NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F080317

Metagenome / Metatranscriptome Family F080317

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F080317
Family Type Metagenome / Metatranscriptome
Number of Sequences 115
Average Sequence Length 40 residues
Representative Sequence LKKLPTWGVTIVPPVDEGEGPRLAPTAMLIDAVRPYVRRG
Number of Associated Samples 100
Number of Associated Scaffolds 115

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 0.87 %
% of genes near scaffold ends (potentially truncated) 99.13 %
% of genes from short scaffolds (< 2000 bps) 90.43 %
Associated GOLD sequencing projects 96
AlphaFold2 3D model prediction Yes
3D model pTM-score0.27

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (80.000 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil
(26.956 % of family members)
Environment Ontology (ENVO) Unclassified
(29.565 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(43.478 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 22.06%    β-sheet: 0.00%    Coil/Unstructured: 77.94%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  		pTM-score: 0.27
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 115 Family Scaffolds
PF028262-Hacid_dh_C 5.22
PF06283ThuA 3.48
PF02566OsmC 2.61
PF00378ECH_1 2.61
PF00296Bac_luciferase 2.61
PF03460NIR_SIR_ferr 2.61
PF00106adh_short 1.74
PF00756Esterase 1.74
PF07978NIPSNAP 1.74
PF16113ECH_2 1.74
PF13683rve_3 1.74
PF01266DAO 1.74
PF02148zf-UBP 1.74
PF030614HBT 1.74
PF04365BrnT_toxin 0.87
PF02624YcaO 0.87
PF12831FAD_oxidored 0.87
PF04392ABC_sub_bind 0.87
PF06186DUF992 0.87
PF01979Amidohydro_1 0.87
PF05598DUF772 0.87
PF12902Ferritin-like 0.87
PF01741MscL 0.87
PF05721PhyH 0.87
PF00578AhpC-TSA 0.87
PF01738DLH 0.87
PF02441Flavoprotein 0.87
PF01223Endonuclease_NS 0.87
PF01627Hpt 0.87
PF04966OprB 0.87
PF07733DNA_pol3_alpha 0.87
PF01593Amino_oxidase 0.87
PF03729DUF308 0.87
PF06750DiS_P_DiS 0.87
PF00043GST_C 0.87
PF02371Transposase_20 0.87
PF00211Guanylate_cyc 0.87
PF13403Hint_2 0.87
PF01048PNP_UDP_1 0.87
PF12146Hydrolase_4 0.87
PF02668TauD 0.87
PF02798GST_N 0.87
PF07995GSDH 0.87
PF04964Flp_Fap 0.87
PF07812TfuA 0.87
PF04909Amidohydro_2 0.87
PF02796HTH_7 0.87
PF01547SBP_bac_1 0.87
PF03966Trm112p 0.87
PF02738MoCoBD_1 0.87
PF07883Cupin_2 0.87
PF00881Nitroreductase 0.87
PF00743FMO-like 0.87
PF03466LysR_substrate 0.87
PF00126HTH_1 0.87
PF00561Abhydrolase_1 0.87

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 115 Family Scaffolds
COG4813Trehalose utilization proteinCarbohydrate transport and metabolism [G] 3.48
COG1764Organic hydroperoxide reductase OsmC/OhrADefense mechanisms [V] 2.61
COG1765Uncharacterized OsmC-related proteinGeneral function prediction only [R] 2.61
COG1989Prepilin signal peptidase PulO (type II secretory pathway) or related peptidaseCell motility [N] 2.61
COG2141Flavin-dependent oxidoreductase, luciferase family (includes alkanesulfonate monooxygenase SsuD and methylene tetrahydromethanopterin reductase)Coenzyme transport and metabolism [H] 2.61
COG5207Uncharacterized Zn-finger protein, UBP-typeGeneral function prediction only [R] 1.74
COG0435Glutathionyl-hydroquinone reductaseEnergy production and conversion [C] 0.87
COG0587DNA polymerase III, alpha subunitReplication, recombination and repair [L] 0.87
COG0625Glutathione S-transferasePosttranslational modification, protein turnover, chaperones [O] 0.87
COG0775Nucleoside phosphorylase/nucleosidase, includes 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase MtnN and futalosine hydrolase MqnBNucleotide transport and metabolism [F] 0.87
COG0813Purine-nucleoside phosphorylaseNucleotide transport and metabolism [F] 0.87
COG1864DNA/RNA endonuclease G, NUC1Nucleotide transport and metabolism [F] 0.87
COG1944Ribosomal protein S12 methylthiotransferase accessory factor YcaOTranslation, ribosomal structure and biogenesis [J] 0.87
COG1970Large-conductance mechanosensitive channelCell wall/membrane/envelope biogenesis [M] 0.87
COG2072Predicted flavoprotein CzcO associated with the cation diffusion facilitator CzcDInorganic ion transport and metabolism [P] 0.87
COG2114Adenylate cyclase, class 3Signal transduction mechanisms [T] 0.87
COG2133Glucose/arabinose dehydrogenase, beta-propeller foldCarbohydrate transport and metabolism [G] 0.87
COG2175Taurine dioxygenase, alpha-ketoglutarate-dependentSecondary metabolites biosynthesis, transport and catabolism [Q] 0.87
COG2176DNA polymerase III, alpha subunit (gram-positive type)Replication, recombination and repair [L] 0.87
COG2820Uridine phosphorylaseNucleotide transport and metabolism [F] 0.87
COG2929Ribonuclease BrnT, toxin component of the BrnT-BrnA toxin-antitoxin systemDefense mechanisms [V] 0.87
COG2984ABC-type uncharacterized transport system, periplasmic componentGeneral function prediction only [R] 0.87
COG3247Acid resistance membrane protein HdeD, DUF308 familyGeneral function prediction only [R] 0.87
COG3482Uncharacterized conserved proteinFunction unknown [S] 0.87
COG3547TransposaseMobilome: prophages, transposons [X] 0.87
COG3659Carbohydrate-selective porin OprBCell wall/membrane/envelope biogenesis [M] 0.87
COG3847Flp pilus assembly protein, pilin FlpExtracellular structures [W] 0.87
COG5285Ectoine hydroxylase-related dioxygenase, phytanoyl-CoA dioxygenase (PhyH) familySecondary metabolites biosynthesis, transport and catabolism [Q] 0.87

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms80.00 %
UnclassifiedrootN/A20.00 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300001686|C688J18823_11044603Not Available518Open in IMG/M
3300005177|Ga0066690_10942216All Organisms → cellular organisms → Bacteria548Open in IMG/M
3300005332|Ga0066388_104481389All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria711Open in IMG/M
3300005436|Ga0070713_101050264All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium787Open in IMG/M
3300005557|Ga0066704_10807788All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium583Open in IMG/M
3300005561|Ga0066699_10416694All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium961Open in IMG/M
3300005764|Ga0066903_101288469All Organisms → cellular organisms → Bacteria1364Open in IMG/M
3300005764|Ga0066903_108480151All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium524Open in IMG/M
3300006052|Ga0075029_101274586All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium515Open in IMG/M
3300006175|Ga0070712_100484361All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1035Open in IMG/M
3300006176|Ga0070765_101330169All Organisms → cellular organisms → Bacteria677Open in IMG/M
3300006176|Ga0070765_101373400All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria666Open in IMG/M
3300006893|Ga0073928_10592369All Organisms → cellular organisms → Bacteria784Open in IMG/M
3300007265|Ga0099794_10466250All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium663Open in IMG/M
3300009012|Ga0066710_101193255All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1179Open in IMG/M
3300009012|Ga0066710_104671486All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium512Open in IMG/M
3300009038|Ga0099829_10315518All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1283Open in IMG/M
3300009143|Ga0099792_11149682All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Kineosporiales → Kineosporiaceae → Kineococcus525Open in IMG/M
3300009650|Ga0105857_1084981All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales843Open in IMG/M
3300009826|Ga0123355_10441915All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → Acidocella → Acidocella aromatica1646Open in IMG/M
3300010376|Ga0126381_101819301Not Available879Open in IMG/M
3300010376|Ga0126381_103218951Not Available645Open in IMG/M
3300010379|Ga0136449_103328055All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium617Open in IMG/M
3300010379|Ga0136449_103991802All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae551Open in IMG/M
3300012096|Ga0137389_10115011All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales2159Open in IMG/M
3300012200|Ga0137382_11343428All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium503Open in IMG/M
3300012205|Ga0137362_10274630All Organisms → cellular organisms → Bacteria1457Open in IMG/M
3300012210|Ga0137378_10140919All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales2232Open in IMG/M
3300012361|Ga0137360_11465270All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium586Open in IMG/M
3300012362|Ga0137361_10217846All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales1731Open in IMG/M
3300012918|Ga0137396_10083986All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales2248Open in IMG/M
3300012923|Ga0137359_10225854All Organisms → cellular organisms → Bacteria1672Open in IMG/M
3300012923|Ga0137359_11736155All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium511Open in IMG/M
3300012927|Ga0137416_11704546All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium575Open in IMG/M
3300012944|Ga0137410_11562053All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Kineosporiales → Kineosporiaceae → Kineococcus577Open in IMG/M
3300012948|Ga0126375_11497372All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae576Open in IMG/M
3300014167|Ga0181528_10195334Not Available1093Open in IMG/M
3300014838|Ga0182030_11350169Not Available598Open in IMG/M
3300015054|Ga0137420_1498844All Organisms → cellular organisms → Bacteria1895Open in IMG/M
3300016270|Ga0182036_10147389All Organisms → cellular organisms → Bacteria1671Open in IMG/M
3300016319|Ga0182033_10112997All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium2024Open in IMG/M
3300016319|Ga0182033_11818234All Organisms → cellular organisms → Bacteria553Open in IMG/M
3300016357|Ga0182032_10683757All Organisms → cellular organisms → Bacteria860Open in IMG/M
3300016422|Ga0182039_12274891All Organisms → cellular organisms → Bacteria500Open in IMG/M
3300016445|Ga0182038_10036713All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria3147Open in IMG/M
3300017933|Ga0187801_10431999Not Available551Open in IMG/M
3300017975|Ga0187782_10576399All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium864Open in IMG/M
3300018034|Ga0187863_10225284All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1043Open in IMG/M
3300018476|Ga0190274_11867818All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium696Open in IMG/M
3300020068|Ga0184649_1064188Not Available506Open in IMG/M
3300020199|Ga0179592_10457549Not Available551Open in IMG/M
3300020579|Ga0210407_10742248All Organisms → cellular organisms → Bacteria → Proteobacteria760Open in IMG/M
3300020580|Ga0210403_10129388All Organisms → cellular organisms → Bacteria2058Open in IMG/M
3300020583|Ga0210401_10614690All Organisms → cellular organisms → Bacteria → Proteobacteria948Open in IMG/M
3300021138|Ga0214164_1035381All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae1207Open in IMG/M
3300021170|Ga0210400_10180754All Organisms → cellular organisms → Bacteria1710Open in IMG/M
3300021171|Ga0210405_10173144All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales1710Open in IMG/M
3300021181|Ga0210388_11142923Not Available663Open in IMG/M
3300021384|Ga0213876_10489830Not Available654Open in IMG/M
3300021405|Ga0210387_10172948All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales1861Open in IMG/M
3300021420|Ga0210394_10565568Not Available1000Open in IMG/M
3300022726|Ga0242654_10312358All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria581Open in IMG/M
3300024288|Ga0179589_10579023All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria525Open in IMG/M
3300025928|Ga0207700_10802031All Organisms → cellular organisms → Bacteria842Open in IMG/M
3300025938|Ga0207704_11694019Not Available543Open in IMG/M
3300026325|Ga0209152_10036628All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1692Open in IMG/M
3300026332|Ga0209803_1163175All Organisms → cellular organisms → Bacteria → Proteobacteria851Open in IMG/M
3300026498|Ga0257156_1096685Not Available614Open in IMG/M
3300027512|Ga0209179_1016323All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae1392Open in IMG/M
3300027737|Ga0209038_10142515All Organisms → cellular organisms → Bacteria726Open in IMG/M
3300027882|Ga0209590_10360451All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium937Open in IMG/M
3300027911|Ga0209698_10113189All Organisms → cellular organisms → Bacteria2257Open in IMG/M
3300028906|Ga0308309_11372585All Organisms → cellular organisms → Bacteria606Open in IMG/M
3300029945|Ga0311330_11206645All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales547Open in IMG/M
3300030225|Ga0302196_10423177All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria569Open in IMG/M
3300030943|Ga0311366_10606535All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales952Open in IMG/M
3300031234|Ga0302325_11131500All Organisms → cellular organisms → Bacteria → Proteobacteria1051Open in IMG/M
3300031446|Ga0170820_13160803Not Available660Open in IMG/M
3300031543|Ga0318516_10298865All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium URHD0017930Open in IMG/M
3300031543|Ga0318516_10479414All Organisms → cellular organisms → Bacteria715Open in IMG/M
3300031544|Ga0318534_10267994All Organisms → cellular organisms → Bacteria984Open in IMG/M
3300031561|Ga0318528_10360791All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium780Open in IMG/M
3300031708|Ga0310686_101475912All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → Acidisphaera → unclassified Acidisphaera → Acidisphaera sp. S103807Open in IMG/M
3300031736|Ga0318501_10648056All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium581Open in IMG/M
3300031744|Ga0306918_10699325Not Available793Open in IMG/M
3300031753|Ga0307477_10431937All Organisms → cellular organisms → Bacteria → Proteobacteria900Open in IMG/M
3300031753|Ga0307477_10728679All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium URHD0017662Open in IMG/M
3300031754|Ga0307475_11501770All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium517Open in IMG/M
3300031792|Ga0318529_10338702Not Available700Open in IMG/M
3300031796|Ga0318576_10062493All Organisms → cellular organisms → Bacteria1639Open in IMG/M
3300031845|Ga0318511_10378820All Organisms → cellular organisms → Bacteria647Open in IMG/M
3300031880|Ga0318544_10427652All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria515Open in IMG/M
3300031897|Ga0318520_10697616Not Available634Open in IMG/M
3300031918|Ga0311367_12356773All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales508Open in IMG/M
3300031946|Ga0310910_10052199All Organisms → cellular organisms → Bacteria2887Open in IMG/M
3300031947|Ga0310909_10749747All Organisms → cellular organisms → Bacteria809Open in IMG/M
3300031954|Ga0306926_10056351All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria4716Open in IMG/M
3300031954|Ga0306926_11563458All Organisms → cellular organisms → Bacteria758Open in IMG/M
3300031954|Ga0306926_11696472All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria721Open in IMG/M
3300032001|Ga0306922_12412218Not Available502Open in IMG/M
3300032009|Ga0318563_10628477All Organisms → cellular organisms → Bacteria → Proteobacteria578Open in IMG/M
3300032035|Ga0310911_10002455All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales7552Open in IMG/M
3300032035|Ga0310911_10612488All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium632Open in IMG/M
3300032041|Ga0318549_10074001All Organisms → cellular organisms → Bacteria1450Open in IMG/M
3300032059|Ga0318533_10836526All Organisms → cellular organisms → Bacteria675Open in IMG/M
3300032059|Ga0318533_10953475All Organisms → cellular organisms → Bacteria629Open in IMG/M
3300032059|Ga0318533_11174679Not Available562Open in IMG/M
3300032076|Ga0306924_10207214All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium2251Open in IMG/M
3300032076|Ga0306924_10990543All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium923Open in IMG/M
3300032090|Ga0318518_10267605Not Available877Open in IMG/M
3300032091|Ga0318577_10174015All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1028Open in IMG/M
3300032898|Ga0335072_10918995Not Available816Open in IMG/M
3300032954|Ga0335083_10564800Not Available943Open in IMG/M
3300033134|Ga0335073_10666916Not Available1145Open in IMG/M
3300033158|Ga0335077_11385094All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium679Open in IMG/M


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil26.96%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil16.52%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil11.30%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil4.35%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil3.48%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil2.61%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil2.61%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil2.61%
SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Soil2.61%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere2.61%
WatershedsEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds1.74%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil1.74%
Peatlands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil1.74%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil1.74%
FenEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Fen1.74%
BogEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Bog1.74%
Groundwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment0.87%
FreshwaterEnvironmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater0.87%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Peatland0.87%
Bog Forest SoilEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil0.87%
BogEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog0.87%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment0.87%
Iron-Sulfur Acid SpringEnvironmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring0.87%
Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil0.87%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland0.87%
Permafrost SoilEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost Soil0.87%
BogEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Bog0.87%
SoilEnvironmental → Terrestrial → Soil → Loam → Grasslands → Soil0.87%
PalsaEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa0.87%
Termite GutHost-Associated → Arthropoda → Digestive System → Gut → Unclassified → Termite Gut0.87%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere0.87%
Plant RootsHost-Associated → Plants → Roots → Unclassified → Unclassified → Plant Roots0.87%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300001686Grasslands soil microbial communities from Hopland, California, USAEnvironmentalOpen in IMG/M
3300005177Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_139EnvironmentalOpen in IMG/M
3300005332Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300005436Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaGEnvironmentalOpen in IMG/M
3300005557Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_153EnvironmentalOpen in IMG/M
3300005561Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148EnvironmentalOpen in IMG/M
3300005764Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)EnvironmentalOpen in IMG/M
3300006052Freshwater sediment microbial communities from North America - Little Laurel Run_MetaG_LLR_2013EnvironmentalOpen in IMG/M
3300006175Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaGEnvironmentalOpen in IMG/M
3300006176Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5EnvironmentalOpen in IMG/M
3300006893Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPA 5.5 metaGEnvironmentalOpen in IMG/M
3300007265Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1EnvironmentalOpen in IMG/M
3300009012Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159EnvironmentalOpen in IMG/M
3300009038Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaGEnvironmentalOpen in IMG/M
3300009143Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2EnvironmentalOpen in IMG/M
3300009650Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil DNA_2013-061EnvironmentalOpen in IMG/M
3300009826Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1Host-AssociatedOpen in IMG/M
3300010376Tropical forest soil microbial communities from Panama - MetaG Plot_28EnvironmentalOpen in IMG/M
3300010379Sb_50d combined assemblyEnvironmentalOpen in IMG/M
3300012096Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaGEnvironmentalOpen in IMG/M
3300012200Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaGEnvironmentalOpen in IMG/M
3300012205Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaGEnvironmentalOpen in IMG/M
3300012210Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaGEnvironmentalOpen in IMG/M
3300012361Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaGEnvironmentalOpen in IMG/M
3300012362Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaGEnvironmentalOpen in IMG/M
3300012918Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaGEnvironmentalOpen in IMG/M
3300012923Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaGEnvironmentalOpen in IMG/M
3300012927Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012944Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012948Tropical forest soil microbial communities from Panama - MetaG Plot_14EnvironmentalOpen in IMG/M
3300014167Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin10_10_metaGEnvironmentalOpen in IMG/M
3300014838Permafrost microbial communities from Stordalen Mire, Sweden - 812S3M metaG (Illumina Assembly)EnvironmentalOpen in IMG/M
3300015054Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (PacBio error correction)EnvironmentalOpen in IMG/M
3300016270Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080EnvironmentalOpen in IMG/M
3300016319Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00HEnvironmentalOpen in IMG/M
3300016357Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000EnvironmentalOpen in IMG/M
3300016422Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111EnvironmentalOpen in IMG/M
3300016445Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108EnvironmentalOpen in IMG/M
3300017933Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_1EnvironmentalOpen in IMG/M
3300017975Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP15_20_MGEnvironmentalOpen in IMG/M
3300018034Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_11_10EnvironmentalOpen in IMG/M
3300018476Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 531 TEnvironmentalOpen in IMG/M
3300020068Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_65 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300020199Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300020579Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-MEnvironmentalOpen in IMG/M
3300020580Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-MEnvironmentalOpen in IMG/M
3300020583Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-MEnvironmentalOpen in IMG/M
3300021138Freshwater microbial communities from Trout Bog Lake, WI - Practice 03JUN2009 epilimnionEnvironmentalOpen in IMG/M
3300021170Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-MEnvironmentalOpen in IMG/M
3300021171Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-MEnvironmentalOpen in IMG/M
3300021181Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-OEnvironmentalOpen in IMG/M
3300021384Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9Host-AssociatedOpen in IMG/M
3300021405Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-OEnvironmentalOpen in IMG/M
3300021420Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-MEnvironmentalOpen in IMG/M
3300022726Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-30-M (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300024288Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_08_16fungalEnvironmentalOpen in IMG/M
3300025928Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025938Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026325Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107 (SPAdes)EnvironmentalOpen in IMG/M
3300026332Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_138 (SPAdes)EnvironmentalOpen in IMG/M
3300026498Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NI-49-AEnvironmentalOpen in IMG/M
3300027512Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes)EnvironmentalOpen in IMG/M
3300027737Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP03_OM3 (SPAdes)EnvironmentalOpen in IMG/M
3300027882Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300027911Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 (SPAdes)EnvironmentalOpen in IMG/M
3300028906Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2)EnvironmentalOpen in IMG/M
3300029945I_Bog_N2 coassemblyEnvironmentalOpen in IMG/M
3300030225Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Bog_N1_3EnvironmentalOpen in IMG/M
3300030943III_Fen_N2 coassemblyEnvironmentalOpen in IMG/M
3300031234Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_2EnvironmentalOpen in IMG/M
3300031446Fir Summer Coassembly Site 11 - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031543Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f20EnvironmentalOpen in IMG/M
3300031544Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f26EnvironmentalOpen in IMG/M
3300031561Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f26EnvironmentalOpen in IMG/M
3300031708FICUS49499 Metagenome Czech Republic combined assemblyEnvironmentalOpen in IMG/M
3300031736Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f21EnvironmentalOpen in IMG/M
3300031744Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H (v2)EnvironmentalOpen in IMG/M
3300031753Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_515EnvironmentalOpen in IMG/M
3300031754Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515EnvironmentalOpen in IMG/M
3300031792Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f23EnvironmentalOpen in IMG/M
3300031796Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f24EnvironmentalOpen in IMG/M
3300031845Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f18EnvironmentalOpen in IMG/M
3300031880Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f25EnvironmentalOpen in IMG/M
3300031897Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f16EnvironmentalOpen in IMG/M
3300031918III_Fen_N3 coassemblyEnvironmentalOpen in IMG/M
3300031946Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF172EnvironmentalOpen in IMG/M
3300031947Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.T000HEnvironmentalOpen in IMG/M
3300031954Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2)EnvironmentalOpen in IMG/M
3300032001Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2)EnvironmentalOpen in IMG/M
3300032009Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f19EnvironmentalOpen in IMG/M
3300032035Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF170EnvironmentalOpen in IMG/M
3300032041Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f22EnvironmentalOpen in IMG/M
3300032059Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f27EnvironmentalOpen in IMG/M
3300032076Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2)EnvironmentalOpen in IMG/M
3300032090Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f22EnvironmentalOpen in IMG/M
3300032091Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f25EnvironmentalOpen in IMG/M
3300032898Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.1EnvironmentalOpen in IMG/M
3300032954Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.2EnvironmentalOpen in IMG/M
3300033134Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.2EnvironmentalOpen in IMG/M
3300033158Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.1EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
C688J18823_1104460323300001686SoilGWRVTIVPPVDEGEGPRLAPTEQLLNAVRPYVRPA*
Ga0066690_1094221613300005177SoilPEAQASLTKLRRWGVAIVPPVDEGEGPRLAPSTVLIDAVRHYVRRG*
Ga0066388_10448138913300005332Tropical Forest SoilSLKTLPSWGVTVIPPVDEGEGPRLAPSAVLLDAVRPFVRRG*
Ga0070713_10105026433300005436Corn, Switchgrass And Miscanthus RhizosphereARASLRKLPTWGVTIVPPVDEGEGPRLAPSELLINAVRPHVRQS*
Ga0066704_1080778813300005557SoilRLPEWGVRIVPPVDEGEGPRLAPTATLLDAVRPFVQHS*
Ga0066699_1041669423300005561SoilQVSLRKLPAWHVTVVPPVDEGEGPRLAPSELLLDAVRPYVRRG*
Ga0066903_10128846923300005764Tropical Forest SoilLKKLPTWGVTIVPPVDEGEGPRLAPTAMLIDAVRPYVRRG*
Ga0066903_10848015123300005764Tropical Forest SoilLLPRWGVVIVPPVDEGEGPRLAPTEALLAAVRPYMKRR*
Ga0075029_10127458613300006052WatershedsHVTVVPPVDEGEGPRLAPTAQLLDAAGQYIRRGS*
Ga0070712_10048436113300006175Corn, Switchgrass And Miscanthus RhizosphereKLPGWGVRIVPPVDAGDGPRLAPTKVLLDAVRRYAHRS*
Ga0070765_10133016913300006176SoilKKLPAWGVAIVPPVDEGEGPRLAPSAVLVEAVRPYVRRG*
Ga0070765_10137340013300006176SoilGSLRRLPNWGVTIVPPVDDGAGPRLAPTQQLMDAVRPFVRRP*
Ga0073928_1059236913300006893Iron-Sulfur Acid SpringTWGVTIVPQVNQGEGPRLAPSAQLLDAVRPYARRS*
Ga0099794_1046625013300007265Vadose Zone SoilQASLKQLTSWGVTIVPPVDEGEGPRLAPTGVLIDAVRPYVRRD*
Ga0066710_10119325533300009012Grasslands SoilLLGWGVRIVPPVDEGEGPRLASTAVLLDAVRLYVRRG
Ga0066710_10467148623300009012Grasslands SoilQAQASLKTLPKWGVTIVPQIDAGEGPRLAPTETLLVALRPHVKRG
Ga0099829_1031551813300009038Vadose Zone SoilLPTWHVTIVPPVDEGEGPRLAPSAQLLDAVRPYVRRG*
Ga0099792_1114968213300009143Vadose Zone SoilSWGVTIVAPVDDGEGPRLAPSVVLLDAVRRFVRRG*
Ga0105857_108498113300009650Permafrost SoilAAWGVAIVPPADEAEGPRLAASARLLDAVRPYASKQK*
Ga0123355_1044191513300009826Termite GutSLRALPGWGVTIVPPVDAGEGPRLAPTKQLLNAVRPYVRTR*
Ga0126381_10181930113300010376Tropical Forest SoilAEWGVHLVPPVDAGEGPRLAPTTALLDAVRPHVRSGG*
Ga0126381_10321895113300010376Tropical Forest SoilWGVTIVPPVDEGEGPRLARSALLLDVVRRHVRLG*
Ga0136449_10332805513300010379Peatlands SoilQVSLRTLQAWQVMIVPPVDDGEGPRLAPSAQLLDAVRPYVVQS*
Ga0136449_10399180213300010379Peatlands SoilLRTLPGWGVTVVPPVDEGEGPRLAPTAQVLDAVRPFVRRG*
Ga0137389_1011501173300012096Vadose Zone SoilLSWGVRIVPPVDEGEGPRLAPSAQLLDAVRPYVRRG*
Ga0137382_1134342813300012200Vadose Zone SoilSWGVTIVPPVDEGEGPRLAPTGVLIDAVRPYVRRG*
Ga0137362_1027463013300012205Vadose Zone SoilLPVWGVIIVPPVDEGEGPRLAPTAVLIDAVRPYVR
Ga0137378_1014091913300012210Vadose Zone SoilKLPTWGVTIVPPVDDGDGPRLAASAVLVDAVRPYVRRG*
Ga0137360_1146527023300012361Vadose Zone SoilPEAQTSLERLPRWGVTIVPPVDEGEGPRLAPTAQLLDAVRPYTRRR*
Ga0137361_1021784613300012362Vadose Zone SoilLPVWGVIIVPPVDEGEGPRLAPTAVLIDAVRPYVRRR
Ga0137396_1008398613300012918Vadose Zone SoilTLPGWGVIIVPPVDEGEGPRLAPTAALIDTVRPYVRRR*
Ga0137359_1022585413300012923Vadose Zone SoilQASLRTLPTWGVTIVPPIYEGEGPRLAPTAVLIDAVRPYVRG*
Ga0137359_1173615523300012923Vadose Zone SoilASLKKLPEWGVIMVPPVDEGEGPRLAPTAALIDAVRPYVRRG*
Ga0137416_1170454623300012927Vadose Zone SoilSLRRLPEWGVRIVPPVDEGEGPRLAPTATLLDAVRPFVQHS*
Ga0137410_1156205313300012944Vadose Zone SoilSWGVTIVAPVDDGEGPRLAPSAVLLDAVRPYVRRG*
Ga0126375_1149737213300012948Tropical Forest SoilEKLSRWGVVIVGPVDDGEGPRLAPTAALLDAVRLYVR*
Ga0181528_1019533423300014167BogRTLPAWGVTIVPPVDLGDGPRLAPTEALLDAARPFVRAQG*
Ga0182030_1135016913300014838BogSLRTLSNWKVTIVPPVDAGEGPRLAPTTKLLDAARPHVRRA*
Ga0137420_149884443300015054Vadose Zone SoilLPGWGIRIVPQVDQGEGPRLAPTEALLDAVRPYVRRG*
Ga0182036_1014738923300016270SoilVAQASLKTLPSWGVVIVPPVDEGEGPRLAPSAMLLDAVRPFVDRA
Ga0182033_1011299733300016319SoilERLPSWGVTIVPPVDEGEGPRLAPTAVLIDAVRPYVRRS
Ga0182033_1181823413300016319SoilTLPSWGATIVPPVDDGEGPRLAPTGVLLGAVRPHAGRG
Ga0182032_1068375723300016357SoilSWGATIVPPVDDGEGPRLAPTGVLLGAVRPPAGRG
Ga0182039_1227489123300016422SoilLPTWGVTIIPPVDEGEGPRLAPTAVLVDAVRPYVRRG
Ga0182038_1003671353300016445SoilERLPSWGVTIVPPVDEDEGPRLAPTAVLVDAVRPYVRHS
Ga0187801_1043199913300017933Freshwater SedimentLPAWGVTIVPPVDEGEGPRLAATATLLDAVRPYVRRG
Ga0187782_1057639923300017975Tropical PeatlandLPQWGVTIVPPVDFGEGPRLAPTEDLLASLRPYVRLQKTAAIG
Ga0187863_1022528413300018034PeatlandVAQASLKRLPTWNVIVVPPVDDGEGPRLAPNERLLDAVRPFVRHG
Ga0190274_1186781823300018476SoilWGVTIVPPVDEGQGPRLAPTEALLTEVRPHLRRQPGVPS
Ga0184649_106418813300020068Groundwater SedimentLQRLPNWGVTIVPPVDEGEGPRLAPTDQLIDAVRPYVAGR
Ga0179592_1045754923300020199Vadose Zone SoilQGSLRKLPGWGIRIVPQVDQGEGPRLAPTEALLDAVRPYVRRG
Ga0210407_1074224813300020579SoilAQASLKTLPSWGVVIVPPVDEGEGPRLAPSAVLLDVVRPFVRRG
Ga0210403_1012938833300020580SoilPPEARASLKKLRAWGVTIVAPVDEGEGPRLAPSAVLVDAARPHVRRG
Ga0210401_1061469013300020583SoilKLPAWGVAIVPPVDEGEGPRLAPSAVLVEAVRPYVRRG
Ga0214164_103538113300021138FreshwaterSLATLASWGVVVVPQVNAGDGPRLAPAEHLLDAVRPFAG
Ga0210400_1018075413300021170SoilASLRLLPEWGVTIVPPVDEGEGPRLAPSALLLDAVRPYARR
Ga0210405_1017314433300021171SoilLNRLPAWGVTIVPPVDEGEGPRLAPSAVLVDAVRPYVRR
Ga0210388_1114292313300021181SoilNRLPAWGVTIVPPVDEGEGPRLAPSAVLVDAVRPYVRR
Ga0213876_1048983013300021384Plant RootsPVAQASLKKLPEWGVAIVPPVDAGEGPRLAPTDQLMDAVRPYVLRR
Ga0210387_1017294813300021405SoilLPAWGVTIVPPVDEGEGPRLAPSAVLVDAVRPYVRR
Ga0210394_1056556813300021420SoilSLIKLPGWGVTIVPPVDVGDGPRLAPTAALIDAVRPHVRRG
Ga0242654_1031235813300022726SoilPEWGVTIVPPVDEGEGPRLAPTAALIDAVRPHATRG
Ga0179589_1057902313300024288Vadose Zone SoilEAQASLRKLPTWGVIIVPPVDEGEGPRLAPSELLMHAVRPYVRRG
Ga0207700_1080203113300025928Corn, Switchgrass And Miscanthus RhizosphereLRLLPKWGVTIVPPVDEGEGPRLAPSALLLDAVRPYARR
Ga0207704_1169401923300025938Miscanthus RhizosphereRTLPEWGIVIVPPVDLGEGPRLAPTDTLLAAVRPYVRCA
Ga0209152_1003662833300026325SoilLRRLPEWGVRIVPPVDEGEGPRLAPTATLLDAVRPFVQHS
Ga0209803_116317523300026332SoilKKFPERGVIIVPPVDAGEGPRLAPTAVLIDAVRPYAPK
Ga0257156_109668523300026498SoilARASLNRLPAWGVTIVPPVDEGEGPRLAPSAALVDAVRPYVRR
Ga0209179_101632333300027512Vadose Zone SoilLHSWGVTIVAPVDDGEGPRLAPSAVLLDAVRPYVRRG
Ga0209038_1014251513300027737Bog Forest SoilAQASLKTLPSWGVAIVPPVDEGEGPRLAPSTVLLDAVRPYVRRG
Ga0209590_1036045113300027882Vadose Zone SoilAQASLKKLPSWGVTIVPPVDEGEGPRLAPTGVLIDAVRPHVRRGR
Ga0209698_1011318933300027911WatershedsLRTLPEWGVTVVPPVEDGSGPRLAPDEQLLTAVRLYVA
Ga0308309_1137258513300028906SoilKKLPAWGVAIVPPVDEGEGPRLAPSAVLVEAVRPYVRRG
Ga0311330_1120664513300029945BogTLPGWGVIVVPPIDDGNGPRLAPTAALLDAVRPYVSRG
Ga0302196_1042317713300030225BogDSLRTLPTWGVTIVPPVDDGGGPRLAPTERLLDAVRRFARKD
Ga0311366_1060653513300030943FenLASWGVIIVPPADDGAGPRLAPTARLLDAVRPFVRRG
Ga0302325_1113150023300031234PalsaSLKILPSWGVTIVPPVDTGEGPRLAPSELLLDAVRPYVRR
Ga0170820_1316080313300031446Forest SoilASLNRLPAWGVTIVPPADEGEGPRLAPSAALVDAVRPYVRR
Ga0318516_1029886513300031543SoilSLGKLPGWGVTIVPPVDEGEGPRLAPSAALLDAVRPYVRRG
Ga0318516_1047941413300031543SoilLAQASLKTLPSWGVTMVPPVDDGEGPRLAPTATLLAAVRPYLRRG
Ga0318534_1026799423300031544SoilGAGVAPILPQWGVTIVSPVDDGDGPRLAPTAALLDAVRPYVRRG
Ga0318528_1036079123300031561SoilLERLPSWGVTIVPPVDEGEGPRLAPTAVLIDAVRPYVRRS
Ga0310686_10147591223300031708SoilLAEWGVTMVPPIDDGNGPRLAPTAQLLDAVRPYVRRADATTA
Ga0318501_1064805613300031736SoilSWGVTILPPVDDGEGPRLARTATLLAAVRPYLRRG
Ga0306918_1069932513300031744SoilPTWGVTIVPPVDEGEGPRLAPSAVLVDAVRLHVRRG
Ga0307477_1043193733300031753Hardwood Forest SoilAQASLKKLPAWGVAIVAPVDEGEGPRLAPSAVLVEAVRPYVRRG
Ga0307477_1072867933300031753Hardwood Forest SoilRASLKKLPTWGVTIVPPVDEGEGPRLAPSAALLDAVRPYVRRG
Ga0307475_1150177013300031754Hardwood Forest SoilKLPTWGVTIVPPVDEGEGPRLAPSELLIDAVRPHVPRR
Ga0318529_1033870213300031792SoilLKRLPTWGVTIVPPVEEGEGPRLAPSAVLVDAVRLHVRRG
Ga0318576_1006249313300031796SoilASLDRLPSWGVTIIPPVDEGEGPRLAPTAVLVDAVRPYVRHS
Ga0318511_1037882023300031845SoilAQASLKRLPTWGVTIIPPVDEGEGPRLAPTAVLVDAVRPYVRRG
Ga0318544_1042765223300031880SoilTWGVTIVPPVDEGEGPRLAPSAALLDAVRPYVRRG
Ga0318520_1069761623300031897SoilPQAQASLRLLPQWGVTIVPPVDEGEGPRLAPSGLLIDAVRPYVRRG
Ga0311367_1235677313300031918FenLASWNVTIVPPLDDGQGPRLAPTAQLLAAVRPHVRPG
Ga0310910_1005219913300031946SoilRASLKRLPTWGVTIVPPVDEGEGPRLAPSAVLVDAVRLHVRRG
Ga0310909_1074974723300031947SoilLKKLRNWGVIIVPPVDEGEGPRLAPSAVLIDAVRPYVRPS
Ga0306926_1005635173300031954SoilSLARLPGWGVRIVQPIDEGEGPGLAPTAVLLDAVRSYVRRD
Ga0306926_1156345813300031954SoilNHPEAQTSLKKLRNWGVIIVPPVDEGEGPRLAPSAVLIDAVRTYVRPS
Ga0306926_1169647223300031954SoilPEAQASLKRLPSWGVTIVPPVDEGAGPRLAPTASLLEAARPYVRGS
Ga0306922_1241221813300032001SoilKLGRWGVAIVPPVDLGEGPRLAPSAALFEPVRIHLRRG
Ga0318563_1062847713300032009SoilPAARASLATLAEWGVHLVPPVDAGEGPRLAPTTALLDAVRPHVRSGG
Ga0310911_1000245513300032035SoilQWGVTIVPPVDEGEGPRLAPSAALLDAVRPYVRRG
Ga0310911_1061248813300032035SoilAQASLKTLPSWGVTMVPPVDDGEGPRLAPTATLLAAVRPYLRRG
Ga0318549_1007400113300032041SoilSWGVTIVPPVDEDEGPRLAPTAVLVDAVRPYVRHS
Ga0318533_1083652613300032059SoilPEAQTSLKKLRNWGVIIVPPVDEGEGPRLAPSAVLIDAVRPYVRPS
Ga0318533_1095347513300032059SoilSLEKLPAWGVTIVPPVDEGQGPRLAPTDMLVNAVRPHVRRG
Ga0318533_1117467923300032059SoilDKLGRWGVAIVPPVDLGEGPRLAPSAALFEPVRIHLRRG
Ga0306924_1020721433300032076SoilAQASLKKLPSWGVTVIPPVDEGEGPRLAPSAMLLDAVRPFVDRG
Ga0306924_1099054313300032076SoilEAQSSLKRLPIWGVTIVPPVDDGEGPRLAPSALLIDAVRPYARRG
Ga0318518_1026760523300032090SoilPTWGVTIVPPVDTGEGPRLAPSSQLLKAVRPYVRP
Ga0318577_1017401523300032091SoilAQASLKRLPSWGVTIVPPVDEGAGPRLAPTAALLEAARPYVRGS
Ga0335072_1091899513300032898SoilWGVRIIPPVDTGEGPRLAPTAQLLDAVRPFLRRAADGGAP
Ga0335083_1056480023300032954SoilRWGVRVVPPVDDGGGPRLAPTEALMDAVRPFVQAG
Ga0335073_1066691623300033134SoilMARASLRTLPTWNVTIIPPVDEGDGPRLAPTVSLLDAVRPFVKQG
Ga0335077_1138509413300033158SoilQAQASLRRLPEWGVTIVPPVDEGDGPRLAPTEQLLAAVRPYARR

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.