NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F080257

Metagenome / Metatranscriptome Family F080257

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F080257
Family Type Metagenome / Metatranscriptome
Number of Sequences 115
Average Sequence Length 51 residues
Representative Sequence MENLSWLFWGYAAGWLLIFGYLFWISAKERTLRKKISELQEAMEERWKQKKA
Number of Associated Samples 75
Number of Associated Scaffolds 115

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 86.96 %
% of genes near scaffold ends (potentially truncated) 20.87 %
% of genes from short scaffolds (< 2000 bps) 81.74 %
Associated GOLD sequencing projects 73
AlphaFold2 3D model prediction Yes
3D model pTM-score0.43

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (71.304 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog
(22.609 % of family members)
Environment Ontology (ENVO) Unclassified
(53.043 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Water (non-saline)
(42.609 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Transmembrane (alpha-helical) Signal Peptide: No Secondary Structure distribution: α-helix: 61.25%    β-sheet: 0.00%    Coil/Unstructured: 38.75%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  		pTM-score: 0.43
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 115 Family Scaffolds
PF07589PEP-CTERM 32.17
PF01578Cytochrom_C_asm 26.09
PF02265S1-P1_nuclease 5.22
PF10431ClpB_D2-small 1.74
PF02397Bac_transf 0.87
PF02952Fucose_iso_C 0.87
PF01548DEDD_Tnp_IS110 0.87
PF13231PMT_2 0.87
PF02894GFO_IDH_MocA_C 0.87
PF13490zf-HC2 0.87

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 115 Family Scaffolds
COG0673Predicted dehydrogenaseGeneral function prediction only [R] 0.87
COG2148Sugar transferase involved in LPS biosynthesis (colanic, teichoic acid)Cell wall/membrane/envelope biogenesis [M] 0.87
COG2407L-fucose isomerase or related proteinCarbohydrate transport and metabolism [G] 0.87
COG3547TransposaseMobilome: prophages, transposons [X] 0.87

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms71.30 %
UnclassifiedrootN/A28.70 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300004152|Ga0062386_100833841All Organisms → cellular organisms → Bacteria760Open in IMG/M
3300005616|Ga0068852_102539138All Organisms → cellular organisms → Bacteria532Open in IMG/M
3300005712|Ga0070764_10701630All Organisms → cellular organisms → Bacteria623Open in IMG/M
3300006059|Ga0075017_101478274All Organisms → cellular organisms → Bacteria535Open in IMG/M
3300006176|Ga0070765_101863445Not Available564Open in IMG/M
3300009645|Ga0116106_1260422All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4552Open in IMG/M
3300009665|Ga0116135_1044462All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA41535Open in IMG/M
3300010341|Ga0074045_10950012Not Available542Open in IMG/M
3300010379|Ga0136449_100155031All Organisms → cellular organisms → Bacteria4481Open in IMG/M
3300010379|Ga0136449_101700380All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4951Open in IMG/M
3300010379|Ga0136449_101923025All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4878Open in IMG/M
3300010379|Ga0136449_102555984Not Available730Open in IMG/M
3300010379|Ga0136449_104107456All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4542Open in IMG/M
3300011120|Ga0150983_11655060Not Available554Open in IMG/M
3300014156|Ga0181518_10490724Not Available582Open in IMG/M
3300014160|Ga0181517_10171861Not Available1203Open in IMG/M
3300014160|Ga0181517_10204090All Organisms → cellular organisms → Bacteria1079Open in IMG/M
3300014161|Ga0181529_10097337Not Available1887Open in IMG/M
3300014161|Ga0181529_10519569All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4628Open in IMG/M
3300014161|Ga0181529_10573231All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4591Open in IMG/M
3300014162|Ga0181538_10706499Not Available522Open in IMG/M
3300014164|Ga0181532_10054125All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA42638Open in IMG/M
3300014164|Ga0181532_10184368All Organisms → cellular organisms → Bacteria1233Open in IMG/M
3300014164|Ga0181532_10545558All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4632Open in IMG/M
3300014167|Ga0181528_10049594All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA42328Open in IMG/M
3300014167|Ga0181528_10092228All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA41650Open in IMG/M
3300014167|Ga0181528_10154489All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA41241Open in IMG/M
3300014167|Ga0181528_10395781All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4752Open in IMG/M
3300014168|Ga0181534_10059861All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA41878Open in IMG/M
3300014168|Ga0181534_10161093All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA41155Open in IMG/M
3300014169|Ga0181531_10128627All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA41524Open in IMG/M
3300014169|Ga0181531_10577157All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4696Open in IMG/M
3300014199|Ga0181535_10211523All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA41185Open in IMG/M
3300014200|Ga0181526_10213313All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA41234Open in IMG/M
3300014489|Ga0182018_10000065All Organisms → cellular organisms → Bacteria → Acidobacteria124267Open in IMG/M
3300014489|Ga0182018_10008060All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus7960Open in IMG/M
3300014491|Ga0182014_10062726All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA42450Open in IMG/M
3300014491|Ga0182014_10455650All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4631Open in IMG/M
3300014492|Ga0182013_10030442All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus4539Open in IMG/M
3300014492|Ga0182013_10044773All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA43451Open in IMG/M
3300014492|Ga0182013_10306493Not Available888Open in IMG/M
3300014493|Ga0182016_10497231Not Available706Open in IMG/M
3300014498|Ga0182019_11212994All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4555Open in IMG/M
3300014498|Ga0182019_11404818All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4518Open in IMG/M
3300014499|Ga0182012_10391746All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4918Open in IMG/M
3300014501|Ga0182024_11252673All Organisms → cellular organisms → Bacteria864Open in IMG/M
3300014501|Ga0182024_11885818All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4665Open in IMG/M
3300014657|Ga0181522_10263498All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA41020Open in IMG/M
3300014657|Ga0181522_11061782Not Available503Open in IMG/M
3300014658|Ga0181519_10192143All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA41288Open in IMG/M
3300014839|Ga0182027_10224542All Organisms → cellular organisms → Bacteria → Acidobacteria2164Open in IMG/M
3300014839|Ga0182027_10630963All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA41146Open in IMG/M
3300016705|Ga0181507_1238882Not Available1024Open in IMG/M
3300016750|Ga0181505_10839452Not Available506Open in IMG/M
3300016750|Ga0181505_11197645All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4532Open in IMG/M
3300017935|Ga0187848_10448130Not Available529Open in IMG/M
3300017946|Ga0187879_10330196All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4846Open in IMG/M
3300017946|Ga0187879_10711413All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4559Open in IMG/M
3300017948|Ga0187847_10218452All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA41038Open in IMG/M
3300017948|Ga0187847_10332870All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4831Open in IMG/M
3300017988|Ga0181520_10111132All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA42318Open in IMG/M
3300017988|Ga0181520_10891558Not Available594Open in IMG/M
3300017988|Ga0181520_10981486Not Available560Open in IMG/M
3300018006|Ga0187804_10374585All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4628Open in IMG/M
3300018033|Ga0187867_10382883All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4780Open in IMG/M
3300018038|Ga0187855_10851487Not Available532Open in IMG/M
3300018040|Ga0187862_10623003All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4637Open in IMG/M
3300018040|Ga0187862_10681370All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4602Open in IMG/M
3300018042|Ga0187871_10506194All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4668Open in IMG/M
3300018042|Ga0187871_10651182All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4585Open in IMG/M
3300018043|Ga0187887_10569057Not Available669Open in IMG/M
3300019242|Ga0181502_1113552All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4619Open in IMG/M
3300019256|Ga0181508_1191236All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA41349Open in IMG/M
3300019258|Ga0181504_1178786Not Available1053Open in IMG/M
3300019258|Ga0181504_1244236Not Available526Open in IMG/M
3300019270|Ga0181512_1305375Not Available1085Open in IMG/M
3300022881|Ga0224545_1043950All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4632Open in IMG/M
3300023101|Ga0224557_1021402All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia3477Open in IMG/M
3300027854|Ga0209517_10443379Not Available719Open in IMG/M
3300027879|Ga0209169_10544627All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4608Open in IMG/M
3300028780|Ga0302225_10344346Not Available704Open in IMG/M
3300029907|Ga0311329_10458022Not Available877Open in IMG/M
3300029911|Ga0311361_11296131All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4571Open in IMG/M
3300029943|Ga0311340_10571938All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4994Open in IMG/M
3300029986|Ga0302188_10465528All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4515Open in IMG/M
3300031234|Ga0302325_12011514All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4712Open in IMG/M
3300031236|Ga0302324_100292251All Organisms → cellular organisms → Bacteria2506Open in IMG/M
3300031236|Ga0302324_102826731Not Available583Open in IMG/M
3300031249|Ga0265339_10495916Not Available564Open in IMG/M
3300031250|Ga0265331_10130636All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA41146Open in IMG/M
3300031344|Ga0265316_10009951All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus8709Open in IMG/M
3300031344|Ga0265316_10643080Not Available750Open in IMG/M
3300031524|Ga0302320_10279810All Organisms → cellular organisms → Bacteria2246Open in IMG/M
3300031525|Ga0302326_10288953All Organisms → cellular organisms → Bacteria2632Open in IMG/M
3300031525|Ga0302326_13693298All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4504Open in IMG/M
3300031595|Ga0265313_10187683All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4866Open in IMG/M
3300031788|Ga0302319_11120097All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4736Open in IMG/M
3300031788|Ga0302319_11568630Not Available582Open in IMG/M
3300031902|Ga0302322_103954882Not Available506Open in IMG/M
3300032160|Ga0311301_10328959All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA42415Open in IMG/M
3300032160|Ga0311301_12669514Not Available551Open in IMG/M
3300032805|Ga0335078_10034747All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus7487Open in IMG/M
3300032805|Ga0335078_10785877All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA41163Open in IMG/M
3300032805|Ga0335078_11048668All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4960Open in IMG/M
3300032805|Ga0335078_11794812All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4667Open in IMG/M
3300032828|Ga0335080_10688442All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA41067Open in IMG/M
3300032895|Ga0335074_10240982All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA42142Open in IMG/M
3300032898|Ga0335072_10001382All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus39547Open in IMG/M
3300032898|Ga0335072_10351424Not Available1614Open in IMG/M
3300032898|Ga0335072_10437555All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA41385Open in IMG/M
3300033402|Ga0326728_10001850All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia72914Open in IMG/M
3300033405|Ga0326727_10848920Not Available694Open in IMG/M
3300033887|Ga0334790_035389All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA42008Open in IMG/M
3300034065|Ga0334827_243570All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4526Open in IMG/M
3300034282|Ga0370492_0080668Not Available1332Open in IMG/M


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
BogEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog22.61%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Peatland17.39%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil7.83%
Peatlands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil6.96%
BogEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Bog6.09%
PalsaEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa6.09%
BogEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Bog5.22%
RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere4.35%
FenEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Fen3.48%
SoilEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Soil3.48%
SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Soil2.61%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland1.74%
PalsaEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Palsa1.74%
PermafrostEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost1.74%
Peat SoilEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil1.74%
Bog Forest SoilEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil0.87%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment0.87%
WatershedsEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds0.87%
Untreated Peat SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil0.87%
Bog Forest SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil0.87%
Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil0.87%
FenEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Fen0.87%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere0.87%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300004152Coassembly of ECP12_OM1, ECP12_OM2, ECP12_OM3EnvironmentalOpen in IMG/M
3300005616Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2Host-AssociatedOpen in IMG/M
3300005712Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 4EnvironmentalOpen in IMG/M
3300006059Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2012EnvironmentalOpen in IMG/M
3300006176Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5EnvironmentalOpen in IMG/M
3300009645Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_40EnvironmentalOpen in IMG/M
3300009665Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_20_10EnvironmentalOpen in IMG/M
3300010341Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM2EnvironmentalOpen in IMG/M
3300010379Sb_50d combined assemblyEnvironmentalOpen in IMG/M
3300011120Combined assembly of Microbial Forest Soil metaTEnvironmentalOpen in IMG/M
3300014156Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin01_60_metaGEnvironmentalOpen in IMG/M
3300014160Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin01_30_metaGEnvironmentalOpen in IMG/M
3300014161Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin10_30_metaGEnvironmentalOpen in IMG/M
3300014162Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin23_30_metaGEnvironmentalOpen in IMG/M
3300014164Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin11_30_metaGEnvironmentalOpen in IMG/M
3300014167Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin10_10_metaGEnvironmentalOpen in IMG/M
3300014168Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin17_10_metaGEnvironmentalOpen in IMG/M
3300014169Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin11_10_metaGEnvironmentalOpen in IMG/M
3300014199Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin17_30_metaGEnvironmentalOpen in IMG/M
3300014200Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin06_30_metaGEnvironmentalOpen in IMG/M
3300014489Permafrost microbial communities from Stordalen Mire, Sweden - 812P2M metaGEnvironmentalOpen in IMG/M
3300014491Permafrost microbial communities from Stordalen Mire, Sweden - 612S2D metaGEnvironmentalOpen in IMG/M
3300014492Permafrost microbial communities from Stordalen Mire, Sweden - 612S2M metaGEnvironmentalOpen in IMG/M
3300014493Permafrost microbial communities from Stordalen Mire, Sweden - 712S2M metaGEnvironmentalOpen in IMG/M
3300014498Permafrost microbial communities from Stordalen Mire, Sweden - 812E2M metaGEnvironmentalOpen in IMG/M
3300014499Permafrost microbial communities from Stordalen Mire, Sweden - 612S2S metaGEnvironmentalOpen in IMG/M
3300014501Permafrost microbial communities from Stordalen Mire, Sweden - P3-2 metaG (Illumina Assembly)EnvironmentalOpen in IMG/M
3300014657Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_10_metaGEnvironmentalOpen in IMG/M
3300014658Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin02_10_metaGEnvironmentalOpen in IMG/M
3300014839Permafrost microbial communities from Stordalen Mire, Sweden - 712E1D metaG (Illumina Assembly)EnvironmentalOpen in IMG/M
3300016705Metatranscriptome of peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin06_30_metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300016750Metatranscriptome of peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_30_metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300017935Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_4_40EnvironmentalOpen in IMG/M
3300017946Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_19_10EnvironmentalOpen in IMG/M
3300017948Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_4_10EnvironmentalOpen in IMG/M
3300017988Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin02_30_metaGEnvironmentalOpen in IMG/M
3300018006Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_4EnvironmentalOpen in IMG/M
3300018033Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_13_10EnvironmentalOpen in IMG/M
3300018038Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_10EnvironmentalOpen in IMG/M
3300018040Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_10_150EnvironmentalOpen in IMG/M
3300018042Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_16_10EnvironmentalOpen in IMG/M
3300018043Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_7_10EnvironmentalOpen in IMG/M
3300019242Metatranscriptome of peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin02_10_metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300019256Metatranscriptome of peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin10_10_metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300019258Metatranscriptome of peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_10_metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300019270Metatranscriptome of peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin17_10_metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300022881Peat soil microbial communities from Stordalen Mire, Sweden - 717 P1 20-24EnvironmentalOpen in IMG/M
3300023101Peat soil microbial communities from Stordalen Mire, Sweden - 717 S3 10-14EnvironmentalOpen in IMG/M
3300027854Peat soil microbial communities from Weissenstadt, Germany - SII-2010 (SPAdes)EnvironmentalOpen in IMG/M
3300027879Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 4 (SPAdes)EnvironmentalOpen in IMG/M
3300028780Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E3_2EnvironmentalOpen in IMG/M
3300029907I_Bog_N1 coassemblyEnvironmentalOpen in IMG/M
3300029911III_Bog_N2 coassemblyEnvironmentalOpen in IMG/M
3300029943I_Palsa_N3 coassemblyEnvironmentalOpen in IMG/M
3300029986Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Bog_E2_1EnvironmentalOpen in IMG/M
3300031234Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_2EnvironmentalOpen in IMG/M
3300031236Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_1EnvironmentalOpen in IMG/M
3300031249Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaGHost-AssociatedOpen in IMG/M
3300031250Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaGHost-AssociatedOpen in IMG/M
3300031344Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaGHost-AssociatedOpen in IMG/M
3300031524Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Bog_T0_3EnvironmentalOpen in IMG/M
3300031525Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_3EnvironmentalOpen in IMG/M
3300031595Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaGHost-AssociatedOpen in IMG/M
3300031788Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Bog_T0_2EnvironmentalOpen in IMG/M
3300031902Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Fen_T0_2EnvironmentalOpen in IMG/M
3300032160Sb_50d combined assembly (MetaSPAdes)EnvironmentalOpen in IMG/M
3300032805Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.2EnvironmentalOpen in IMG/M
3300032828Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.4EnvironmentalOpen in IMG/M
3300032895Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.3EnvironmentalOpen in IMG/M
3300032898Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.1EnvironmentalOpen in IMG/M
3300033402Lab enriched peat soil microbial communities from McLean, Ithaca, NY, United States - MB31MNEnvironmentalOpen in IMG/M
3300033405Lab enriched peat soil microbial communities from McLean, Ithaca, NY, United States - MB29MYEnvironmentalOpen in IMG/M
3300033887Peat soil microbial communities from Stordalen Mire, Sweden - 713 P-1-X1EnvironmentalOpen in IMG/M
3300034065Peat soil microbial communities from Stordalen Mire, Sweden - 714 S1 1-5EnvironmentalOpen in IMG/M
3300034282Peat soil microbial communities from wetlands in Alaska, United States - Eight_mile_03D_16EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
Ga0062386_10083384113300004152Bog Forest SoilMENLNWLFWGYAAGWLLIFVYLLGIAQKERGLRKKIAELQETIEERWKKK*
Ga0068852_10253913823300005616Corn RhizosphereMENLNWLFWGYAAGWLLIFAYLFWTAQKERSLRRKIAELQESMEERWKKK*
Ga0070764_1070163023300005712SoilMENLSWLFWGYAAAWLLIFGYLLWISQKERSLRRKVSELQEAMDERWKQKKA*
Ga0075017_10147827423300006059WatershedsMENLNWLFWGYAAGFLLIFGYLFWIAQKERTLRKKILDLQETVEDRWKKK*
Ga0070765_10186344523300006176SoilMENLSWLFWGYAAAWLLMFGYLFWISQKERTLRRKVSELQEAMDERWKQKKA*
Ga0116106_126042213300009645PeatlandMENLNWLFWGYAAGWLLIFGYLFSISQKERTLHKKIAELQETMEERWKQKK
Ga0116135_104446233300009665PeatlandMVDPNLSWLFWGYAAGWLLIFGYLFSIARKERTLRKKVSELQEAIEERWKQKKA*
Ga0074045_1095001223300010341Bog Forest SoilMENLSWLFWGYAAGWLLIFAFLFRISRKELTLRRKISELQETIEERWKQKKV*
Ga0136449_10015503153300010379Peatlands SoilMENLNWLFWAYAAGWLLIFAFLFRISWKERALRRKISELQETIEDRWKQKQA*
Ga0136449_10170038023300010379Peatlands SoilMENLNWLFWGYAAGWLIIFAFLFRISQKERTLRKKISELQETIEDRWKQKKA*
Ga0136449_10192302523300010379Peatlands SoilMVDPNLSWLFWGYAAGWLLIFGYLFSIAQKERTLRKKVSELQEAIEERWKQKKA*
Ga0136449_10255598423300010379Peatlands SoilMENLNWLFWGYAAGWLLIFGYLLGIAQKERGLRKKISELQETIEERWKKK*
Ga0136449_10410745623300010379Peatlands SoilMENLSWLFWAYAAGWLLIFAFLFRSSRKELILRRKISELQETIEERWKQKKV*
Ga0150983_1165506023300011120Forest SoilMENLSWLFWGYAAGWLLIFGYLFRISQKERTLRKKISELQETIEDRWKQKQA*
Ga0181518_1049072423300014156BogMDPNLNWLFWGYAAGWLLIFGYLFGISAKERRLRRKVSELQEAMEERWRQKKA*
Ga0181517_1017186123300014160BogMENLSWLFWGYAAGWLLIFAYLFAIARKERGLRKKIAELQEAIDDRWKKQ*
Ga0181517_1020409033300014160BogMENLNWLFWGYAAGWALIFGYLFLIAQKERSLRKKISELEETIE
Ga0181529_1009733713300014161BogMENLNWLFWGYAAGWALIFGYLFLIAQKERSLRKKISELEETIEERWKRR*
Ga0181529_1051956913300014161BogMENLSWLFWGYAAGWLLIFGYLFSIARKERGLRKKISELQEAIDDRWKKK*
Ga0181529_1057323123300014161BogMENLNWLFWGYAAGWLLIFGYLFLIAQKERGLRKKIAELQETIEERWKKK*
Ga0181538_1070649923300014162BogMENLNWLFWGYAAGWLLIFGYLFLIARKERGLRKKISELEETIEERWKKK*
Ga0181532_1005412523300014164BogMENLNWLFWGYAAGWLLIFGYLFSISQKERTLRKKIAELQETMEERWKQKKS*
Ga0181532_1018436833300014164BogMIDPNLSWLFWGYAAGWLLIFGYLFWIAQKERTLRKKVAGLQEAIEERRKQKKT*
Ga0181532_1054555813300014164BogMVDPNLSWLFWGYAAGWLLIFGYLFWIAQKERTLRKKVSELQEAIEERWKQKKA*
Ga0181528_1004959423300014167BogMENLNWLFWGYAAGWALIFGYLFLIARKERGLRKKISELEETIEERWKKK*
Ga0181528_1009222823300014167BogMDKQLGFLLWGYAAGWLLIFGYLFLISQKERGLRKKIAELQEAMEDRWKQKKA*
Ga0181528_1015448923300014167BogMENLSWLFWGYAAAWAVIFVYLFRLSRKERDLRRKISELQEAMEDRWKQKKA*
Ga0181528_1039578113300014167BogMENLSWLFWGYAVAWLLIFGYLFRISQKESTLRKKVSELQETIEDRWKQKRA*
Ga0181534_1005986123300014168BogMENLNWLFWGYAAGWAIVFGYLFLIARKERGLRKKISELEETIEERWKKK*
Ga0181534_1016109333300014168BogMVDPNLSWLFWGYAAGWLLIFGYLFWIAQKERSLRKKVSELRDAMEERWKQKKA*
Ga0181531_1012862723300014169BogMEKQLGFLLWGYAAGWLLIFGYLFWIAQKERGLRRKIAELHEEMEERWKQKKA*
Ga0181531_1057715723300014169BogMDKQLGFLLWGYAAGWLLIFGYLFWIASKERGLRKKIAELQDAMKERWKQ
Ga0181535_1021152313300014199BogMENLSWLFWGYAAGWLLIFGYLFSISQKERTLRKKIAELQEAMEEHWKQKKA*
Ga0181526_1021331323300014200BogMENLNWLFWGYAAGWLLIFGYLFSISQKERTLRKKIAELQETMEERWKQKKA*
Ga0182018_10000065583300014489PalsaMVDPNLSWLFWGYAAGWLLIFGYLFWIAQKERTLRKKVSELRDAMEERWKQKKA*
Ga0182018_1000806023300014489PalsaMENLSWLFWAYAAGWLIVFGYLFSISQKERTLRKKISELQETIEDRWKQKKA*
Ga0182014_1006272623300014491BogMENLNWLFWGYTAGWLIVFAYLFRISQKERTLRKKISELQETIEDRWKQKKA*
Ga0182014_1045565023300014491BogMENLSWLFWGYAVAWLLIFGYLFWIAQKERTLRRKIAELQETIEDRWKQKKG*
Ga0182013_1003044253300014492BogMDPQLSFLFWGYTVGWLLIFGYLFWISQKERSLRKKVSELQEAMEERWKQKKA*
Ga0182013_1004477333300014492BogMENLSWLFWGYAAAWAVIFVYLFRLSQKERALRRKISELQEAMEDRWKQKKA*
Ga0182013_1030649323300014492BogMQNLSWLFWGYAAGWLLIFVYLFAIAQKERGLRKKIAELQEAIDDRWKKK*
Ga0182016_1049723123300014493BogGYAAGWLLIFVYLFAIAQKERGLRKKIAELQEAIDDRWKKK*
Ga0182019_1121299413300014498FenMVDPNLSWLFWGYAAGWLLIFGYLFRIAQKERTLRRKVAELQDAIEERWKQKKA*
Ga0182019_1140481813300014498FenMDKQLGYLLWGYAAGWLLIFGYLFWISAKERTLRKKISELQEAM
Ga0182012_1039174623300014499BogMDPQLSFLFWGYTVGWLLIFGYLFWISQKERSLRKKVSELQKAMEERWKQKKA*
Ga0182024_1125267323300014501PermafrostMENLSWLFWGYAAAWLLIFGYLFWISQKERTLRRKVSELQEAMDERWKQKKA*
Ga0182024_1188581823300014501PermafrostMENLSWLFWAYAAGWLLIFAFLFRISQKERTLRRKISELQEAIDDRWKQKKEVR*
Ga0181522_1026349823300014657BogMDKQLGFLLWGYAAGWLLIFGYLFWIASKERGLRKKIAELQDAMEERWKQKKA*
Ga0181522_1106178213300014657BogMENLNWLFWGYAAGWLLIFGYLFLIAQKERGLRKKIAELQEAMEDRWKQKKA*
Ga0181519_1019214323300014658BogFLFWGYTVGWLLIFGYLFWISQREQSLRKKVSELQEAIEERWKQKKA*
Ga0182027_1022454233300014839FenMENLSWLFWGYAAGWLLIFGYLFWISAKERTLRKKISELQEAMEERWKQKKA*
Ga0182027_1063096313300014839FenMKNLTWLFWGYAAGWLLIFGYLFLIARKERGLRRKISELQETIEERWKKK*
Ga0181507_123888223300016705PeatlandVMENLSWLFWGYAAGWLLIFAFLFRISRKELTLRRKISELQETIEERWKQKKV
Ga0181505_1083945223300016750PeatlandWGYAAGWLLIFGYLFWIAQKERTLRKKVSGLQEAIEERWKQKKA
Ga0181505_1119764523300016750PeatlandMVDPNLSWLFWGYAAGWLLIFGYLFGISAKERKLRRKVSELQEAMEERWKQKKA
Ga0187848_1044813023300017935PeatlandMENLNWLFWGYAAGWLLIFGYLFSISQKERTLRKKIAELQETMEERWKQKKS
Ga0187879_1033019613300017946PeatlandMVDPNLSWLFWGYAAGWLLIFGYLFWIAQKERTLRKKVAGLQEAIEERWKQKKA
Ga0187879_1071141313300017946PeatlandMENLNWLFWGYAAGWALIFGYLFLIARKERGLRKKISELEETIEERWKQ
Ga0187847_1021845223300017948PeatlandMVDPNLSWLFWGYAAGWLLIFGYLFSIARKERTLRKKVSELQEAIEERWKQKKA
Ga0187847_1033287013300017948PeatlandMENLNWLFWGYAAGWAIVFGYLFLIARKERGLRKKISELEETIEERWKKK
Ga0181520_1011113233300017988BogMENLSWLFWGYAAGWLLIFAYLFAIARKERGLRKKIAELQEAIDDRWKKQ
Ga0181520_1089155813300017988BogMENLSWLFWGYAAGWLLIFGYLFSISQKERTLRKKIAELQEAMEEHWKQKKA
Ga0181520_1098148623300017988BogMEKQLGFLLWGYAAGWLLIFGYLFWIAQKERGLRRKIAELHEEMEERWKQKKA
Ga0187804_1037458523300018006Freshwater SedimentMENLSWLFWAYAAGWLLIFAFLFRISRKELTLRRKISDLQETIEERWKQKKV
Ga0187867_1038288323300018033PeatlandMVDPNLSWLFWGYAAGWLLIFGYLFSIAQKERTLRKKVSELQEAIEERWKQKKA
Ga0187855_1085148723300018038PeatlandWGYAAAWLLIFGYLFSIAQKERTLRKKVSELQEAIEERWKQKKA
Ga0187862_1062300313300018040PeatlandMENLNWLFWGYAAGWALIFGYLFLIARKERGLRRKISELEETIEERWKKK
Ga0187862_1068137013300018040PeatlandMENLNWLFWGYAAGWLLIFGYLFSISQKERTLRKKIAELQETMEERWK
Ga0187871_1050619423300018042PeatlandMVDPNLSWLFWGYAAGWLLIFGYLFWISQKERGLRKRIAELQEAMEERWKQKKA
Ga0187871_1065118213300018042PeatlandMENLSWLFWGYAAGWLLIFAFLFRISRKELTLRRKISELQETIEERWKQKKV
Ga0187887_1056905723300018043PeatlandMENLSWLFWGYAAGWLLIFAYLFAIARKERGLRKKIAELQEAIDDRWKKK
Ga0181502_111355223300019242PeatlandMDPQLSFLFWGYTVGWLLIFGYLFWISQREQSLRKKVSELQEAIEERWKQKKA
Ga0181508_119123623300019256PeatlandMDKQLGFLLWGYAAGWLLIFGYLFLIARKERGLRKKISELQEAIEERWKKK
Ga0181504_117878623300019258PeatlandRFEAVLNVMENLSWLFWGYAAGWLLIFAFLFRISRKELTLRRKISELQETIEERWKQKKV
Ga0181504_124423613300019258PeatlandMDKQLGFLLWGYAAGWLLIFGYLFWIASKERGLRKKIAELQDAMEERWKQKKA
Ga0181512_130537513300019270PeatlandENLNWLFWGYAAGWAIVFGYLFLIARKERGLRKKISELEETIEERWKKK
Ga0224545_104395013300022881SoilMENLSWLFWAYAAGWLIVFGYLFSISQKERTLRKKISELQETIED
Ga0224557_102140213300023101SoilRDMENLNWLFWGYTAGWLIVFAYLFRISQKERTLRKKISELQETIEDRWKQKKA
Ga0209517_1044337923300027854Peatlands SoilMVDPNLSWLFWGYAAAWLLIFGYLFSIARKERTLRKKVSELQEAIEERWKQKKA
Ga0209169_1054462723300027879SoilMENLSWLFWGYAAAWLLIFGYLLWISQKERSLRRKVSELQEAMDERWKQKKA
Ga0302225_1034434623300028780PalsaFNYLLAGFVAGWALIFGYLFWIAQKERILRKKVSELQDAVEERWKQKKA
Ga0311329_1045802223300029907BogWGYTAGWLIVFAYLFRISQKERTLRKKISELQETIEDRWKQKKA
Ga0311361_1129613123300029911BogMENLSWLFWGYAAAWAVIFVYLFRLSQKERALRRKISELQEAMEDRWKQKKA
Ga0311340_1057193823300029943PalsaMENLSWLFWAYAAGWLLIFAFLFRISQKERTLRRKISELQEVIDDRWKQKKA
Ga0302188_1046552823300029986BogMENLNWLFWGYTAGWLIVFAYLFRISQKERTLRKKISELQETIEDRW
Ga0302325_1201151423300031234PalsaMDAQTTKQFNYLLAGFVAGWALIFGYLFWIAQKERILRKKVSERQDAVEE
Ga0302324_10029225143300031236PalsaMDAQTTKQFNYLLAGFVAGWALIFGYLFWIAQKERILRKKVSELQDAVEERWKQKKA
Ga0302324_10282673113300031236PalsaKQLGFLLWGYAAAWLLIFGYLFWIAQKERGLRKKIAELQEAMEDRWKQKKA
Ga0265339_1049591623300031249RhizosphereMDPQLSFLFWGYAIGWLLIFGYLFWIAQKEKTLRKKVAELQEAMEERWKQKKA
Ga0265331_1013063623300031250RhizosphereMDSQLSFLFWGYAAAWLLIFGYLFSIAQKEKTLRKKVSELQEAMEERWKQKKA
Ga0265316_1000995143300031344RhizosphereMENLSWLFWAYAAGWLLIFGYLFLIARKERGLRKKISELEETIEERWKRR
Ga0265316_1064308023300031344RhizosphereMVDPNLSWLFWGFAAGWLLIFGYLFSIAQKERTLRKKVSELQEAIEERWKQKKA
Ga0302320_1027981023300031524BogMQNLSWLFWGYAAGWLLIFVYLFAIAQKERGLRKKIAELQEAIDDRWKKK
Ga0302326_1028895343300031525PalsaMDAQTAKQFNYLLAGFVAGWALIFGYLFWIAQKERILRKKVSELQDAVEERWKQKKA
Ga0302326_1369329823300031525PalsaMDKQLGFLLWGYAAAWLLIFGYLFWISQKERGLRKKIAELQEAMEERWKQKKA
Ga0265313_1018768323300031595RhizosphereMVDPNLSWLFWGYAAGWLLIFGYLFSIARKERTLRRKVSELQEAMEVRWKQKKA
Ga0302319_1112009713300031788BogMENLNWLFYAFGLGWLVIFGYLFQISQKERKLRHRVAEL
Ga0302319_1156863013300031788BogMENLNWLFWGYAAGWLLIFGYLFLIARKERGLRKKISELQETIEERWKKK
Ga0302322_10395488223300031902FenMENLNWLFWGYAAGWLLMFGFLFRISQKERTLRRKISELQEAVEERWKKK
Ga0311301_1032895923300032160Peatlands SoilMENLNWLFWAYAAGWLLIFAFLFRISWKERALRRKISELQETIEDRWKQKQA
Ga0311301_1266951413300032160Peatlands SoilMENLNWLFWGYAAGWLLIFGYLLGIAQKERGLRKKISELQETIEERWKKK
Ga0335078_1003474753300032805SoilMVDPNLSWLFWGYAAGWLLIFAYLFSISRKERSLRRKVAELQEAMEERWKQKKA
Ga0335078_1078587723300032805SoilMENLSWLFWGYAGAWLLIFGYLFWIAAKERTLRRKISELQEAMEDRWKQKKA
Ga0335078_1104866823300032805SoilVIDPNLGWLFWGYAAGWLLIFAYLFHIGRKERTLRRKIAELQETMEERWKQKKA
Ga0335078_1179481213300032805SoilMENLSWLFWGYAAAWLLIFGYLFRIAHKEGTLRRKIAELEESVEDRWKQKKA
Ga0335080_1068844223300032828SoilMVDPNLSWLFWGYAAGWLLIFGYLFSISRKERSLRRKISELQEAIEERWKHKKA
Ga0335074_1024098223300032895SoilMVDPNLRWLFWGYAAGWLLIFGYLFFISRKESTLRRKVSELQEAMEERWKQKKA
Ga0335072_10001382223300032898SoilMVDPNLSWLFWGYAAGWLLIFGYLFFISRKESTLRRKISELQEAMEERWKQKKA
Ga0335072_1035142413300032898SoilMDPQLKFLFWGYAAAWLLIFGYLFWISQKERALRKKVSELQEAMEERWRQKKA
Ga0335072_1043755523300032898SoilMDPNLGWLFWGYAVGWLLIFGYLFSISRKEQTLRRKVSELQEAMEDRWKKKV
Ga0326728_10001850553300033402Peat SoilMENLSWLFWGYAAGWLLIFGYLFWISAKERTLRKKFSELQEAMEERWKQKKA
Ga0326727_1084892023300033405Peat SoilMDPNLNWLFWGYAAGWLLIFGYLFGISAKERRLRRKVSELQEAMEERWRQKKA
Ga0334790_035389_1856_20083300033887SoilMENLSWLFWGYAAGWLLIFGYLFWISAKERTLRKKISELQEAMEERWKQKK
Ga0334827_243570_27_1883300034065SoilMDPQLSFLFWGYTVGWLLIFGYLFWISQKERSLRKKVSELQEAMEERWKQKKA
Ga0370492_0080668_985_11373300034282Untreated Peat SoilMENLSWLFWGYAAGWLLIFGYLFLIAQKERGLRRKIAELQETIEERWKKK

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.