NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F080084

Metagenome / Metatranscriptome Family F080084

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F080084
Family Type Metagenome / Metatranscriptome
Number of Sequences 115
Average Sequence Length 49 residues
Representative Sequence DEWKDPAPEGEEPYKSVRQDLIPVLVKAIQEQQAIITQLTARITALEGA
Number of Associated Samples 99
Number of Associated Scaffolds 115

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Viruses
% of genes with valid RBS motifs 0.88 %
% of genes near scaffold ends (potentially truncated) 94.78 %
% of genes from short scaffolds (< 2000 bps) 85.22 %
Associated GOLD sequencing projects 93
AlphaFold2 3D model prediction Yes
3D model pTM-score0.52

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Duplodnaviria (60.000 % of family members)
NCBI Taxonomy ID 2731341
Taxonomy All Organisms → Viruses → Duplodnaviria

Most Common Ecosystem
GOLD Ecosystem Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous
(22.609 % of family members)
Environment Ontology (ENVO) Unclassified
(40.000 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Water (non-saline)
(39.130 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 36.36%    β-sheet: 0.00%    Coil/Unstructured: 63.64%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  		pTM-score: 0.52
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 115 Family Scaffolds
PF13884Peptidase_S74 2.61
PF00959Phage_lysozyme 1.74
PF13392HNH_3 1.74
PF08291Peptidase_M15_3 0.87
PF07460NUMOD3 0.87
PF00149Metallophos 0.87
PF04383KilA-N 0.87
PF01464SLT 0.87
PF11651P22_CoatProtein 0.87


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms81.74 %
UnclassifiedrootN/A18.26 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300001851|RCM31_10273829All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage843Open in IMG/M
3300002091|JGI24028J26656_1000078All Organisms → cellular organisms → Bacteria45744Open in IMG/M
3300002091|JGI24028J26656_1003910All Organisms → Viruses → Predicted Viral2428Open in IMG/M
3300002092|JGI24218J26658_1000998All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage10154Open in IMG/M
3300005346|Ga0074242_10798594All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage836Open in IMG/M
3300005527|Ga0068876_10670073All Organisms → cellular organisms → Bacteria556Open in IMG/M
3300005528|Ga0068872_10261022Not Available969Open in IMG/M
3300005582|Ga0049080_10304533All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage514Open in IMG/M
3300006030|Ga0075470_10084366All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage958Open in IMG/M
3300006037|Ga0075465_10167180All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage504Open in IMG/M
3300006400|Ga0075503_1539271All Organisms → cellular organisms → Bacteria507Open in IMG/M
3300006752|Ga0098048_1210216All Organisms → Viruses573Open in IMG/M
3300006802|Ga0070749_10097239All Organisms → Viruses → Predicted Viral1743Open in IMG/M
3300006802|Ga0070749_10739976All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage524Open in IMG/M
3300006916|Ga0070750_10312778All Organisms → cellular organisms → Bacteria669Open in IMG/M
3300006917|Ga0075472_10608245Not Available548Open in IMG/M
3300007276|Ga0070747_1281251All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage574Open in IMG/M
3300007346|Ga0070753_1048000All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1766Open in IMG/M
3300007346|Ga0070753_1109885All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1069Open in IMG/M
3300007534|Ga0102690_1159744All Organisms → Viruses → Predicted Viral1024Open in IMG/M
3300007540|Ga0099847_1219618All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage551Open in IMG/M
3300007541|Ga0099848_1030148All Organisms → Viruses → Predicted Viral2264Open in IMG/M
3300007542|Ga0099846_1077763All Organisms → Viruses → Predicted Viral1235Open in IMG/M
3300007960|Ga0099850_1240074Not Available701Open in IMG/M
3300007992|Ga0105748_10427605All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage573Open in IMG/M
3300008267|Ga0114364_1015586All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage6071Open in IMG/M
3300008448|Ga0114876_1007336All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage6667Open in IMG/M
3300008448|Ga0114876_1132936All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage935Open in IMG/M
3300008448|Ga0114876_1156326All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage825Open in IMG/M
3300009155|Ga0114968_10766483Not Available503Open in IMG/M
3300009161|Ga0114966_10781232All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage516Open in IMG/M
3300009169|Ga0105097_10568004Not Available637Open in IMG/M
3300010299|Ga0129342_1215232All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage678Open in IMG/M
3300010368|Ga0129324_10377337All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage549Open in IMG/M
3300012757|Ga0157628_1040874All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage811Open in IMG/M
3300012968|Ga0129337_1361719All Organisms → Viruses → Predicted Viral1217Open in IMG/M
3300014962|Ga0134315_1006135Not Available2002Open in IMG/M
3300017742|Ga0181399_1085414Not Available791Open in IMG/M
3300017747|Ga0181352_1106915Not Available764Open in IMG/M
3300017747|Ga0181352_1112802All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage738Open in IMG/M
3300017752|Ga0181400_1171846All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage608Open in IMG/M
3300017754|Ga0181344_1051345All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1230Open in IMG/M
3300017754|Ga0181344_1118516All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage763Open in IMG/M
3300017766|Ga0181343_1001900Not Available8109Open in IMG/M
3300017766|Ga0181343_1147191All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage657Open in IMG/M
3300017771|Ga0181425_1072017All Organisms → Viruses → Predicted Viral1115Open in IMG/M
3300017785|Ga0181355_1276156All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage638Open in IMG/M
3300017786|Ga0181424_10236881All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage766Open in IMG/M
3300017967|Ga0181590_11083737Not Available518Open in IMG/M
3300018048|Ga0181606_10364225All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage781Open in IMG/M
3300020176|Ga0181556_1133384Not Available1052Open in IMG/M
3300020498|Ga0208050_1004904All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1647Open in IMG/M
3300021347|Ga0213862_10243589All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → unclassified Planctomycetota → Planctomycetota bacterium634Open in IMG/M
3300021389|Ga0213868_10658321Not Available540Open in IMG/M
3300021956|Ga0213922_1079980All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes680Open in IMG/M
3300021961|Ga0222714_10448398All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage672Open in IMG/M
3300022178|Ga0196887_1088865All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → unclassified Rhodobacteraceae → Rhodobacteraceae bacterium SB2709Open in IMG/M
3300022179|Ga0181353_1060272All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage982Open in IMG/M
3300022198|Ga0196905_1033044All Organisms → Viruses → Predicted Viral1544Open in IMG/M
3300023174|Ga0214921_10071627All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage2821Open in IMG/M
3300023184|Ga0214919_10060320All Organisms → Viruses → Predicted Viral3520Open in IMG/M
3300023184|Ga0214919_10147952All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1870Open in IMG/M
3300023184|Ga0214919_10209938All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1448Open in IMG/M
3300023184|Ga0214919_10481515All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage772Open in IMG/M
3300023184|Ga0214919_10656096All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage605Open in IMG/M
3300024352|Ga0255142_1000087Not Available35705Open in IMG/M
3300024539|Ga0255231_1040027All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage748Open in IMG/M
3300024568|Ga0255238_1003073All Organisms → Viruses → Predicted Viral3767Open in IMG/M
3300024859|Ga0255278_1120270All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage506Open in IMG/M
3300025635|Ga0208147_1126335All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage607Open in IMG/M
3300025645|Ga0208643_1101283All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage788Open in IMG/M
3300025645|Ga0208643_1153884All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → unclassified Rhodobacteraceae → Rhodobacteraceae bacterium SB2580Open in IMG/M
3300025646|Ga0208161_1023784All Organisms → Viruses → Predicted Viral2257Open in IMG/M
3300025655|Ga0208795_1049586All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria1246Open in IMG/M
3300025668|Ga0209251_1159592All Organisms → Viruses → environmental samples → uncultured Mediterranean phage581Open in IMG/M
3300025732|Ga0208784_1257393All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage501Open in IMG/M
3300025756|Ga0255239_1009298All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1591Open in IMG/M
3300025759|Ga0208899_1092805All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1145Open in IMG/M
3300025889|Ga0208644_1357389All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage554Open in IMG/M
3300026473|Ga0255166_1020587All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1418Open in IMG/M
3300026503|Ga0247605_1089094Not Available757Open in IMG/M
3300027129|Ga0255067_1048756All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage604Open in IMG/M
3300027608|Ga0208974_1190602All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage501Open in IMG/M
3300027732|Ga0209442_1262740All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage612Open in IMG/M
3300027797|Ga0209107_10557918All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage502Open in IMG/M
(restricted) 3300027837|Ga0255041_10346945Not Available542Open in IMG/M
3300027893|Ga0209636_11146161Not Available554Open in IMG/M
3300027896|Ga0209777_10501933All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage894Open in IMG/M
3300028103|Ga0255172_1071242All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage627Open in IMG/M
3300029933|Ga0119945_1029193All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage630Open in IMG/M
3300031519|Ga0307488_10588064All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage648Open in IMG/M
3300031758|Ga0315907_10446766All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1033Open in IMG/M
3300031784|Ga0315899_10272548All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1682Open in IMG/M
3300031787|Ga0315900_10820419All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage638Open in IMG/M
3300031787|Ga0315900_10856228All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium618Open in IMG/M
3300031963|Ga0315901_11029438All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage572Open in IMG/M
3300032562|Ga0316226_1381422Not Available518Open in IMG/M
3300033418|Ga0316625_101000590All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage744Open in IMG/M
3300033482|Ga0316627_100228605All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1462Open in IMG/M
3300033978|Ga0334977_0466534All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage580Open in IMG/M
3300033980|Ga0334981_0171749All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1026Open in IMG/M
3300033981|Ga0334982_0140607All Organisms → Viruses → Predicted Viral1237Open in IMG/M
3300034012|Ga0334986_0629003All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage507Open in IMG/M
3300034020|Ga0335002_0529898All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage624Open in IMG/M
3300034023|Ga0335021_0234342All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1009Open in IMG/M
3300034101|Ga0335027_0096090All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage2272Open in IMG/M
3300034101|Ga0335027_0260850All Organisms → Viruses → Predicted Viral1192Open in IMG/M
3300034106|Ga0335036_0485696Not Available773Open in IMG/M
3300034112|Ga0335066_0001096Not Available19572Open in IMG/M
3300034118|Ga0335053_0268657All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1085Open in IMG/M
3300034119|Ga0335054_0417815All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage764Open in IMG/M
3300034122|Ga0335060_0548616All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage588Open in IMG/M
3300034283|Ga0335007_0757789All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage534Open in IMG/M

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
AqueousEnvironmental → Aquatic → Marine → Coastal → Unclassified → Aqueous22.61%
FreshwaterEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater18.26%
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake10.43%
FreshwaterEnvironmental → Aquatic → Freshwater → River → Unclassified → Freshwater6.96%
FreshwaterEnvironmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater4.35%
SeawaterEnvironmental → Aquatic → Marine → Strait → Unclassified → Seawater4.35%
LenticEnvironmental → Aquatic → Freshwater → Lentic → Unclassified → Lentic2.61%
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake2.61%
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake2.61%
SeawaterEnvironmental → Aquatic → Marine → Coastal → Unclassified → Seawater2.61%
Salt MarshEnvironmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh2.61%
Freshwater LenticEnvironmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lentic1.74%
Freshwater To Marine Saline GradientEnvironmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient1.74%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil1.74%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment0.87%
FreshwaterEnvironmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater0.87%
FreshwaterEnvironmental → Aquatic → Freshwater → Lentic → Hypolimnion → Freshwater0.87%
Freshwater And SedimentEnvironmental → Aquatic → Freshwater → Lentic → Hypolimnion → Freshwater And Sediment0.87%
Freshwater Lake SedimentEnvironmental → Aquatic → Freshwater → Lentic → Sediment → Freshwater Lake Sediment0.87%
Freshwater, PlanktonEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton0.87%
Marine PlanktonEnvironmental → Aquatic → Freshwater → Lotic → Unclassified → Marine Plankton0.87%
AquaticEnvironmental → Aquatic → Freshwater → Drinking Water → Unclassified → Aquatic0.87%
Surface WaterEnvironmental → Aquatic → Freshwater → Groundwater → Unclassified → Surface Water0.87%
FreshwaterEnvironmental → Aquatic → Freshwater → Creek → Unclassified → Freshwater0.87%
MarineEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Marine0.87%
Marine SedimentEnvironmental → Aquatic → Marine → Oceanic → Sediment → Marine Sediment0.87%
Sackhole BrineEnvironmental → Aquatic → Marine → Coastal → Unclassified → Sackhole Brine0.87%
Estuary WaterEnvironmental → Aquatic → Marine → Coastal → Unclassified → Estuary Water0.87%
MarineEnvironmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine0.87%
Estuarine WaterEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water0.87%
Saline Water And SedimentEnvironmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Sediment → Saline Water And Sediment0.87%

Visualization
Powered by ApexCharts



Associated Samples

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Taxon OIDSample NameHabitat TypeIMG/M Link
3300001851Marine plankton microbial communities from the Amazon River plume, Atlantic Ocean - RCM31, ROCA_DNA206_0.2um_MCP-S_C_3bEnvironmentalOpen in IMG/M
3300002091Lentic bog actinobacteria communities from Grosse Fuchskuhle, Germany - Sample acI-B2 co-culture F-F8 metagenomeEnvironmentalOpen in IMG/M
3300002092Lentic bog actinobacteria communities from Grosse Fuchskuhle, Germany - Sample acI-B2 co-culture F-B6 metagenomeEnvironmentalOpen in IMG/M
3300005346Saline sediment microbial community from Etoliko Lagoon, GreeceEnvironmentalOpen in IMG/M
3300005527Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel5S_2200h metaGEnvironmentalOpen in IMG/M
3300005528Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel1S_2200h metaGEnvironmentalOpen in IMG/M
3300005582Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER15MSRFEnvironmentalOpen in IMG/M
3300006030Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_D_<0.8_DNAEnvironmentalOpen in IMG/M
3300006037Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_0.19_>0.8_DNAEnvironmentalOpen in IMG/M
3300006400Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_D_<0.8_RNA2 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006752Marine viral communities from the Subarctic Pacific Ocean - 13_ETSP_OMZ_AT15268 metaGEnvironmentalOpen in IMG/M
3300006802Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18EnvironmentalOpen in IMG/M
3300006916Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_24EnvironmentalOpen in IMG/M
3300006917Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_N_<0.8_DNAEnvironmentalOpen in IMG/M
3300007276Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_31EnvironmentalOpen in IMG/M
3300007346Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_31EnvironmentalOpen in IMG/M
3300007534Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel4S_1600h metaT (Metagenome Metatranscriptome) (version 2)EnvironmentalOpen in IMG/M
3300007540Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_2 Viral MetaGEnvironmentalOpen in IMG/M
3300007541Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1S Viral MetaGEnvironmentalOpen in IMG/M
3300007542Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_1 Viral MetaGEnvironmentalOpen in IMG/M
3300007960Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1D Viral MetaGEnvironmentalOpen in IMG/M
3300007992Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1461AB_0.2umEnvironmentalOpen in IMG/M
3300008267Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, sample HABS-E2014-0024-100-LTREnvironmentalOpen in IMG/M
3300008448Freshwater viral communities during cyanobacterial harmful algal blooms (CHABs) in Western Lake Erie, USA - August 4, 2014 all contigsEnvironmentalOpen in IMG/M
3300009155Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_EF_MetaGEnvironmentalOpen in IMG/M
3300009161Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130207_XF_MetaGEnvironmentalOpen in IMG/M
3300009169Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 10-12cm May2015EnvironmentalOpen in IMG/M
3300010299Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_15_0.2_DNAEnvironmentalOpen in IMG/M
3300010368Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_15_0.2_DNAEnvironmentalOpen in IMG/M
3300012757Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES161 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012968Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.2_RNA1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300014962Surface water microbial communities from Bangladesh - BaraHaldiaSW0309EnvironmentalOpen in IMG/M
3300017742Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 22 SPOT_SRF_2011-05-21EnvironmentalOpen in IMG/M
3300017747Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MLB.S.NEnvironmentalOpen in IMG/M
3300017752Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 23 SPOT_SRF_2011-06-22EnvironmentalOpen in IMG/M
3300017754Freshwater viral communities from Lake Michigan, USA - Su13.VD.MLB.D.DEnvironmentalOpen in IMG/M
3300017766Freshwater viral communities from Lake Michigan, USA - Su13.VD.MLB.S.DEnvironmentalOpen in IMG/M
3300017771Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 48 SPOT_SRF_2013-11-13EnvironmentalOpen in IMG/M
3300017785Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.D.NEnvironmentalOpen in IMG/M
3300017786Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 47 SPOT_SRF_2013-09-18EnvironmentalOpen in IMG/M
3300017967Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071411BT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300018048Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 041412US metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300020176Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011505AT metaG (spades assembly)EnvironmentalOpen in IMG/M
3300020498Freshwater microbial communities from Lake Mendota, WI - 13JUN2010 deep hole epilimnion (SPAdes)EnvironmentalOpen in IMG/M
3300021347Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO266EnvironmentalOpen in IMG/M
3300021389Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO127EnvironmentalOpen in IMG/M
3300021956Freshwater microbial communities from McNutts Creek, Athens, Georgia, United States - 29-17 MGEnvironmentalOpen in IMG/M
3300021961Estuarine water microbial communities from San Francisco Bay, California, United States - C33_3DEnvironmentalOpen in IMG/M
3300022178Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_31 (v3)EnvironmentalOpen in IMG/M
3300022179Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MLB.D.NEnvironmentalOpen in IMG/M
3300022198Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1S Viral MetaG (v3)EnvironmentalOpen in IMG/M
3300023174Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL-1505EnvironmentalOpen in IMG/M
3300023184Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL-1503EnvironmentalOpen in IMG/M
3300024352Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Cont_RepB_0hEnvironmentalOpen in IMG/M
3300024539Metatranscriptome of freshwater microbial communities from Columbia River, Oregon, United States - Colum_Atlam_RepB_8h (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300024568Metatranscriptome of freshwater microbial communities from Columbia River, Oregon, United States - Colum_Miss_RepA_8d (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300024859Metatranscriptome of freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Cont_RepC_8d (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300025635Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_0.3_<0.8_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300025645Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_12 (SPAdes)EnvironmentalOpen in IMG/M
3300025646Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1S Viral MetaG (SPAdes)EnvironmentalOpen in IMG/M
3300025655Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_2 Viral MetaG (SPAdes)EnvironmentalOpen in IMG/M
3300025668Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - SI073_LV_100m_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300025732Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_N_>0.8_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300025756Metatranscriptome of freshwater microbial communities from Columbia River, Oregon, United States - Colum_Miss_RepB_8d (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300025759Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_24 (SPAdes)EnvironmentalOpen in IMG/M
3300025889Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18 (SPAdes)EnvironmentalOpen in IMG/M
3300026473Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Cont_RepC_8dEnvironmentalOpen in IMG/M
3300026503Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 91R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300027129Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Cont_RepB_8hEnvironmentalOpen in IMG/M
3300027608Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER15MSRF (SPAdes)EnvironmentalOpen in IMG/M
3300027732Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM110.DD (SPAdes)EnvironmentalOpen in IMG/M
3300027736Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140205_XF_MetaG (SPAdes)EnvironmentalOpen in IMG/M
3300027797Freshwater microbial communities from dead zone in Lake Erie, Canada - CCB hypolimnion July 2011 (SPAdes)EnvironmentalOpen in IMG/M
3300027837 (restricted)Seawater microbial communities from Strait of Georgia, British Columbia, Canada - BC1_12_3EnvironmentalOpen in IMG/M
3300027893Marine sediment microbial communities from White Oak River estuary, North Carolina - WOR-1-52-54 (SPAdes)EnvironmentalOpen in IMG/M
3300027896Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies -HBP12 HB (SPAdes)EnvironmentalOpen in IMG/M
3300028103Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Yuk_RepC_8dEnvironmentalOpen in IMG/M
3300029933Aquatic microbial communities from drinking water treatment plant in Pearl River Delta area, China - influent_20120727_2EnvironmentalOpen in IMG/M
3300031519Sea-ice brine microbial communities from Beaufort Sea near Barrow, Alaska, United States - SB 0.2EnvironmentalOpen in IMG/M
3300031758Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA123EnvironmentalOpen in IMG/M
3300031784Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 4 MA112EnvironmentalOpen in IMG/M
3300031787Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA114EnvironmentalOpen in IMG/M
3300031963Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA116EnvironmentalOpen in IMG/M
3300032562Freshwater microbial communities from Trout Bog Lake, Wisconsin, USA - TBH18017EnvironmentalOpen in IMG/M
3300033418Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_T1_C1_D1_AEnvironmentalOpen in IMG/M
3300033482Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M2_C1_D1_CEnvironmentalOpen in IMG/M
3300033978Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME28Sep2014-rr0002EnvironmentalOpen in IMG/M
3300033980Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME09Aug2015-rr0007EnvironmentalOpen in IMG/M
3300033981Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME24Aug2014-rr0011EnvironmentalOpen in IMG/M
3300034012Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME18Aug2017-rr0027EnvironmentalOpen in IMG/M
3300034020Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME07Aug2015-rr0055EnvironmentalOpen in IMG/M
3300034023Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME21Oct2016-rr0090EnvironmentalOpen in IMG/M
3300034101Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME19Sep2005-rr0107EnvironmentalOpen in IMG/M
3300034106Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME23Aug2013-rr0131EnvironmentalOpen in IMG/M
3300034112Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME27Aug2014-rr0191EnvironmentalOpen in IMG/M
3300034118Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME05Aug2017-rr0165EnvironmentalOpen in IMG/M
3300034119Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME21Jul2015-rr0166EnvironmentalOpen in IMG/M
3300034122Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME03Aug2014-rr0181EnvironmentalOpen in IMG/M
3300034283Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME07Aug2003-rr0061EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Protein ID Sample Taxon ID Habitat Sequence
RCM31_1027382923300001851Marine PlanktonPAPEGQAPYKSVRQDLIPVLVKAIQELKAEVETLEAQPQRLQ*
JGI24028J26656_100007813300002091LenticLIDEWLDPAPEGEEAYKSVRADLIPIFVKAIQELSAKNDALEARLAKLENAQ*
JGI24028J26656_100391053300002091LenticLIDEWLDPAPEGEEAYKSVRADLIPIFVKAIQELSAKNDALEARVAALEGK*
JGI24218J26658_1000998123300002092LenticLIDEWLDPAPEGEEAYKSVRADLIPIFVKAIQELSAKNDALEARLAALEAK*
Ga0074242_1079859413300005346Saline Water And SedimentMNGKMKLLTGEEPYKAIRADLIPVLVKAIQEQQAIIQGLEARLAALESA*
Ga0068876_1067007313300005527Freshwater LakePELIDEWKDPAPEGEEPYKAVRADLIPVLVKAIQEQQAMIETLKAKVAALEAK*
Ga0068872_1026102253300005528Freshwater LakeDLIDEWKDPAPEGEEPYKSVRQDLIPVLVKAIQELSAKVAALEAK*
Ga0049080_1030453313300005582Freshwater LenticKEWLDPAPEGEKPYKAINANLIPTLVKAIQEQQALIIQLTARITALESA*
Ga0075470_1008436613300006030AqueousAQEFEQVLPDMIEEWKDPAPEGEEPYKAVNANLIPTLVKAIQEQQALITQLQADLAALKGA*
Ga0075465_1016718023300006037AqueousDLIDEWKDPAPEGEEPYKSVRQDLIPVLVKAIQELNAKNASLEARLAALEN*
Ga0075503_153927113300006400AqueousDLIDEWKDPAPEGGEPYKTVRQDLIPVLVKAIQEQQATITALEARITALENA*
Ga0098048_121021633300006752MarineEVFPDLVGVWKDEPPEGEEPYKAVSQDLIPTLVKALQELSAKNDALESRITALEGA*
Ga0070749_1009723963300006802AqueousKDPEPEGEAPYKSVRQDLIPVLVKAIQELKAQNDDLRVRLAAAGI*
Ga0070749_1073997613300006802AqueousDPAPEGEEPYKSVRADLIPVLVKAMQEQQALITALTARIEALEA*
Ga0070750_1031277833300006916AqueousPEGEEPYKSVRADLIPTLVKAIQEQQDIIKALETRIQTLENQ*
Ga0075472_1060824513300006917AqueousDPAPEGEEPYKAINANLIPTLVKAIQEQQALITQLTARITALETP*
Ga0070747_128125123300007276AqueousEVFPDLIAEWKDPAPEGEEPYKSVSQDLIPTLVKAIQEQQAIIEALTARIAALES*
Ga0070753_104800073300007346AqueousFIAQEFEQVFPDLVDEWKDPAPEGEEPYKSVRQDLIPVLVKAIQELKAELDEAKAKIAALEAK*
Ga0070753_110988513300007346AqueousDGEESYKSVRADLIPVLIKAIQEQQALITSLTARVALLEGN*
Ga0102690_115974413300007534Freshwater LakePDLIDEWKEAPPEGEEPYKSVRADLIPVLVKAIQELKAIVDAQAVEIAALKG*
Ga0099847_121961813300007540AqueousIAQEFEQVFPDLIDEWKDPAPEGEEPYKSVRQDLIPVLVKAIQEQQAIIEDMKTRLAVAGI*
Ga0099848_103014813300007541AqueousYKSVRQDLIPVLVKAIQEQQALITAQQTAIETLEARVAALEAA*
Ga0099846_107776323300007542AqueousQEFEQVFPDLIGEWKDPAPEGEEPYKSVRQDLIPVLVKAIQELKAENDVLKARLDAAGL*
Ga0099850_124007413300007960AqueousYKSVRQDLIPVLVKAIQEQQTLIESQQSQIDALTARIEVLETA*
Ga0105748_1042760523300007992Estuary WaterLISEWKDPAPEGEEPYKAVSQDLIPTLVKAIQEQQATIESQAAAITDLTTRLTALENN*
Ga0114364_101558653300008267Freshwater, PlanktonVFPDLIDEWKDPAPEGEEPYKSVRQDLIPVLVKAIQEQQALITQLQADVAALKGASA*
Ga0114876_100733613300008448Freshwater LakeFETVFPNLIDEWKDPAPEGEAPYKSVRQDLIPVLVKAIQELAAEVNALKNA*
Ga0114876_113293613300008448Freshwater LakeTWKDPAPEGEEPYKSVRQDLIPVLVKAIQEQQLLIQQLQADVAILKGVQQ*
Ga0114876_115632633300008448Freshwater LakeDEWKDPAPEGEAPYKSVRQDLIPVLVKAIQELTARVEALEA*
Ga0114968_1076648313300009155Freshwater LakePAPEGEEPYKAVNADLIPTLVKAIQEQQALIQSLTDRITQLENKL*
Ga0114966_1078123213300009161Freshwater LakeQEFETVFPEMIDTWKDPAPEGEEPYKAVNADLIPVLVKAIQELNAKVDEQAVRIAELEGVA*
Ga0105097_1056800433300009169Freshwater SedimentEMIQNWKDPAPEGEEPYKAVNADLIPILVKAIQELKAEFDAYKATHP*
Ga0129342_121523223300010299Freshwater To Marine Saline GradientVFPDLIDEWKDPAPEGEEPYKSVRQDLIPVLVKAIQEQQAMIEELKAEVAALKGE*
Ga0129324_1037733713300010368Freshwater To Marine Saline GradientGEDPYKSVRQDLIPVLVKAIQEQQALITAQQTAIETLEARVAALEAA*
Ga0157628_104087413300012757FreshwaterPAPEGEAPYKSVRQDLIPVLVKAIQELAAEVNALKNA*
Ga0129337_136171913300012968AqueousIDTWKDEAPEGEEPYKSVRADLIPVLVKAIQELKAEFDAYKATHP*
Ga0134315_100613513300014962Surface WaterVFPDLIDTWKDKPPEGEEPYKSVRPDLMPVVVKAIQELAAKVSALEAKQ*
Ga0181399_108541413300017742SeawaterGEDVKVIAQNLVPYLVKAVQELSAKNDALEARIIALEKA
Ga0181352_110691513300017747Freshwater LakeDMVENWADPAPEGEEAYKAVNANLIPTLVKAIQEQQAIIESMKTEIDALKAKVGA
Ga0181352_111280213300017747Freshwater LakeDPAPEGEEPYKSVRADLIPVLVKAMQEQQALIAQLQADVAALKA
Ga0181400_117184623300017752SeawaterWIDPAPEGEEPYKAVRADLIPTLVKAIQEQQATIESQATAITDLTTRLTALENN
Ga0181344_105134553300017754Freshwater LakeEVFPDLIDEWKDPAPEGEEPYKSVRQDLIPVLVKAIQEQQALIQTLTARITALESA
Ga0181344_111851643300017754Freshwater LakeEVFPDLIDEWKDPAPEGEEPYKSVRQDLIPVLVKAIQEQQAIITQLTARITALEGA
Ga0181343_100190013300017766Freshwater LakeGEEPYKAVNADLIPVLVKAMQEQQALIVSLEARVAALEAA
Ga0181343_114719133300017766Freshwater LakeDEWKDPAPEGEEPYKSVRQDLIPVLVKAIQEQQAIITQLTARITALEGA
Ga0181425_107201713300017771SeawaterREGLVGEWKDEAPEGEEPYKAVSQDLIPTLVKAIQEQQTLIESLTARIAALEE
Ga0181355_127615613300017785Freshwater LakePAPEGEEPYKSVRQDLIPVLVKAIQEQQVMINELMAKFAALESK
Ga0181424_1023688113300017786SeawaterLIDHWLDEPPEGEEPYKAVRADLIPTLVKAIQEQQATIEALTARVAQLENN
Ga0181590_1108373723300017967Salt MarshRQDLIPVLVKAIQEQQALITAQQTAIETLEARVAALEAA
Ga0181606_1036422513300018048Salt MarshVFPDLIDEWKDPAPEGEEPYKSVRQDLIPVLVKAIQEQQALIQTLTDRITALEAK
Ga0181556_113338413300020176Salt MarshKDPAPEGEEPYKSVRQDLIPVLVKAIQEQQATITALEARIAALEAN
Ga0208050_100490473300020498FreshwaterIAQEFEQVFPNLIDEWKDEAPEGEAPYKSVRQDLIPVLVKAIQELTARVQTLEAK
Ga0213862_1024358923300021347SeawaterDPAPEGEEPYKSVRQDLIPVLVKAIQEQQETITALTARIEQLENN
Ga0213868_1065832113300021389SeawaterPDLVDEWLDEAPEGEEPYKSVRPDLIPVLVKAIQEQQEQIEQLKVEIQTLKGE
Ga0213922_107998013300021956FreshwaterPDMIETWKDPAPEGEEPYKAVNANLIPSLVKAIQELKAELDELKQKVN
Ga0222714_1044839833300021961Estuarine WaterDEWKDNAPEGEAPYKSVRQDLIPVLVKAIQELTARVEALEA
Ga0196887_108886533300022178AqueousSPEGEEPYKSVRQDLIPVLVKAIQELSAKNDALEARITALESA
Ga0181353_106027243300022179Freshwater LakePAPEGEEPYKSVRADLIPVLVKAIQELNAKVEAQAAEIALLKSK
Ga0196905_103304413300022198AqueousRDPAPEGEEPYKSVRQDLIPVLVKAIQEQQALITAQQTAIETLEARVAALEAA
Ga0196905_106538523300022198AqueousMVDKSAIIPLLTAAIQEQQALITALTARVAALEGTQP
Ga0214921_1007162713300023174FreshwaterFPDMVSNWIDEPPEGEEPYKAVNANLIPSLVKAIQEQQALITQLQADVAALKGTK
Ga0214919_1006032013300023184FreshwaterTPPEGEKPYKSVRADLIPVLVKAIQEQQTIINDLKARIIALEGAK
Ga0214919_1014795253300023184FreshwaterFEEVLPDLIDEWKDTPPEGEKPYKSVRADLIPVLVKAIQEQQIIINDLKARVTALEGASL
Ga0214919_1020993843300023184FreshwaterFEEVLPDLIDEWKDTPPEGEKPYKSVRADLIPVLVKAIQEQQTIINDLKARVTALEAK
Ga0214919_1048151523300023184FreshwaterIDEWKDTPPEGEKPYKSVRADLIPVLVKAIQEQQTIINDLTARITALEGAA
Ga0214919_1065609613300023184FreshwaterPAPEGEEPYKSVRQDLIPVLVKAIQEQSALITQLTARITALEARNG
Ga0255142_1000087623300024352FreshwaterEWKDPAPEGEEPYKSVRQDLIPVLVKAIQEQQAIIEQLKARLDAANL
Ga0255231_104002713300024539FreshwaterEFETVFPNLVDEWKDPAPEGEAPYKSVRQDLIPVLVKAIQELTARVQTLEAR
Ga0255238_100307313300024568FreshwaterAPEGEEPYKSVRADLIPVLVKAIQELKAEVDSLKAQLEAK
Ga0255278_112027013300024859FreshwaterLVDEWKDNAPEGEAPYKSVRQDLIPVLVKAIQELTARVEALEA
Ga0208147_112633523300025635AqueousGFIAQEFEQVFPDLIDEWKDPAPEGEAPYKSVRQDLIPVLVKAIQELKAQNDDLRARLAAAGI
Ga0208643_110128313300025645AqueousKDPAPEGEEPYKAVRADLIPTLVKAIQEQQATIESQAAAITDLTTRLTALENN
Ga0208643_115388413300025645AqueousVFPDLIDEWKDASPEGEEPYKSVRQDLIPVLVKAIQELSAKNDALEARITALESA
Ga0208161_102378413300025646AqueousPYKSVRQDLIPVLVKAIQEQQALITAQQTAIETLEARVAALEAA
Ga0208795_104958613300025655AqueousQEFEQVFPEMIGEWLDPAPEGEEPYKSVRADLIPVLVKAIQEQQAIINGLEARLTALEAS
Ga0209251_115959213300025668MarineQVFPDLVDEWKDAAPEGEEHYKSVRQDLIPVLVKAIQELSAKNDELEARITALEGA
Ga0208784_125739323300025732AqueousQEFETVFPNLIDEWKDAAPEGETPYKSVRQDLIPVLVKAIQELTARVQTLEAK
Ga0255239_100929813300025756FreshwaterPAPEGEAPYKSVRQDLIPVLVKAIQELTARVQTLEAR
Ga0208899_109280553300025759AqueousTDLIPLLTAAIQEQQELITAQQTAIETLEARVAALEAA
Ga0208644_135738913300025889AqueousQEFEQVFPDLVDEWKEPAPEGEEPYKSVRADLIPTLVKAIQEQQDIIKALETRIQTLENQ
Ga0255166_102058713300026473FreshwaterDEWKDNAPEGEVPYKSVRQDLIPVLVKAIQELTARVAALEA
Ga0247605_108909433300026503SeawaterWKDEPPEGEEPYKAVSQDLIPTLVKAIQELSAKNDALEARIATLEG
Ga0255067_104875613300027129FreshwaterLIDDWRDPAPEGEDPYKSVRQDLMPVLVKAIQEQQAIIESLKARLDAANL
Ga0208974_119060213300027608Freshwater LenticKEWLDPAPEGEKPYKAINANLIPTLVKAIQEQQALIIQLTARITALESA
Ga0209442_126274013300027732Freshwater LakePAPEGEEPYKSVRQDLIPVLVKAIQEQQTLITQLTARLDAANL
Ga0209190_130283733300027736Freshwater LakeEEPYRSVRQDLMPVLVKAIQEQQALIESLTTRLTALENK
Ga0209107_1055791833300027797Freshwater And SedimentNVFPDMIKEWLDPAPEGEKPYKAINANLIPTLVKAIQEQQALIIQLTARITALESA
(restricted) Ga0255041_1034694533300027837SeawaterPEGEEPYKAVSQDLIPTLVKAIQELSAKNDALEARIANLEG
Ga0209636_1114616113300027893Marine SedimentPAPEGEEPYKSVRQDLIPVLVKAIQELKAELDSVKAELAVIKGA
Ga0209777_1050193313300027896Freshwater Lake SedimentPEGEEPYKSVRADLIPTLVKAIQEQQAIITDLKARIETLEKK
Ga0255172_107124213300028103FreshwaterTVFPDMIETWQDPVPEGEEPYKAVNANLIPTLVKAIQELKAEIDALKG
Ga0119945_102919313300029933AquaticVFPEMIDTWLDPAPEGEEPYKAVNADLIPVLVKAIQELNAKVEAQAAEIAALKGNA
Ga0307488_1058806433300031519Sackhole BrineLIGEWKDPAPEGEEPYKSVSQDLIPTLVKAIQEQQTTIEALTARIAALES
Ga0315907_1044676653300031758FreshwaterQLVDEWADPAPEGEAPYKSVRQDLIPVLVKAIQELAAEVNALKNA
Ga0315899_1027254873300031784FreshwaterDNAPEGEAPYKSVRQDLIPVLVKAIQELTARVEALEA
Ga0315900_1082041923300031787FreshwaterIDEWADPAPEGEASYKSVRQDLIPVLVKAIQELAAEVNALKKA
Ga0315900_1085622813300031787FreshwaterLIDEWKDPAPEGEEPYKAVRADLIPVLVKAIQEQQAMIETLKAKVAALEAK
Ga0315901_1102943823300031963FreshwaterEFETVFPNLIDEWKDPAPEGEAPYKSVRQDLIPVLVKAIQELTARVEALEA
Ga0316226_138142223300032562FreshwaterPDMIENWKDEAPEGEEPYKAINANLIPTLVKAIQEQQAIIEQLKAKVGI
Ga0316625_10100059013300033418SoilPDMVDTWQDPAPEGEEPYKAVNADLIPVLVKAIQEQQALITDLRARVAALESN
Ga0316627_10022860513300033482SoilFPDMIDEWKDPAPEGEEPYKSVRADLIPVLVKAIQELKAEVDSLKAQLEAK
Ga0334977_0466534_418_5793300033978FreshwaterQEFETVFPNLIDEWKENAPEGEAPYKSVRQDLIPVLVKAIQELTARVQTLEAK
Ga0334981_0171749_919_10263300033980FreshwaterPEGEAPYKSVRQDLIPVLVKAIQELAAEVNALKNA
Ga0334982_0140607_1077_12353300033981FreshwaterEFETVFPNLIDEWKDEAPEGEAPYKSVRQDLIPVLVKAIQELTARVQTLETR
Ga0334986_0629003_350_4963300034012FreshwaterVFPNLVDEWKDPAPEGEAPYKSVRQDLIPVLVKAIQELTARVQTLEAR
Ga0335002_0529898_466_6243300034020FreshwaterQEFEQVFPNLVDEWKDNAPEGEAPYKSVRQDLIPVLVKAIQELTARVEALEA
Ga0335021_0234342_3_1793300034023FreshwaterFEKVFPDLIDIAKDPVKEGETPYKTIRQDLIPVLVKAIQEQTQIIKNLEARIVSLESK
Ga0335027_0096090_3_1523300034101FreshwaterEQVFPNLIDEWKDPAPEGEAPYKSVRQDLIPVLVKAIQELTARVEALEA
Ga0335027_0260850_3_1523300034101FreshwaterDTWKDEAPEGEEPYKSVRADLIPVLVKAIQEQQAIIEQLKADVAALKGA
Ga0335036_0485696_629_7723300034106FreshwaterWKDPAPEGEEPYKAVNANLIPTLVKAIQEQQALITTLTDRITALEQA
Ga0335066_0001096_19396_195513300034112FreshwaterMVDQWIDPAPEGEEPYKAVNADLIPVLVKAIQELKADLDATKAELAALKGA
Ga0335053_0268657_963_10853300034118FreshwaterWADPSPEGEAPYKSVRQDLIPVLVKAIQELAAEVNALKNA
Ga0335054_0417815_3_1433300034119FreshwaterPQLVDEWADPSPEGEAPYKSVRQDLIPVLVKAIQELAAEVNALKNA
Ga0335060_0548616_6_1763300034122FreshwaterVFPDLIDEWKDPAPEGEEPYKSVRADLIPVLVKAIQELKSELDSVKAELATLKGNP
Ga0335007_0757789_3_1373300034283FreshwaterPPEGEEPYKSVGADLIPVLVKAIQEQQQMIETLQAKVAALEGKK

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.