSILLIGLGLGAIGGLMAVLLARKETRASLRESSGKTLDY
Ga0209811_1001452513300027821Surface SoilMTTNGESKFSYLLVGLGLRAIGGLMAAILGRKETREVL
Ga0209683_1022951013300027840Wetland SedimentMTTNGESKFSYLLIGLGLGAIGGLMSALLGRKDTRELLRERS
Ga0207428_1098023013300027907Populus RhizosphereMTTNGESKFSYLLVGLGLGAIGGFMAAILGRRETREVLRERGGKG
Ga0207428_1130801623300027907Populus RhizosphereMSTNGESKFSYLFIGLGLGAIGGLMFALLARKETRELLRERSN
Ga0209382_1139596713300027909Populus RhizosphereMTTNSESKVSYLLIGLGLGAVGGLMAALLVRKETREAIRERS
Ga0307308_1020863533300028884SoilMTSDGESKFSYLLIGLGLGAVGGLMAAILARKETRELIR
Ga0299907_1036625723300030006SoilMKTNVETKFSYFLVGLGLGAIGGLMAALLARQETRELLRERSAKSLKYLN
Ga0247649_102023223300030540SoilGESKFSYLLIGLGLGAIGALMFALVARKETRELPRERSSKTLD
Ga0247638_101565513300030551SoilMKTNGESKFSYLLIGLGLGAIGALMFALVARKETRELPRERSSKTLD
Ga0247636_1025699013300030634SoilVTTNGESKFSYLLIGLALGAIGGLISAVLARKETRELLRERGRNSLDYLN
Ga0299913_1093258913300031229SoilMTTNGAAKFAYLFIGLALGAVGGLIAAILARKETREVLRERSGRSLDYLNQ
Ga0310888_1084003813300031538SoilMTTNGESKFSYLLVGLGLGAIGGFMAAILGRRETRELLRERGGKSLDYLTGG
Ga0310884_1084049513300031944SoilMTTNGESKFSYLLVGLGLGAIGGFMAAILGRRETREVLRERGGKSLDYLNQ
Ga0307471_10370823733300032180Hardwood Forest SoilMTTNDESKFSYLLVGLGLGAIGGLMAALLARKETR
Ga0310896_1071234213300032211SoilMPTNGESKFSYLLVGLGLGAIGGFMAAILGRRETREVLRERGG
Ga0335085_1179661713300032770SoilMTTNGKSTFSYLLIGLGLGAIGGLMSALLARKETRELLRERGRNSLDYLNQ
Ga0310810_1136717323300033412SoilMATNGTSKFSILLIGLGLGAIGGLMATVLGRKETREVLRESGGK
Ga0316624_1185277313300033486SoilMRTNGESKFSDLLIGLGLGAIGGLMIALLARKETRDSLRE
Ga0316628_10408698423300033513SoilMRTNGEAKFSLLLIGLGLGAIGGLMIALLARKETRDSLRESST
Ga0364925_0426945_3_1103300034147SedimentMRTNDESRFSLLLIGLGLGAIAALVAALLARKKTRE
Ga0364943_0026308_1_1533300034354SedimentMTTNSESKFSYLFIGLGLGLGAIGGLMFALLARKETRELLRERSSKTLDYL

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.