NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F080027

Metagenome / Metatranscriptome Family F080027

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F080027
Family Type Metagenome / Metatranscriptome
Number of Sequences 115
Average Sequence Length 44 residues
Representative Sequence EIISAEPRPEIWYGENTEAYLIEINAGGLRNKFATIAVKVGE
Number of Associated Samples 95
Number of Associated Scaffolds 115

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Viruses
% of genes with valid RBS motifs 0.87 %
% of genes near scaffold ends (potentially truncated) 99.13 %
% of genes from short scaffolds (< 2000 bps) 86.96 %
Associated GOLD sequencing projects 90
AlphaFold2 3D model prediction No

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Duplodnaviria (69.565 % of family members)
NCBI Taxonomy ID 2731341
Taxonomy All Organisms → Viruses → Duplodnaviria

Most Common Ecosystem
GOLD Ecosystem Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine
(27.826 % of family members)
Environment Ontology (ENVO) Unclassified
(44.348 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Water (non-saline)
(48.696 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 0.00%    β-sheet: 50.00%    Coil/Unstructured: 50.00%
Feature Viewer
Powered by Feature Viewer

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 115 Family Scaffolds
PF06067DUF932 1.74


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms80.00 %
UnclassifiedrootN/A20.00 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300002408|B570J29032_109245902All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage652Open in IMG/M
3300002408|B570J29032_109316319All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage687Open in IMG/M
3300003430|JGI25921J50272_10024416All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C4031576Open in IMG/M
3300005517|Ga0070374_10255734All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage894Open in IMG/M
3300005517|Ga0070374_10376193All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage715Open in IMG/M
3300005527|Ga0068876_10280192All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage950Open in IMG/M
3300005581|Ga0049081_10099229All Organisms → Viruses → Predicted Viral1086Open in IMG/M
3300005662|Ga0078894_10672017All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage916Open in IMG/M
3300005662|Ga0078894_10968027All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage734Open in IMG/M
3300006484|Ga0070744_10142078All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage690Open in IMG/M
3300006484|Ga0070744_10207696All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage556Open in IMG/M
3300006639|Ga0079301_1125075All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage773Open in IMG/M
3300007547|Ga0102875_1134875All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage779Open in IMG/M
3300007548|Ga0102877_1166483All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage622Open in IMG/M
3300007551|Ga0102881_1156163All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage631Open in IMG/M
3300007551|Ga0102881_1230577All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage512Open in IMG/M
3300007561|Ga0102914_1096570Not Available923Open in IMG/M
3300007562|Ga0102915_1312523All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage507Open in IMG/M
3300007606|Ga0102923_1067247All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1126Open in IMG/M
3300007624|Ga0102878_1039355Not Available1460Open in IMG/M
3300007627|Ga0102869_1211511All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage518Open in IMG/M
3300007629|Ga0102895_1032835Not Available1321Open in IMG/M
3300007632|Ga0102894_1112858All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage717Open in IMG/M
3300007632|Ga0102894_1169378All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage580Open in IMG/M
3300007634|Ga0102901_1101619All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage822Open in IMG/M
3300007692|Ga0102823_1129615All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage669Open in IMG/M
3300008107|Ga0114340_1260920All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage522Open in IMG/M
3300008111|Ga0114344_1047973All Organisms → Viruses → Predicted Viral1652Open in IMG/M
3300008116|Ga0114350_1072323All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage2206Open in IMG/M
3300008116|Ga0114350_1181343All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage540Open in IMG/M
3300008117|Ga0114351_1278943All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage807Open in IMG/M
3300008259|Ga0114841_1176548All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage807Open in IMG/M
3300008261|Ga0114336_1152155All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1024Open in IMG/M
3300008261|Ga0114336_1334529Not Available550Open in IMG/M
3300008262|Ga0114337_1157811All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage975Open in IMG/M
3300008266|Ga0114363_1189581All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage643Open in IMG/M
3300008996|Ga0102831_1008645Not Available3648Open in IMG/M
3300008996|Ga0102831_1104267All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage943Open in IMG/M
3300008996|Ga0102831_1130779All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage834Open in IMG/M
3300008999|Ga0102816_1255385Not Available553Open in IMG/M
3300009050|Ga0102909_1102013All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage696Open in IMG/M
3300009051|Ga0102864_1205051All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage538Open in IMG/M
3300009079|Ga0102814_10217805All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1040Open in IMG/M
3300009079|Ga0102814_10390612All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage757Open in IMG/M
3300009079|Ga0102814_10508935All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage657Open in IMG/M
3300009155|Ga0114968_10699142Not Available531Open in IMG/M
3300009161|Ga0114966_10551440All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage649Open in IMG/M
3300009164|Ga0114975_10050154All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes2460Open in IMG/M
3300009180|Ga0114979_10684631All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage581Open in IMG/M
3300009184|Ga0114976_10457419All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage662Open in IMG/M
3300009419|Ga0114982_1082475All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage998Open in IMG/M
3300010309|Ga0102890_1006786All Organisms → Viruses → Predicted Viral2329Open in IMG/M
3300010374|Ga0114986_1044331Not Available810Open in IMG/M
3300010885|Ga0133913_12152923All Organisms → Viruses → Predicted Viral1378Open in IMG/M
3300011010|Ga0139557_1018495Not Available1291Open in IMG/M
3300012716|Ga0157605_1141404All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage992Open in IMG/M
3300017766|Ga0181343_1195336Not Available555Open in IMG/M
3300020048|Ga0207193_1600715All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage731Open in IMG/M
3300020205|Ga0211731_11255587All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C4033431Open in IMG/M
3300020498|Ga0208050_1001141All Organisms → Viruses → Predicted Viral3807Open in IMG/M
3300020519|Ga0208223_1027676All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage739Open in IMG/M
3300020552|Ga0207940_1029357Not Available847Open in IMG/M
3300020559|Ga0208083_1038449All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage821Open in IMG/M
3300020572|Ga0207909_1030483All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage916Open in IMG/M
3300021141|Ga0214163_1066373All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage895Open in IMG/M
3300024343|Ga0244777_10067177Not Available2301Open in IMG/M
3300024343|Ga0244777_10690188All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage612Open in IMG/M
3300024346|Ga0244775_10528824All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage961Open in IMG/M
3300024346|Ga0244775_11348219All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage550Open in IMG/M
3300024483|Ga0255224_1084125All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage663Open in IMG/M
3300027130|Ga0255089_1025175All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1032Open in IMG/M
3300027139|Ga0255082_1027792All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage923Open in IMG/M
3300027141|Ga0255076_1027850All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1027Open in IMG/M
3300027142|Ga0255065_1072870All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage593Open in IMG/M
3300027148|Ga0255115_1095238All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage506Open in IMG/M
3300027153|Ga0255083_1001613Not Available5658Open in IMG/M
3300027222|Ga0208024_1036002Not Available961Open in IMG/M
3300027232|Ga0208803_1079057All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage581Open in IMG/M
3300027240|Ga0208444_1011435All Organisms → Viruses → Predicted Viral1317Open in IMG/M
3300027260|Ga0208027_1079149All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage637Open in IMG/M
3300027281|Ga0208440_1114869Not Available526Open in IMG/M
3300027320|Ga0208923_1064530All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage649Open in IMG/M
3300027538|Ga0255085_1029054All Organisms → Viruses → Predicted Viral1262Open in IMG/M
3300027600|Ga0255117_1031448Not Available1142Open in IMG/M
3300027659|Ga0208975_1195795All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage542Open in IMG/M
3300027782|Ga0209500_10210427Not Available872Open in IMG/M
3300027793|Ga0209972_10022355All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes3829Open in IMG/M
3300027793|Ga0209972_10385058All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage599Open in IMG/M
3300027797|Ga0209107_10497863Not Available541Open in IMG/M
3300027797|Ga0209107_10533025Not Available517Open in IMG/M
3300027804|Ga0209358_10044385All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes2657Open in IMG/M
3300027892|Ga0209550_10154524All Organisms → Viruses → Predicted Viral1629Open in IMG/M
3300027892|Ga0209550_10571344Not Available668Open in IMG/M
3300027892|Ga0209550_10593771All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage651Open in IMG/M
3300027963|Ga0209400_1005322Not Available8870Open in IMG/M
3300029697|Ga0256301_1023250All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1039Open in IMG/M
3300031758|Ga0315907_10520539All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage937Open in IMG/M
3300031857|Ga0315909_10449405All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage906Open in IMG/M
3300032050|Ga0315906_10582781All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage925Open in IMG/M
3300032093|Ga0315902_10110225All Organisms → Viruses → Predicted Viral2959Open in IMG/M
3300032116|Ga0315903_10607446All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage838Open in IMG/M
3300033996|Ga0334979_0528025Not Available635Open in IMG/M
3300034012|Ga0334986_0156076All Organisms → Viruses → Predicted Viral1312Open in IMG/M
3300034018|Ga0334985_0729229All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage532Open in IMG/M
3300034066|Ga0335019_0292585All Organisms → Viruses → Predicted Viral1024Open in IMG/M
3300034092|Ga0335010_0056358All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes2795Open in IMG/M
3300034108|Ga0335050_0034908All Organisms → Viruses → Predicted Viral3230Open in IMG/M
3300034116|Ga0335068_0282960All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage832Open in IMG/M
3300034117|Ga0335033_0600181All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage513Open in IMG/M
3300034272|Ga0335049_0231686All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1280Open in IMG/M
3300034272|Ga0335049_0728347All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage596Open in IMG/M
3300034280|Ga0334997_0134373Not Available1650Open in IMG/M
3300034355|Ga0335039_0033278All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C4033164Open in IMG/M
3300034356|Ga0335048_0299512All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage835Open in IMG/M
3300034356|Ga0335048_0538997All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage551Open in IMG/M


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
EstuarineEnvironmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine27.83%
FreshwaterEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater13.04%
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake11.30%
Freshwater, PlanktonEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton8.70%
FreshwaterEnvironmental → Aquatic → Freshwater → River → Unclassified → Freshwater8.70%
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake6.96%
FreshwaterEnvironmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater5.22%
FreshwaterEnvironmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater4.35%
EstuarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine3.48%
Deep SubsurfaceEnvironmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface2.61%
FreshwaterEnvironmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater1.74%
Freshwater LenticEnvironmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lentic1.74%
Freshwater And SedimentEnvironmental → Aquatic → Freshwater → Lentic → Hypolimnion → Freshwater And Sediment1.74%
FreshwaterEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater0.87%
Freshwater Lake SedimentEnvironmental → Aquatic → Freshwater → Lake → Sediment → Freshwater Lake Sediment0.87%
FreshwaterEnvironmental → Aquatic → Freshwater → Ice → Unclassified → Freshwater0.87%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300002408Freshwater microbial communities from Lake Mendota, WI, sample - 15JUL2010 deep hole epilimnion (Lake Mendota Combined assembly, ASSEMBLY_DATE=20140123)EnvironmentalOpen in IMG/M
3300003430Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.SDEnvironmentalOpen in IMG/M
3300005517Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.SN (version 4)EnvironmentalOpen in IMG/M
3300005527Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel5S_2200h metaGEnvironmentalOpen in IMG/M
3300005581Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER78MSRFEnvironmentalOpen in IMG/M
3300005662Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.SD (version 4)EnvironmentalOpen in IMG/M
3300006484Estuarine microbial communities from the Columbia River estuary, USA - metaG S.535EnvironmentalOpen in IMG/M
3300006639Deep subsurface shale carbon reservoir microbial communities from Ohio, USA - Utica-2 Time Series FC 2014_7_11EnvironmentalOpen in IMG/M
3300007547Estuarine microbial communities from the Columbia River estuary - metaG 1547B-02EnvironmentalOpen in IMG/M
3300007548Estuarine microbial communities from the Columbia River estuary - metaG 1548B-3EnvironmentalOpen in IMG/M
3300007551Estuarine microbial communities from the Columbia River estuary - metaG 1549B-3EnvironmentalOpen in IMG/M
3300007561Estuarine microbial communities from the Columbia River estuary - metaG 1561A-3EnvironmentalOpen in IMG/M
3300007562Estuarine microbial communities from the Columbia River estuary - metaG 1561A-02EnvironmentalOpen in IMG/M
3300007606Estuarine microbial communities from the Columbia River estuary - metaG 1569-02EnvironmentalOpen in IMG/M
3300007624Estuarine microbial communities from the Columbia River estuary - metaG 1548A-02EnvironmentalOpen in IMG/M
3300007627Estuarine microbial communities from the Columbia River estuary - metaG 1546A-02EnvironmentalOpen in IMG/M
3300007629Estuarine microbial communities from the Columbia River estuary - metaG 1554B-3EnvironmentalOpen in IMG/M
3300007632Estuarine microbial communities from the Columbia River estuary - metaG 1554A-3EnvironmentalOpen in IMG/M
3300007634Estuarine microbial communities from the Columbia River estuary - metaG 1555A-02EnvironmentalOpen in IMG/M
3300007692Estuarine microbial communities from the Columbia River estuary - Ebb tide non-ETM metaG S.743EnvironmentalOpen in IMG/M
3300008107Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0046-3-NAEnvironmentalOpen in IMG/M
3300008111Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE4, Sample E2014-0050-C-NAEnvironmentalOpen in IMG/M
3300008116Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0106-3-NAEnvironmentalOpen in IMG/M
3300008117Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0108-C-NAEnvironmentalOpen in IMG/M
3300008259Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, sample HABS-E2014-0132-C-NAEnvironmentalOpen in IMG/M
3300008261Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, sample HABS-E2014-0024-C-NAEnvironmentalOpen in IMG/M
3300008262Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0046-C-NAEnvironmentalOpen in IMG/M
3300008266Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample HABS-E2014-0108-C-NAEnvironmentalOpen in IMG/M
3300008996Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.747EnvironmentalOpen in IMG/M
3300008999Estuarine microbial communities from the Columbia River estuary - Flood tide non-ETM metaG S.545EnvironmentalOpen in IMG/M
3300009050Estuarine microbial communities from the Columbia River estuary - metaG 1557A-02EnvironmentalOpen in IMG/M
3300009051Estuarine microbial communities from the Columbia River estuary - metaG 1449B-02EnvironmentalOpen in IMG/M
3300009079Estuarine microbial communities from the Columbia River estuary - Flood tide ETM metaG S.741EnvironmentalOpen in IMG/M
3300009155Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_EF_MetaGEnvironmentalOpen in IMG/M
3300009161Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130207_XF_MetaGEnvironmentalOpen in IMG/M
3300009164Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130626_EF_MetaGEnvironmentalOpen in IMG/M
3300009180Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140625_EF_MetaGEnvironmentalOpen in IMG/M
3300009184Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_EF_MetaGEnvironmentalOpen in IMG/M
3300009419Subsurface microbial communities from deep shales in Ohio, USA - Utica-3 well 1 S input2 FTEnvironmentalOpen in IMG/M
3300010309Estuarine microbial communities from the Columbia River estuary - metaG 1552A-3EnvironmentalOpen in IMG/M
3300010374Subsurface microbial communities from deep shales in Ohio, USA - Utica-3 well 1 S-1-Day17EnvironmentalOpen in IMG/M
3300010885northern Canada Lakes Co-assemblyEnvironmentalOpen in IMG/M
3300011010Freshwater microbial communities from Western Basin Lake Erie, Ontario, Canada - Station 970 - Surface IceEnvironmentalOpen in IMG/M
3300012716Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES130 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300017766Freshwater viral communities from Lake Michigan, USA - Su13.VD.MLB.S.DEnvironmentalOpen in IMG/M
3300020048Microbial communities from Manganika and McQuade lakes, Minnesota, USA Combined Assembly of Gp0225457, Gp0225456, Gp0225455, Gp0225454, Gp0225453, Gp0224915EnvironmentalOpen in IMG/M
3300020205Freshwater lake microbial communities from Lake Erken, Sweden - P4710_103 megahit1EnvironmentalOpen in IMG/M
3300020498Freshwater microbial communities from Lake Mendota, WI - 13JUN2010 deep hole epilimnion (SPAdes)EnvironmentalOpen in IMG/M
3300020519Freshwater microbial communities from Lake Mendota, WI - 07OCT2009 deep hole epilimnion ns (SPAdes)EnvironmentalOpen in IMG/M
3300020552Freshwater microbial communities from Lake Mendota, WI - 06JUL2012 deep hole epilimnion (SPAdes)EnvironmentalOpen in IMG/M
3300020559Freshwater microbial communities from Lake Mendota, WI - 07JUL2009 deep hole epilimnion (SPAdes)EnvironmentalOpen in IMG/M
3300020572Freshwater microbial communities from Lake Mendota, WI - 05MAY2010 deep hole epilimnion (SPAdes)EnvironmentalOpen in IMG/M
3300021141Freshwater microbial communities from Lake Mendota, WI - Practice 15JUN2010 epilimnionEnvironmentalOpen in IMG/M
3300024343Combined assembly of estuarine microbial communities from Columbia River, Washington, USA >3um size fractionEnvironmentalOpen in IMG/M
3300024346Whole water sample coassemblyEnvironmentalOpen in IMG/M
3300024483Metatranscriptome of freshwater microbial communities from Columbia River, Oregon, United States - Colum_Cont_RepB_8h (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300027130Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Miss_RepC_8dEnvironmentalOpen in IMG/M
3300027139Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Colum_RepB_8hEnvironmentalOpen in IMG/M
3300027141Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Law_RepB_8hEnvironmentalOpen in IMG/M
3300027142Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Cont_RepC_0hEnvironmentalOpen in IMG/M
3300027148Freshwater microbial communities from St. Lawrence River, New York, United States - Law_Law_RepB_8hEnvironmentalOpen in IMG/M
3300027153Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Colum_RepC_8hEnvironmentalOpen in IMG/M
3300027222Estuarine microbial communities from the Columbia River estuary - metaG 1546B-02 (SPAdes)EnvironmentalOpen in IMG/M
3300027232Estuarine microbial communities from the Columbia River estuary - metaG 1551A-02 (SPAdes)EnvironmentalOpen in IMG/M
3300027240Estuarine microbial communities from the Columbia River estuary - metaG 1555A-3 (SPAdes)EnvironmentalOpen in IMG/M
3300027260Estuarine microbial communities from the Columbia River estuary - metaG 1563A-02 (SPAdes)EnvironmentalOpen in IMG/M
3300027281Estuarine microbial communities from the Columbia River estuary - metaG 1547B-02 (SPAdes)EnvironmentalOpen in IMG/M
3300027320Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.575 (SPAdes)EnvironmentalOpen in IMG/M
3300027538Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Cont_RepB_8dEnvironmentalOpen in IMG/M
3300027600Freshwater microbial communities from St. Lawrence River, New York, United States - Law_Atlam_RepA_8hEnvironmentalOpen in IMG/M
3300027659Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER78MSRF (SPAdes)EnvironmentalOpen in IMG/M
3300027782Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140212_EF_MetaG (SPAdes)EnvironmentalOpen in IMG/M
3300027793Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel1S_2200h metaG (SPAdes)EnvironmentalOpen in IMG/M
3300027797Freshwater microbial communities from dead zone in Lake Erie, Canada - CCB hypolimnion July 2011 (SPAdes)EnvironmentalOpen in IMG/M
3300027804Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MLB.SN (SPAdes)EnvironmentalOpen in IMG/M
3300027892Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.SN (SPAdes)EnvironmentalOpen in IMG/M
3300027963Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_EF_MetaG (SPAdes)EnvironmentalOpen in IMG/M
3300029697Metatranscriptome of freshwater microbial communities from Columbia River, Oregon, United States - Colum_Law_RepC_8h (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031758Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA123EnvironmentalOpen in IMG/M
3300031857Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA125EnvironmentalOpen in IMG/M
3300032050Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA122EnvironmentalOpen in IMG/M
3300032093Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA117EnvironmentalOpen in IMG/M
3300032116Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA119EnvironmentalOpen in IMG/M
3300033996Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME20Jul2016-rr0004EnvironmentalOpen in IMG/M
3300034012Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME18Aug2017-rr0027EnvironmentalOpen in IMG/M
3300034018Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME04Jul2014-rr0021EnvironmentalOpen in IMG/M
3300034066Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME11Jul2017-rr0087EnvironmentalOpen in IMG/M
3300034092Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME03Aug2012-rr0069EnvironmentalOpen in IMG/M
3300034108Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME24Jun2014-rr0157EnvironmentalOpen in IMG/M
3300034116Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-CONTROL-GENDONOREnvironmentalOpen in IMG/M
3300034117Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME18Jun2014-rr0124EnvironmentalOpen in IMG/M
3300034272Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME18Jul2017-rr0156EnvironmentalOpen in IMG/M
3300034280Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME10Aug2009-rr0048EnvironmentalOpen in IMG/M
3300034355Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME18Oct2015-rr0135EnvironmentalOpen in IMG/M
3300034356Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME17Jun2014-rr0152EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
B570J29032_10924590213300002408FreshwaterRSRNRHFAGEIVSAKPRPEIWYGDKTEAFLIEIRTGGLRNKFATIAVKVGE*
B570J29032_10931631943300002408FreshwaterYRSRNRHFAGEIVSAKPRPEIWYGDKTEAFLIEIRTGGLRNKFATVAVKVGE*
JGI25921J50272_1002441613300003430Freshwater LakeSAKPRPEIWYGDKTEAFLIEIRTGGLRNKFATIAVKVGE*
Ga0070374_1025573463300005517Freshwater LakeKPRPEIWYGDKTEAFLIEIRTGGLRNKFATVAVKVGE*
Ga0070374_1037619313300005517Freshwater LakeRPEIWYGEKTEAYLIEINTRSLRNKFATVAVKVGE*
Ga0068876_1028019213300005527Freshwater LakeSAEHRPEIYYGEKTEAYLIEVRAGGLRNKFATIAVKVGE*
Ga0049081_1009922913300005581Freshwater LenticARPRPEIWYGDKTEAYLIGINYRGSIKTQYATIAVKVGE*
Ga0078894_1067201763300005662Freshwater LakeRHFSGEIVSAEPRPEIWYGENTEAFLIEVNAGGLRNKFATIAVKVGE*
Ga0078894_1096802753300005662Freshwater LakePEIYYGEKTEAFLIEVRTGGLRNKFATIAVKVGE*
Ga0070744_1014207813300006484EstuarineIISATPRPAIWYGENTEAYVVEVYDRTLRNKFATVAVKVGE*
Ga0070744_1020769613300006484EstuarineIINATPRPEIWYGEKTEAYLIEINTRSLRNKFATVAVKVGE*
Ga0079301_112507543300006639Deep SubsurfaceYRSRNRHFSGEIVSAEHRPEIWYGEKTEAYLIEINAGGLRNKFATIAVKVGE*
Ga0102875_113487513300007547EstuarinePRPEIWYGDKTEAYLIGINYRGSIKTQYATIAVKVGE*
Ga0102877_116648333300007548EstuarineEPRPEIWYGEKTEAYLIGINYKGSIKTQYATIAVKVGE*
Ga0102881_115616313300007551EstuarineATPRPEIWYGEKTEAYLIEINTRSLRNKFATVAVKVGE*
Ga0102881_123057713300007551EstuarineYRSNSRHFEGEIINATPRPEIWYGEKTEAYLIEIDTRSFRNKFATIAVKVGE*
Ga0102914_109657043300007561EstuarinePRPAIWYGENTEAYVVEVYDRTLRNKFATVAIRVGE*
Ga0102915_131252313300007562EstuarineATPRPEIWYGEKTEAYLIEINTRSLRNKFATIAVKVGE*
Ga0102923_106724713300007606EstuarineNRHFSGEIVSAKPRPEIWYGDKTEAFLIEVRAGGLRNKFATVAVKVGE*
Ga0102878_103935513300007624EstuarineGEIVSAEHRPEIYYGEKTEAYLIEVRAGGLQNKFATIAVKVGE*
Ga0102869_121151113300007627EstuarineNYRSNSRHFSGEIISAEHRPEIWYGEKTEAYLIEINAGGLRNKFATIAVKLGE*
Ga0102895_103283513300007629EstuarineRPEIWYGEKTEAYLIEINAGGLRNKFATIAVKVGE*
Ga0102894_111285813300007632EstuarineAIWYGENTEAYLIGINYKGSIKTQYATIAVKVGE*
Ga0102894_116937813300007632EstuarineKNYRSRNRHFEGEIISATPRPAIWYGENTEAYVVEVYDRTLRNKFATVAVKVGE*
Ga0102901_110161913300007634EstuarineTYRSNSRHFEGEIISAEPRPAIWYGENTEAYLIGINYKGSIKTQYATIAVKVGE*
Ga0102823_112961533300007692EstuarineRSNSRHFSGEIVSAEHRPEIWYGEKTEAYLIEIRAGGLRNKFATIAVKVGE*
Ga0114340_126092033300008107Freshwater, PlanktonFSGEIVSAEPRPEIWYGENTEAFLIEVNAGGLRNKFATIAVKVGE*
Ga0114344_104797383300008111Freshwater, PlanktonGEIISAEHRPAIWYGENTEAYLIEVRTGGLRNKFATIAVKVGE*
Ga0114350_107232333300008116Freshwater, PlanktonMATKIISAEHRPAIWYGENTEAYLIEVRTGGLRNKFATIAVKVGE*
Ga0114350_118134313300008116Freshwater, PlanktonGEIISAEPRPAIWYGENTEAYLIEVRTGGLRNKFATIAVKVGE*
Ga0114351_127894343300008117Freshwater, PlanktonTNRHFSGEIISAEPRPAIWYGENTEAYLIEVNAGGLRNKFATIAVKVGE*
Ga0114841_117654853300008259Freshwater, PlanktonNRHFSGEIVSAEPRPEIWYGENTEAFLIEVNAGGLRNKFATIAVKVGE*
Ga0114336_115215553300008261Freshwater, PlanktonEIVSAKPRPEIWYGDKTEAFLIEIRTGGLRNKFATIAVKVGE*
Ga0114336_133452913300008261Freshwater, PlanktonAEKREGIWYGENTEAYLSEVNAKGLRNKFATIAVKVGE*
Ga0114337_115781113300008262Freshwater, PlanktonHFSGEIVSAEHRPEIWDGEKTEAYLIEINAGGLRNKFATIAVKVGE*
Ga0114363_118958123300008266Freshwater, PlanktonAEPRPAIWYGENTEAYLIEVRTGGLRNKFATIAVKVGE*
Ga0102831_1008645113300008996EstuarineEGEIISAEPRPEIWYGEKTEAYLIGINYKGSIKTQYATIAVKVGE*
Ga0102831_110426713300008996EstuarineNYNSRNRHFEGEIVSARPRPEIWYGDKTEAYLIEINTRSLRNKFATVAVKVGE*
Ga0102831_113077913300008996EstuarineNYRSNSRHFSGEIVSAKPRPAIWYGDKTEAFLIEVRTGGLRNKFATIAVKVGE*
Ga0102816_125538543300008999EstuarineRPEIWYGEKTEAYLIEINTRSLRNKFATIAVKVGE*
Ga0102909_110201343300009050EstuarineRSNSRHFSGEIVSAEPRPAIWYGEKTEAFLIEIRTGGLRNKFATIAVKVGE*
Ga0102864_120505113300009051EstuarineSRHFEGEIISAEPRPAIWYGENTEAYLIGINYKGSIKTQYATIAVKVGE*
Ga0102814_1021780513300009079EstuarinePRPEIWYGEKTEAYLIEINTRSLRNKFATIAVKVGE*
Ga0102814_1039061213300009079EstuarineYNRHFSGEIVSAEPRPAIWYGEKTEAYLIEVRTGGLRNKFATIAVKVGE*
Ga0102814_1050893533300009079EstuarineRHFSGEIVSAEPRPAIWYGENTEAYLIGINYKGSIKTQYATIAVKVGE*
Ga0114968_1069914233300009155Freshwater LakePEIWYGEKTEAYLIEINTRSLRNKFATVAVKVGE*
Ga0114966_1055144043300009161Freshwater LakeSRHFEGEIINATPRPEIWYGEKTEAYLIEINTRSLRNKFATVAVKVGE*
Ga0114975_1005015413300009164Freshwater LakeFEGEIISATPRPAIWYGENTEAYVVEVYDRTLRNKFATVAVKVGE*
Ga0114979_1068463113300009180Freshwater LakeKNYRSNSRHFSGEIISAKARPEIWYGDKTEAYLIEINAGGLRNKFATIAVKVGE*
Ga0114976_1045741943300009184Freshwater LakeRNRHFEGEIISATPRPAIWYGENTEAYVVEVYDRTLRNKFATVAVKVGE*
Ga0114982_108247513300009419Deep SubsurfaceRPEIWYGENTEAYLIEINAGGLRNKFATIAVKVGE*
Ga0102890_100678613300010309EstuarineEIVSAEHRPEIYYGEKTEAYLIEVRAGGLQNKFATIAVKVGE*
Ga0114986_104433133300010374Deep SubsurfaceFQGEIIHAEPRPAIWYGENTEAYLVQVRVPHSLHDKYATIAVKVGE*
Ga0133913_1215292353300010885Freshwater LakeGEIISAKARPEIWYGDKTEAYLIEINAGGLRNKFATIAVKVGE*
Ga0139557_101849513300011010FreshwaterPRPAIWYGENTEAYVIEVYDRTLRNKFATVAIRVGE*
Ga0157605_114140413300012716FreshwaterRSRNRHFAGEIVSAKPRPEIWYGDKTEAFLIEIRTGGLRNKFATVAVKVGE*
Ga0181343_119533633300017766Freshwater LakeFSGEIVSAEHRPEIYYGEKTEAYLIEVNAGGLRNKFATIAVKVGE
Ga0207193_160071543300020048Freshwater Lake SedimentSGEIVSAKPRPAIWYGDKTEAFLIEVRTGGLRNKFATIAVKVGE
Ga0211731_11255587113300020205FreshwaterNSRHFEGEIVSATPRPEIWYGENTEAYLIEVNARGLRNKYATIAVKVGE
Ga0208050_1001141133300020498FreshwaterNSRHFSGEIVSAEHRPEIYYGEKTEAYLIEVRAGGLRNKFATIAVKVGE
Ga0208223_102767623300020519FreshwaterQNYRSRNRHFAGEIVSAKPRPEIWYGDKTEAFLIEIRTGGLRNKFATIAVKVGE
Ga0207940_102935753300020552FreshwaterGEIISAEPRPEIWYGENTEAYLIGIDYRGSIKTQYATVAVKVGE
Ga0208083_103844913300020559FreshwaterFAGEIVSAKPRPEIWYGDKTEAFLIEIRTGGLRNKFATVAVKVGE
Ga0207909_103048313300020572FreshwaterNYRSRNRHFAGEIVSAKPRPEIWYGDKTEAFLIEIRTGGLRNKFATIAVKVGE
Ga0214163_106637313300021141FreshwaterFAGEIVSAKPRPEIWYGDKTEAFLIEIRTGGLRNKFATIAVKVGE
Ga0244777_1006717713300024343EstuarineHFSGEIVSAEPRPSIWYGDKTEAYTIEVRTGGLRNKFATIAVKVGE
Ga0244777_1069018813300024343EstuarineNSRHFEGEIINATPRPEIWYGEKTEAYLIEINTRSLRNKFATVAVKVGE
Ga0244775_1052882443300024346EstuarineKPRPAIWYGDKTEAFLIEVRTGGLRNKFATIAVKVGE
Ga0244775_1134821933300024346EstuarineIINATPRPEIWYGEKTEAYLIEINTRSLRNKFATVAVKVGE
Ga0255224_108412513300024483FreshwaterYRSNSRHFSGEIVSAEHRPEIWYGEKTEAYLIEIRAGGLRNKFATIAVKVGE
Ga0255089_102517553300027130FreshwaterYRSTNRHFSGEIVSAEPRPAIWYGENTEAYVIEIRTGGLRNKFATIAVKTSD
Ga0255082_102779213300027139FreshwaterVSAEPRPAIWYGENTEAYVIEIRTGGLRNKFATIAVKTSD
Ga0255076_102785013300027141FreshwaterSAEPRPAIWYGENTEAYVIEIRTGGLRNKFATIAVKTSD
Ga0255065_107287043300027142FreshwaterTYRSTNRHFSGEIISAEHRPSIWYGENTEAYLIEIRTGGLRNKFATIAVKVGE
Ga0255115_109523833300027148FreshwaterAEHRPEIWYGEKTEAYLIEINAGGLRNKFATIAVKVGE
Ga0255083_1001613163300027153FreshwaterNRHFSGEIVSAKPRPEIWYGDKTEAFLIEVRAGGLRNKFATVAVKVGE
Ga0208024_103600213300027222EstuarineEHRPEIYYGEKTEAYLIEVRAGGLQNKFATIAVKVGE
Ga0208803_107905743300027232EstuarineRHFSGEIVSAEPRPAIWYGEKTEAFLIEIRTGGLRNKFATIAVKVGE
Ga0208444_101143513300027240EstuarineSRNRHFEGEIVSARPRPEIWYGDKTEAYLIGINYRGSIKTQYATIAVKVGE
Ga0208027_107914913300027260EstuarineHFEGEIVSARPRPEIWYGDKTEAYLIGIDYRGSIKTQYATVAVKVGE
Ga0208440_111486913300027281EstuarineNYRSNSRHFSGEIVSAEHRPEIYYGEKTEAYLIEVRAGGLQNKFATIAVKVGE
Ga0208923_106453043300027320EstuarineRPEIWYGEKTEAYLIEIRAGGLRNKFATIAVKVGE
Ga0255085_102905463300027538FreshwaterFEGEIISATPRPEIWYGEKTEAYLIEINTRSLRNKFATIAVKVGE
Ga0255117_103144813300027600FreshwaterYRSRNRHFEGEIVSAEKREGIWYGENTEAYLIEVNTRGLRNKFATIAVKVGE
Ga0208975_119579513300027659Freshwater LenticKNYRSNSRHFSGEIVSAEHRPEIWYGEKTEAYLIEINAGGFRNKFATIAVKVGE
Ga0209500_1021042713300027782Freshwater LakeATPRPAIWYGENTEAYVVEVYDRTLRNKFATVAVKVGE
Ga0209972_1002235513300027793Freshwater LakeYRSNSRHFSGEIVSAEPRPEIYYGEKTEAYLIEIRTGGLRNKFATIAVKVGE
Ga0209972_1038505813300027793Freshwater LakeNYRSNSRHFSGEIISAEPRPEIWYGENTEAYLIEINAGGLRNKFATIAVKVGE
Ga0209107_1049786343300027797Freshwater And SedimentRPEIWYGEKTEAYLIEINAGGLRNKFATIAVKVGE
Ga0209107_1053302513300027797Freshwater And SedimentEIISASPRPAIWYGENTEAYVIEIYDRTLRSKFATVAVKVGE
Ga0209358_1004438593300027804Freshwater LakeNRHFAGEIVSAKPRPEIWYGDKTEAFLIEIRTGGLRNKFATVAVKVGE
Ga0209550_1015452463300027892Freshwater LakeYRSRNRHFEGEIVSAEKREGIWYGENTEAYLIEVNAKGLRNKFATIAVKVGE
Ga0209550_1057134413300027892Freshwater LakeARPEIYYGEKTEAYLIEINAGGLRNKFATIAVKVGE
Ga0209550_1059377133300027892Freshwater LakeVSAKPRPEIWYGDKTEAFLIEIRTGGLRNKFATVAVKVGE
Ga0209400_1005322263300027963Freshwater LakeNSRHFEGEIISATPRPEIWYGEKTEAYLIEINTRSLRNKFATIAVKVGE
Ga0256301_102325073300029697FreshwaterEIISAEPRPEIWYGEKTEAYLIGIYYRGSLKTQYATIAVKVGE
Ga0315907_1052053943300031758FreshwaterIVSAKSRPAIWYGENTEAYLIEVRTGGLRNKFATVAVKVGE
Ga0315909_1044940513300031857FreshwaterSAEPRPEIWYGENTEAYLIEINAGGLRNKFATIAVKVGE
Ga0315906_1058278153300032050FreshwaterSAEHRPEIYYGEKTEAYLIEVRAGGLRNKFATIAVKVGE
Ga0315902_1011022513300032093FreshwaterGEIISAEHRPAIWYGENTEAYLIEVRTGGLRNKFATIAVKVGE
Ga0315903_1060744653300032116FreshwaterHFSGEIISAEPRPEIWYGENTEAYLIEINAGGLRNKFATIAVKVGE
Ga0334979_0528025_2_1423300033996FreshwaterHFSGEIVSAEHRPEIYYGEKTEAYLIEVRAGGLRNKFATIAVKVGE
Ga0334986_0156076_3_1163300034012FreshwaterEHRPEIYYGEKTEAYLIEVRAGGLRNKFATIAVKVGE
Ga0334985_0729229_3_1553300034018FreshwaterSNTRHFSGEIISAEARPEIWYGENTEAYLIEINAGGLRNKFATIAVKVGE
Ga0335019_0292585_3_1403300034066FreshwaterFSGEIISAEHRPEIWYGENTEAYLIEINAGGLRNKFATIAVKTSD
Ga0335010_0056358_2652_27953300034092FreshwaterRHFEGEIVSAQKREGIWYGENTEAYLIEVNAKGLRNKFATIAVKVGE
Ga0335050_0034908_3_1193300034108FreshwaterAEHRPEIWYGENTEAYLIEINAGGLRNKFATVAVKVGE
Ga0335068_0282960_2_1273300034116FreshwaterIVSAEHRPEIYYGEKTEAYLIEVRAGGLRNKFATIAVKVGE
Ga0335033_0600181_1_1383300034117FreshwaterFEGEIISATPRPAIWYGENTEAYVVEVYDRTLRNKFATVAVKIGE
Ga0335049_0231686_1_1503300034272FreshwaterNRHFEGEIVSARPRPEIWYGDKTEAYLIGINYRGSIKTQYATIAVKVGE
Ga0335049_0728347_461_5953300034272FreshwaterSGEIISAEHRPEIWYGENTEAYLIEINAGGLRNKFATIAVKTSD
Ga0334997_0134373_1533_16493300034280FreshwaterAEPRPEIWYGENTEAYLIEINAGGLRNKFATIAVKTSD
Ga0335039_0033278_3036_31643300034355FreshwaterEIISAEPRPEIWYGENTEAYLIEINAGGLRNKFATIAVKVGE
Ga0335048_0299512_699_8333300034356FreshwaterSGEIISAEPRPEIYYGEKTEAYLIEVRAGGLRNKFATIAVKVGE
Ga0335048_0538997_3_1223300034356FreshwaterAEPRPEIYYGDNTEAYLIGFNYKGSIKTQYATVAVKVGE

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.