Basic Information | |
---|---|
Family ID | F079910 |
Family Type | Metagenome |
Number of Sequences | 115 |
Average Sequence Length | 47 residues |
Representative Sequence | MKRGHVTGHKQERSGKGSNWWYQTPEAEEIIRKLEAEWEAKQQQASK |
Number of Associated Samples | 78 |
Number of Associated Scaffolds | 115 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | No |
Most common taxonomic group | Unclassified |
% of genes with valid RBS motifs | 60.87 % |
% of genes near scaffold ends (potentially truncated) | 22.61 % |
% of genes from short scaffolds (< 2000 bps) | 89.57 % |
Associated GOLD sequencing projects | 71 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.36 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Unclassified (73.913 % of family members) |
NCBI Taxonomy ID | N/A |
Taxonomy | N/A |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (42.609 % of family members) |
Environment Ontology (ENVO) | Unclassified (42.609 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (46.087 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 29.33% β-sheet: 0.00% Coil/Unstructured: 70.67% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.36 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 115 Family Scaffolds |
---|---|---|
PF13560 | HTH_31 | 18.26 |
PF01381 | HTH_3 | 14.78 |
PF13443 | HTH_26 | 4.35 |
PF12844 | HTH_19 | 2.61 |
PF00239 | Resolvase | 1.74 |
PF13358 | DDE_3 | 1.74 |
PF04365 | BrnT_toxin | 0.87 |
PF07508 | Recombinase | 0.87 |
PF03400 | DDE_Tnp_IS1 | 0.87 |
PF13730 | HTH_36 | 0.87 |
PF13751 | DDE_Tnp_1_6 | 0.87 |
PF11455 | MazE-like | 0.87 |
COG ID | Name | Functional Category | % Frequency in 115 Family Scaffolds |
---|---|---|---|
COG1961 | Site-specific DNA recombinase SpoIVCA/DNA invertase PinE | Replication, recombination and repair [L] | 2.61 |
COG2452 | Predicted site-specific integrase-resolvase | Mobilome: prophages, transposons [X] | 1.74 |
COG1662 | Transposase and inactivated derivatives, IS1 family | Mobilome: prophages, transposons [X] | 0.87 |
COG2929 | Ribonuclease BrnT, toxin component of the BrnT-BrnA toxin-antitoxin system | Defense mechanisms [V] | 0.87 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
Unclassified | root | N/A | 73.91 % |
All Organisms | root | All Organisms | 26.09 % |
Visualization |
---|
Powered by ApexCharts |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 42.61% |
Groundwater Sand | Environmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand | 21.74% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 10.43% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 8.70% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 5.22% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 3.48% |
Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 1.74% |
Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 1.74% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.74% |
Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.87% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 0.87% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 0.87% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300002908 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 08_20_2013_1_40cm | Environmental | Open in IMG/M |
3300002911 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_2_20cm | Environmental | Open in IMG/M |
3300005166 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_123 | Environmental | Open in IMG/M |
3300005172 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_132 | Environmental | Open in IMG/M |
3300005177 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_139 | Environmental | Open in IMG/M |
3300005178 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_137 | Environmental | Open in IMG/M |
3300005180 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_134 | Environmental | Open in IMG/M |
3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Environmental | Open in IMG/M |
3300005447 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_138 | Environmental | Open in IMG/M |
3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Environmental | Open in IMG/M |
3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Environmental | Open in IMG/M |
3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Environmental | Open in IMG/M |
3300005558 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_147 | Environmental | Open in IMG/M |
3300006755 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter | Environmental | Open in IMG/M |
3300007255 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1 | Environmental | Open in IMG/M |
3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
3300009799 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N2_0_30 | Environmental | Open in IMG/M |
3300009807 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S3_0_10 | Environmental | Open in IMG/M |
3300009810 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S3_20_30 | Environmental | Open in IMG/M |
3300009811 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N3_20_30 | Environmental | Open in IMG/M |
3300009814 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S2_50_60 | Environmental | Open in IMG/M |
3300009815 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S1_0_10 | Environmental | Open in IMG/M |
3300009816 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N1_0_10 | Environmental | Open in IMG/M |
3300009817 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S3_10_20 | Environmental | Open in IMG/M |
3300009818 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N1_30_40 | Environmental | Open in IMG/M |
3300009821 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S1_20_30 | Environmental | Open in IMG/M |
3300009836 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N1_10_20 | Environmental | Open in IMG/M |
3300009837 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N1_20_30 | Environmental | Open in IMG/M |
3300010333 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_40cm_2_24_1 metaG | Environmental | Open in IMG/M |
3300011271 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaG | Environmental | Open in IMG/M |
3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
3300012199 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaG | Environmental | Open in IMG/M |
3300012200 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaG | Environmental | Open in IMG/M |
3300012201 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_40_16 metaG | Environmental | Open in IMG/M |
3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
3300012204 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_100_16 metaG | Environmental | Open in IMG/M |
3300012206 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaG | Environmental | Open in IMG/M |
3300012209 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaG | Environmental | Open in IMG/M |
3300012211 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaG | Environmental | Open in IMG/M |
3300012285 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_20_16 metaG | Environmental | Open in IMG/M |
3300012349 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Sage2_R_115_16 metaG | Environmental | Open in IMG/M |
3300012350 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_60_16 metaG | Environmental | Open in IMG/M |
3300012351 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_100_16 metaG | Environmental | Open in IMG/M |
3300012353 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_80_16 metaG | Environmental | Open in IMG/M |
3300012360 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_113_16 metaG | Environmental | Open in IMG/M |
3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
3300012362 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG | Environmental | Open in IMG/M |
3300012685 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz1.16 metaG | Environmental | Open in IMG/M |
3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012930 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012977 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_20cm_5_24_1 metaG | Environmental | Open in IMG/M |
3300014150 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_20cm_5_24_1 metaG | Environmental | Open in IMG/M |
3300014154 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09212015 | Environmental | Open in IMG/M |
3300017659 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_40cm_5_24_1 metaG | Environmental | Open in IMG/M |
3300017997 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_100_coex | Environmental | Open in IMG/M |
3300018056 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_100_b1 | Environmental | Open in IMG/M |
3300018431 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_104 | Environmental | Open in IMG/M |
3300018468 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111 | Environmental | Open in IMG/M |
3300020018 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2s2 | Environmental | Open in IMG/M |
3300022534 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_30_b1 | Environmental | Open in IMG/M |
3300022694 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_30_coex | Environmental | Open in IMG/M |
3300026277 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_2_20cm (SPAdes) | Environmental | Open in IMG/M |
3300026332 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_138 (SPAdes) | Environmental | Open in IMG/M |
3300026497 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - CO-08-B | Environmental | Open in IMG/M |
3300027006 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S2_20_30 (SPAdes) | Environmental | Open in IMG/M |
3300027056 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N3_20_30 (SPAdes) | Environmental | Open in IMG/M |
3300027379 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S3_10_20 (SPAdes) | Environmental | Open in IMG/M |
3300027384 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S3_30_40 (SPAdes) | Environmental | Open in IMG/M |
3300027490 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S1_0_10 (SPAdes) | Environmental | Open in IMG/M |
3300027748 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149 (SPAdes) | Environmental | Open in IMG/M |
3300027846 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG (SPAdes) | Environmental | Open in IMG/M |
3300027882 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
3300027952 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N1_0_10 (SPAdes) | Environmental | Open in IMG/M |
3300027957 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N1_10_20 (SPAdes) | Environmental | Open in IMG/M |
3300028878 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_117 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
JGI25382J43887_102312151 | 3300002908 | Grasslands Soil | MKHGHVTGHKRERSSKGSNWWYQTPEAEEIMRKLEAEWEATQQQASK* |
JGI25390J43892_100390582 | 3300002911 | Grasslands Soil | MKRGHVTGTKRERSGKRNNWWYQTEEAQELLRKLDAEWAAKQQQASK* |
Ga0066674_103519442 | 3300005166 | Soil | MKRGHVTGHKTERTGQGWWYQTPEAEALIRKLEAEWQARQQQGQQQ* |
Ga0066683_104024261 | 3300005172 | Soil | MKRGHVTGHKKERSGKGNNWWYQTPEAEAMIRQLEAEWAAKQTTQASK* |
Ga0066690_104717823 | 3300005177 | Soil | MQRGHVTSHKKERSGKGNNWWYQTPEAEAMIQKLAAEWAAKQQQASK* |
Ga0066688_101434312 | 3300005178 | Soil | MKRGHVTGNKKERSGKGNNWWYQTPEAEAMIRKLEAEWQARQSTHASK* |
Ga0066685_105525941 | 3300005180 | Soil | MKRGHVTGHKKERTGKGWWYQTEEVEALIRQLEAEWQARQQPAQQQ* |
Ga0066388_1023073081 | 3300005332 | Tropical Forest Soil | RGHVTGHKHERTGTGWWYQTEEAEALIRQLEAEWQARQQQVSEQ* |
Ga0070708_1004878751 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | MKRGHVTGHKQERPGNGWWYQTEEAEAIVRQLEAEWQARQQPAQQQ* |
Ga0066689_107657992 | 3300005447 | Soil | MKRGHVTGNKKERSGKGNNWWYQTPEAEAMVRQLEAEWQAKQASK* |
Ga0066689_110142562 | 3300005447 | Soil | GHVTGNKKERSGKGNNWWYQTPEAEAMIRQLEAEWAAKQTTQASK* |
Ga0070706_1014574641 | 3300005467 | Corn, Switchgrass And Miscanthus Rhizosphere | MKRGHVTGHKTERTGQGWWYQTPEAEALIRKLEAEWQARQQQAQQQ* |
Ga0070707_1020566892 | 3300005468 | Corn, Switchgrass And Miscanthus Rhizosphere | VTGHKQERTGKSWWYQTEEAEAIIRQLEAEWQVQPQQVNEQ* |
Ga0070698_1002132171 | 3300005471 | Corn, Switchgrass And Miscanthus Rhizosphere | MLQHSIEKQHSMKRGHVTGHKQERTGKSWWYQTEEAEAIIRQLEAEWQVQPQQVNEQ* |
Ga0066698_102245871 | 3300005558 | Soil | MQRGHVTGHKKERSGKGNNWWYQTPEAEAMIQKLAAEWAAKQQQASK* |
Ga0079222_117831092 | 3300006755 | Agricultural Soil | RRTYTMKRGHVTGHKQERSGKGHNWWYQTPEAEEMICQLAVEWQARQEQGK* |
Ga0099791_105677711 | 3300007255 | Vadose Zone Soil | MKRGHVTGHKHERSGKGNNWWYQTPEAEAIIRQLEAEREAKQQQQASK* |
Ga0066710_1000331872 | 3300009012 | Grasslands Soil | MKRGHVTGHKKERTGKGWWYQTEEVEALIRQLEAEWQARQQPAQQQ |
Ga0066710_1000579482 | 3300009012 | Grasslands Soil | MKRGHVTGNKKERSGKGNNWWYQTPEAEAMIRKLEAEWQARQSTHASK |
Ga0066710_1005393413 | 3300009012 | Grasslands Soil | MKRGHVTGNKKERSGKGNNWWYQTPEAEAMIRQLEAEWQAKQASK |
Ga0066710_1027918661 | 3300009012 | Grasslands Soil | MKRGHITGNKKERSGKGNNWWYQTPEAEAMIRQLEAEWAAKQTTQASK |
Ga0099827_100441494 | 3300009090 | Vadose Zone Soil | MKRGHVTSHKHERTGKGSNWWYQTPEAEEIIRKLEAEWEAKQQQGSK* |
Ga0099827_100708631 | 3300009090 | Vadose Zone Soil | SMKRGHVTGHKTERTGQGWWYQTPEAEALIRKLEAEWQARQQQGQQ* |
Ga0099827_104912182 | 3300009090 | Vadose Zone Soil | MKRGHVTGHKHERTGIGRNWWYHTPEAEEIIRKLEAEWEATQQQAST* |
Ga0099827_105673421 | 3300009090 | Vadose Zone Soil | MKRGHVTGHKQERSGKGNNWWYQTPEAEAIIRKLEAEWQAQQQQASK* |
Ga0066709_1004722194 | 3300009137 | Grasslands Soil | MKRGHVTGNKKERSGKGNNWWYQTPEAEAMIRQLEAEWQAKQASK* |
Ga0066709_1007063891 | 3300009137 | Grasslands Soil | MQHGHVTGHKQERSGKGSNWWYQTPEAEAIIRKLEAEWEAKQQQ |
Ga0066709_1016577461 | 3300009137 | Grasslands Soil | MKRGHVTGHKKERSGKGNNWWYQTPEAEAMIRKLEAEWAARQQQQASK* |
Ga0105075_10514061 | 3300009799 | Groundwater Sand | MQHGHVTGHKKERSGKGNNWWYQTPEAEAMIRQMEAEWEAKQQASK* |
Ga0105061_10216792 | 3300009807 | Groundwater Sand | MKRGHVTGTKRERSGKGNNWWYQTEEAQELLRKLDAAWEAKQQQASK* |
Ga0105088_10391811 | 3300009810 | Groundwater Sand | MKRGHVTGTKRERSGKGNNWWYQTEEAQELLRKLDAA |
Ga0105084_10650482 | 3300009811 | Groundwater Sand | MKRGHVTGHKKERSSKNANWWYATEEAQELLRKLDAEWEAKPQQQ |
Ga0105082_10782811 | 3300009814 | Groundwater Sand | MKHGHVTGHKKERTGKGNNWWYQTPEAEAMIRQMEAEWEAKQQQAST* |
Ga0105070_10413492 | 3300009815 | Groundwater Sand | MKRGHVTGHKKERTSKGSNWWYQTPEAEAMIRQMAAEWEAKQQQQDSK* |
Ga0105076_11010122 | 3300009816 | Groundwater Sand | MKRGHVTGHKKERTSKGSNWWYQTPEAEAMIRQMAAEWEAK |
Ga0105062_10275211 | 3300009817 | Groundwater Sand | MKRGHVTGTKRERSGKGNNWWYQTEEAQELLRKLDAEWAAKQQQASK* |
Ga0105072_10298981 | 3300009818 | Groundwater Sand | MKRGHVTGHKKERSSKNANWWYATEEAQEVLRKLDAEWAAKQQQASK* |
Ga0105072_10603471 | 3300009818 | Groundwater Sand | MKRGHVTGTKRERSGKGNNWWYQTEEAQELLRKLDAEWEAKQQQ |
Ga0105064_10394172 | 3300009821 | Groundwater Sand | MQRGHVTGHKKERSGKNANWWYATEEAQELLRKLDAEWEAKQQQASK* |
Ga0105068_10136182 | 3300009836 | Groundwater Sand | MQRGHVTGHKKERSGKGNNWWYQTEEAQELLRKLDAAWEAKQQQASK* |
Ga0105068_10916891 | 3300009836 | Groundwater Sand | MKRGHVTGHKQERSGKGNNWWYQTPEAEAMIRQIEAEWEAKQQASK* |
Ga0105068_11255041 | 3300009836 | Groundwater Sand | MKRGHVTGHKKERTSKGSNWWYQTPEAEAMIRQMAAEWEAKQQQQDSQ* |
Ga0105058_10303001 | 3300009837 | Groundwater Sand | SMKRGHVTGTKRERSGKGNNWWYQTEEAQELLRKLDAEWAAKQQQASK* |
Ga0134080_103724442 | 3300010333 | Grasslands Soil | MKRGHVTGNKKERSGKGNNWWYQTPEAEPIIRQLEAEWEAKQQQQASK* |
Ga0137393_117713521 | 3300011271 | Vadose Zone Soil | MKRGHVTGYKHERTGKGSNWWYQTPEAEEIIRKLEAELEAK* |
Ga0137388_118930692 | 3300012189 | Vadose Zone Soil | MKRGHVTGHKHERTGKGSNWWYQTPEAEEIIRKLEAEWEAKQQQGSK* |
Ga0137383_112778361 | 3300012199 | Vadose Zone Soil | MKRGHVTGHKQERTSKGSNWWYQTPEAEAIIRQLEAEWQARQTTQESK* |
Ga0137382_108315901 | 3300012200 | Vadose Zone Soil | MQRGHVTGHKKERSGKGNNWWYQTPEAEAMIQKLAAEWAAKQQQAS |
Ga0137365_104757152 | 3300012201 | Vadose Zone Soil | MKRGHITGHKQERTGKGNNWWYQTPETEEIIRKLEAEWQARQTTQESK* |
Ga0137365_106234472 | 3300012201 | Vadose Zone Soil | MKRGHVTGHKQERSGKGSNWWYQTPEAEEIIRKLEAEWEAKQQQASK* |
Ga0137365_107061552 | 3300012201 | Vadose Zone Soil | MQHGHVTGNKKERSGKGNNWWYQTPEAEAMIQKLEAEWEVKQQQASK |
Ga0137363_109118962 | 3300012202 | Vadose Zone Soil | MKHGHVTGHKKERSGKNANWWYATEEAQEVLRKLDAEWAAKQQQASK* |
Ga0137374_101251883 | 3300012204 | Vadose Zone Soil | MKRGHITGHKQERTGKGNNWWYQTPEAEEIIRKLEAEWQARQTTQESK* |
Ga0137374_101563232 | 3300012204 | Vadose Zone Soil | MQHGHVTGHKKERSGKGNNWWYQTPEAEAMIRKLEAEWEAKRQQASK* |
Ga0137374_101564872 | 3300012204 | Vadose Zone Soil | MKCGHVTGHKQERSGKGSNWWYQTPEAEAMIRKLEAEWEAKQQQGSK* |
Ga0137374_105690931 | 3300012204 | Vadose Zone Soil | MDTTQKRRYAMKRGHVTGHKQERSGKGNNWWYQTPEAEAMLRQMEAEWEAKQQQEGK* |
Ga0137374_111366611 | 3300012204 | Vadose Zone Soil | MKRGHVTGTKRERSGKGNNWWYQTEEAQELIRKLDAEWEAKQQASK* |
Ga0137380_106514892 | 3300012206 | Vadose Zone Soil | MKRGHVTGHKKERRGKGNNWWYQTPEAEAMIRQLEAEWEAKQQQGSK* |
Ga0137380_111827671 | 3300012206 | Vadose Zone Soil | MKRGHVTGNKKERSGKGNNWWYQTPEAEAMIRQLEAEWQAKQGSCTSS |
Ga0137380_112887271 | 3300012206 | Vadose Zone Soil | KRGHVTGHKHERSGKGHNWWYHTPEAAEIIRQLDVEWEAKQATQASK* |
Ga0137380_113391711 | 3300012206 | Vadose Zone Soil | MKRGHVTGHKQERTGKGNNWWYQTPEAEAMIRQMEAEWEAKQQQASK* |
Ga0137379_112590722 | 3300012209 | Vadose Zone Soil | MKRGHATGHKKERTGKGWWYQTEEVEALIRQLEAEWQARQQPAQQQ* |
Ga0137377_108894191 | 3300012211 | Vadose Zone Soil | MKRGHVTGHKKERTGKRSNWWYHTPEAEEIIYKLEAEWEARQQQANT* |
Ga0137377_113758782 | 3300012211 | Vadose Zone Soil | HDEEHSMKRGHVTGHKKERTGKGWWYQTEEVEALIRQLEAEWQARQTTQESK* |
Ga0137370_108965212 | 3300012285 | Vadose Zone Soil | DKEAPMKRGHVTGHKKERTGKRSNWWYHTPEAEEIIYKLEAEWEARQQQANT* |
Ga0137387_102867363 | 3300012349 | Vadose Zone Soil | MQHGHVTGHKKERSGKGNNWWYQTPEAEAMIRQLEAEWEAKRQQASK* |
Ga0137387_103011871 | 3300012349 | Vadose Zone Soil | MKRRHVTGHKHERSGKGSNWWYQTPEAEVIIRKLEAEWAAKQQASK* |
Ga0137372_103047662 | 3300012350 | Vadose Zone Soil | MQHGHVTGHKKERSGKGNNWWYQTPEAEAKIRQLEAEWEAKRQQASK* |
Ga0137386_110820541 | 3300012351 | Vadose Zone Soil | MKRGHVTGHKKERTGKGWWYQTEEVEALIRQLEAEWQAEQQPAQQQ* |
Ga0137367_108268851 | 3300012353 | Vadose Zone Soil | MKRGHVTGHKKERRGKGNNWWYQTPEAEAMIRQLEAEWAAKQQQQASK* |
Ga0137375_101145254 | 3300012360 | Vadose Zone Soil | MKRGHVTGNKQERSGKGSNWWYQTPEAEAMIRQIEAEWEAKQQQQASK* |
Ga0137375_101401387 | 3300012360 | Vadose Zone Soil | MKRGHVTGTKRERSGKVNNWWYATEEVQELLRKLDAEWEAKQQQASK* |
Ga0137375_102852672 | 3300012360 | Vadose Zone Soil | MKRGHVTGHKQERSGKGSNWWYQTPEAEAMIRKLEAEWEAKQQQGSK* |
Ga0137360_111800272 | 3300012361 | Vadose Zone Soil | MKRGHVTGHKHECSGKGNNWWYQTPEAEAIILKLEVEWEAKQQQASK* |
Ga0137361_103261611 | 3300012362 | Vadose Zone Soil | MKRGHVTGHKQERSGKGNNWWYQTPEAEAIIRKLEAEWDAKQTTQASK* |
Ga0137361_105624512 | 3300012362 | Vadose Zone Soil | MKRGHVTGHKKERSGKNANWWYATEEAQEVLRKLDAEWEAKQQQTRK* |
Ga0137361_110730892 | 3300012362 | Vadose Zone Soil | RRHTMQRGHVTGHKQERTGKGRNWWYHTPEAEEIIRKLEAEWEAKQQQASK* |
Ga0137361_115777062 | 3300012362 | Vadose Zone Soil | MKRGHVTGHKQERTSKGANWWYQTPEAEAMIRQMEAEWEAKQQQAGK* |
Ga0137397_105120712 | 3300012685 | Vadose Zone Soil | MTHTNKEHTMQRGHVTGTKRERSGKGNNWWYQTPEAEAMMRQMEAEWEAKQQASK* |
Ga0137404_100675366 | 3300012929 | Vadose Zone Soil | MTHTKENEMQHGHVTGHKQERSGKNANWWYATEEAQEVLRKLDAEWAAKQQQASK* |
Ga0137404_110609841 | 3300012929 | Vadose Zone Soil | MKRGHVTGHKHERSGKGNNWWYQTPEAEAIIRQLEAEWEAKQQQQASK* |
Ga0137404_112151092 | 3300012929 | Vadose Zone Soil | MTHTKENEMKRGHVTGHKQERTSKGANWWYQTPEAEAMIRQMEAEWEAKQQQQAGK* |
Ga0137407_103386751 | 3300012930 | Vadose Zone Soil | MHHGHVTGHKKERSGNHANWWYATEEAQEVLRKLDAEWAAKQQQASK* |
Ga0137407_106945071 | 3300012930 | Vadose Zone Soil | MKRGHVTGTKRERSGKRNNWWYQTEEAQELLRKLDAEWEAK* |
Ga0137407_114484991 | 3300012930 | Vadose Zone Soil | TMKRGHVTGTKRERSGKGNNWWYQTPEAEAMIRQLEAEWAAKQQQQASK* |
Ga0137407_116127351 | 3300012930 | Vadose Zone Soil | MKRGHVTGHKKERSGKGNNWWYHTAEAEEMIQKLEAEWEAKQQQASK* |
Ga0134087_107938392 | 3300012977 | Grasslands Soil | MKHGHVTGNKKERSGKGNNWWYQTPEAEAMIRQLEAEW |
Ga0134081_103230681 | 3300014150 | Grasslands Soil | MKRGHVTGHKKERSGKGNNWWYQTPEAEAMIRKLEAEWQARQSTHASK* |
Ga0134075_104967422 | 3300014154 | Grasslands Soil | MQRGHVTGHKKERSGKGNNWWYQTPEAEAMIQKLAAEWAAKQQQA |
Ga0134075_105302102 | 3300014154 | Grasslands Soil | RSGKGNNWWYQTPEAEAMIRQLEAEWAAKQTTQASK* |
Ga0134083_105021911 | 3300017659 | Grasslands Soil | MQRGHVTGHKTERTGQGWWYQTPEAEALIRKLEAEWQARQQQGQQQ |
Ga0184610_13177141 | 3300017997 | Groundwater Sediment | MKRGHVTGHKKERSGKGSNWWYQTPEAEAMIRQMEAEWQARQTTQDSK |
Ga0184623_101761511 | 3300018056 | Groundwater Sediment | MKRGHVTGHKQERTSKGSNWWYQTPEAEEIIRKLEAEWQARQTTQDTK |
Ga0066655_106466242 | 3300018431 | Grasslands Soil | MKRGHVTGHKKERSGKGNNWWYQTPEAEAMIQKLAAEWAAKQQQASK |
Ga0066662_111937711 | 3300018468 | Grasslands Soil | MKRGHVTGTKRERSGKRNNWWYQTEEAQELLRKLDAEWAAKQQQASK |
Ga0193721_10608163 | 3300020018 | Soil | MQHGHVTGHKKERSGKGNNWWYHTPEAEEMIQKLEAEWEAKQQQASK |
Ga0224452_10881942 | 3300022534 | Groundwater Sediment | MKRGHVTGHKRERSGKGSNWWYQTPEAEEIMRKLEAEWEAKQQQGSK |
Ga0222623_103023091 | 3300022694 | Groundwater Sediment | KEHTMKRGHVTGHKRERSGKGSNWWYQTPEAEEIMRKLEAEWEAKQQQGSK |
Ga0209350_10793631 | 3300026277 | Grasslands Soil | MQRGHVTGHKKERSGKGNNWWYQTPEAEAMIQKLAAEWAAKQQQASK |
Ga0209803_13504442 | 3300026332 | Soil | KRGHVTGHKKERTGKGWWYQTEEVEALIRQLEAEWQARQSTHASK |
Ga0257164_10603722 | 3300026497 | Soil | MKRGHVTGHKHERTGIGRNWWYHTPEAEEIIRKLETEWEATQQQAST |
Ga0209896_10082653 | 3300027006 | Groundwater Sand | MKRGHVTGTKRERSGKGNNWWYQTEEAQELLRKLDAAWEAKQQQASK |
Ga0209879_10018503 | 3300027056 | Groundwater Sand | MQHGHVTGHKKERSGKGNNWWYQTPEAEAMIRQMEAEWEAKQQASK |
Ga0209842_10428002 | 3300027379 | Groundwater Sand | MKRGHVTGTKRERSGKGNNWWYQTEEAQELLRKLDAEWAAKQQQASK |
Ga0209854_10701882 | 3300027384 | Groundwater Sand | MKRGHVTGHKHERSGKGSNWWYQTPEAEAMIRQMEAEWEAKQQQAST |
Ga0209899_10239911 | 3300027490 | Groundwater Sand | MKHGHVTGHKKERTGKGNNWWYQTPEAEAMIRQMEAEWEAKQQQAST |
Ga0209899_10497892 | 3300027490 | Groundwater Sand | MQRGHVTGHKKERSGKGNNWWYQTEEAQELLRKLDAEWAAKQQQASK |
Ga0209689_10871264 | 3300027748 | Soil | MKRGHVTGTKRERSGKRNNWWYQTEEAQELLRKLDAEWAAKQQQA |
Ga0209180_105757192 | 3300027846 | Vadose Zone Soil | MKRGHVTGHKQERTSKGANWWYQTPEAEAMIRQMEVEWEAKQQQASK |
Ga0209590_100773744 | 3300027882 | Vadose Zone Soil | MKRGHVTSHKHERTGKGSNWWYQTPEAEEIIRKLEAEWEAKQQQGSK |
Ga0209889_10282372 | 3300027952 | Groundwater Sand | MKHGHVTGHKKERSGKNANWWYATEEAQELLRKLDAEWEAKQQQASK |
Ga0209889_10713801 | 3300027952 | Groundwater Sand | MKRGHVTGHKKERTSKGSNWWYQTPEAEAMIRQMAAEWEAKQQQQDSQ |
Ga0209889_11193522 | 3300027952 | Groundwater Sand | MKRGHVTGHKKERSSKNANWWYATEEAQELLRKLDAEWEAKPQQQDSK |
Ga0209857_10080643 | 3300027957 | Groundwater Sand | MQRGHVTGHKKERSGKGNNWWYQTPEAEAMIRQMEAEWEAKQQASK |
Ga0307278_104563981 | 3300028878 | Soil | MKRGHVTGHKKERSGKNANWWYATEEAQELLRKLDAEWEAKQQQAST |
⦗Top⦘ |