Metagenome / Metatranscriptome Family F080469

Basic Information
Family ID	F080469
Family Type	Metagenome / Metatranscriptome
Number of Sequences	115
Average Sequence Length	43 residues
Representative Sequence	MIMTNKLLPVALIAALIGGSVGALVMHKSQPATAETTTST
Number of Associated Samples	102
Number of Associated Scaffolds	115

Quality Assessment
Transcriptomic Evidence	Yes
Most common taxonomic group	Unclassified
% of genes with valid RBS motifs	100.00 %
% of genes near scaffold ends (potentially truncated)	98.26 %
% of genes from short scaffolds (< 2000 bps)	89.57 %
Associated GOLD sequencing projects	94
AlphaFold2 3D model prediction	Yes
3D model pTM-score	0.39

Most Common Taxonomy
Group	Unclassified (51.304 % of family members)
NCBI Taxonomy ID	N/A
Taxonomy	N/A

Most Common Ecosystem
GOLD Ecosystem	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere (8.696 % of family members)
Environment Ontology (ENVO)	Unclassified (48.696 % of family members)
Earth Microbiome Project Ontology (EMPO)	Host-associated → Plant → Plant rhizosphere (66.087 % of family members)

Full Alignment
Alignment of all the sequences in the family.

Powered by MSAViewer

Seed Alignment
Alignment of a non-redundant set of sequences, used to build the family's HMM profile.

Powered by MSAViewer

AlphaFold2 Input Alignment
Refined alignment used as input for AlphaFold2.

Powered by MSAViewer

Predicted Topology & Secondary Structure
Classification:	Fibrous	Signal Peptide:	Yes	Secondary Structure distribution:	α-helix: 32.35% β-sheet: 0.00% Coil/Unstructured: 67.65%
Feature Viewer

Powered by Feature Viewer

Pfam ID	Name	% Frequency in 115 Family Scaffolds
PF03572	Peptidase_S41	14.78
PF13180	PDZ_2	12.17
PF02618	YceG	3.48
PF03652	RuvX	0.87
PF14012	DUF4229	0.87
PF00400	WD40	0.87

COG ID	Name	Functional Category	% Frequency in 115 Family Scaffolds
COG0793	C-terminal processing protease CtpA/Prc, contains a PDZ domain	Posttranslational modification, protein turnover, chaperones [O]	14.78
COG1559	Endolytic transglycosylase MltG, terminates peptidoglycan polymerization	Cell wall/membrane/envelope biogenesis [M]	3.48
COG0816	YqgF/RuvX protein, pre-16S rRNA maturation RNase/Holliday junction resolvase/anti-termination factor	Translation, ribosomal structure and biogenesis [J]	0.87

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	51.30 %
All Organisms	root	All Organisms	48.70 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	51.30 %
cellular organisms	root	All Organisms → cellular organisms	48.70 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	51.30 %
Bacteria	superkingdom	All Organisms → cellular organisms → Bacteria	48.70 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	51.30 %
Acidobacteria	phylum	All Organisms → cellular organisms → Bacteria → Acidobacteria	35.65 %
Terrabacteria group	clade	All Organisms → cellular organisms → Bacteria → Terrabacteria group	0.87 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	51.30 %
unclassified Acidobacteria	no rank	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria	24.35 %
Blastocatellia	class	All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia	4.35 %
Actinobacteria	phylum	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	0.87 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	51.30 %
Acidobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	24.35 %
Blastocatellales	order	All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales	4.35 %
Actinomycetia	class	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia	0.87 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	51.30 %
Acidobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	24.35 %
Pyrinomonadaceae	family	All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae	4.35 %
unclassified Actinomycetia	no rank	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia	0.87 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	51.30 %
Acidobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	24.35 %
Pyrinomonas	genus	All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas	2.61 %
unclassified Pyrinomonadaceae	no rank	All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → unclassified Pyrinomonadaceae	1.74 %
Actinomycetia bacterium	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium	0.87 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	51.30 %
Acidobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	24.35 %
Pyrinomonas methylaliphatogenes	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes	2.61 %
Pyrinomonadaceae bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → unclassified Pyrinomonadaceae → Pyrinomonadaceae bacterium	1.74 %
Actinomycetia bacterium	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium	0.87 %

Visualization

Powered by ApexCharts

Associated Scaffolds

Scaffold	Taxonomy	Length	IMG/M Link
2170459019\|G14TP7Y02F82AW	Not Available	543	Open in IMG/M
3300000364\|INPhiseqgaiiFebDRAFT_104556550	Not Available	542	Open in IMG/M
3300000955\|JGI1027J12803_100194682	All Organisms → cellular organisms → Bacteria	1500	Open in IMG/M
3300000956\|JGI10216J12902_118027371	Not Available	633	Open in IMG/M
3300002886\|JGI25612J43240_1062341	Not Available	569	Open in IMG/M
3300004052\|Ga0055490_10101729	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	810	Open in IMG/M
3300004114\|Ga0062593_103364484	All Organisms → cellular organisms → Bacteria → Acidobacteria	513	Open in IMG/M
3300004157\|Ga0062590_101162999	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	749	Open in IMG/M
3300004479\|Ga0062595_100624385	Not Available	846	Open in IMG/M
3300004480\|Ga0062592_101768235	Not Available	603	Open in IMG/M
3300005328\|Ga0070676_10233628	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	1220	Open in IMG/M
3300005334\|Ga0068869_100181636	All Organisms → cellular organisms → Bacteria	1649	Open in IMG/M
3300005336\|Ga0070680_100369848	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	1220	Open in IMG/M
3300005340\|Ga0070689_100250287	All Organisms → cellular organisms → Bacteria	1462	Open in IMG/M
3300005340\|Ga0070689_101454258	Not Available	620	Open in IMG/M
3300005345\|Ga0070692_10030466	All Organisms → cellular organisms → Bacteria	2698	Open in IMG/M
3300005353\|Ga0070669_100529568	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	980	Open in IMG/M
3300005364\|Ga0070673_100527995	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	1070	Open in IMG/M
3300005367\|Ga0070667_101154730	Not Available	724	Open in IMG/M
3300005440\|Ga0070705_100162860	All Organisms → cellular organisms → Bacteria	1493	Open in IMG/M
3300005468\|Ga0070707_100121492	All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → unclassified Pyrinomonadaceae → Pyrinomonadaceae bacterium	2536	Open in IMG/M
3300005471\|Ga0070698_101913560	Not Available	546	Open in IMG/M
3300005530\|Ga0070679_101897455	All Organisms → cellular organisms → Bacteria → Acidobacteria	544	Open in IMG/M
3300005545\|Ga0070695_101466991	All Organisms → cellular organisms → Bacteria → Acidobacteria	567	Open in IMG/M
3300005547\|Ga0070693_100043300	All Organisms → cellular organisms → Bacteria	2542	Open in IMG/M
3300005549\|Ga0070704_100160060	All Organisms → cellular organisms → Bacteria	1780	Open in IMG/M
3300005549\|Ga0070704_100933892	Not Available	782	Open in IMG/M
3300005578\|Ga0068854_100343477	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	1220	Open in IMG/M
3300005578\|Ga0068854_100528948	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	997	Open in IMG/M
3300005578\|Ga0068854_100551330	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	978	Open in IMG/M
3300005719\|Ga0068861_102595671	Not Available	511	Open in IMG/M
3300005834\|Ga0068851_10602431	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	669	Open in IMG/M
3300005840\|Ga0068870_10271774	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	1059	Open in IMG/M
3300006169\|Ga0082029_1589080	Not Available	632	Open in IMG/M
3300006804\|Ga0079221_11580078	Not Available	530	Open in IMG/M
3300006854\|Ga0075425_101698029	Not Available	710	Open in IMG/M
3300006904\|Ga0075424_100383724	All Organisms → cellular organisms → Bacteria	1497	Open in IMG/M
3300006904\|Ga0075424_101158028	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	823	Open in IMG/M
3300007004\|Ga0079218_13773675	Not Available	515	Open in IMG/M
3300007076\|Ga0075435_101923834	Not Available	519	Open in IMG/M
3300009038\|Ga0099829_10664085	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	866	Open in IMG/M
3300009156\|Ga0111538_10246149	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium	2264	Open in IMG/M
3300009157\|Ga0105092_10906293	Not Available	521	Open in IMG/M
3300009174\|Ga0105241_11430859	Not Available	663	Open in IMG/M
3300009177\|Ga0105248_10031373	All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes	5940	Open in IMG/M
3300009177\|Ga0105248_12037743	Not Available	652	Open in IMG/M
3300009553\|Ga0105249_10067303	All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes	3300	Open in IMG/M
3300010041\|Ga0126312_10184743	All Organisms → cellular organisms → Bacteria	1454	Open in IMG/M
3300010166\|Ga0126306_10705279	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	809	Open in IMG/M
3300010358\|Ga0126370_12667411	Not Available	500	Open in IMG/M
3300010397\|Ga0134124_11668848	Not Available	669	Open in IMG/M
3300010397\|Ga0134124_12291486	Not Available	580	Open in IMG/M
3300010399\|Ga0134127_11431225	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	763	Open in IMG/M
3300010403\|Ga0134123_13202597	Not Available	527	Open in IMG/M
3300011332\|Ga0126317_10652750	All Organisms → cellular organisms → Bacteria → Acidobacteria	569	Open in IMG/M
3300012189\|Ga0137388_10824333	All Organisms → cellular organisms → Bacteria → Acidobacteria	859	Open in IMG/M
3300012203\|Ga0137399_10358991	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	1211	Open in IMG/M
3300012360\|Ga0137375_10180052	All Organisms → cellular organisms → Bacteria	2027	Open in IMG/M
3300012896\|Ga0157303_10165713	Not Available	607	Open in IMG/M
3300012922\|Ga0137394_10126725	All Organisms → cellular organisms → Bacteria	2164	Open in IMG/M
3300012929\|Ga0137404_10255514	All Organisms → cellular organisms → Bacteria	1505	Open in IMG/M
3300012986\|Ga0164304_11507374	Not Available	556	Open in IMG/M
3300013297\|Ga0157378_11887471	Not Available	646	Open in IMG/M
3300013306\|Ga0163162_12089595	Not Available	650	Open in IMG/M
3300014326\|Ga0157380_12627278	Not Available	570	Open in IMG/M
3300014968\|Ga0157379_11850202	Not Available	594	Open in IMG/M
3300015262\|Ga0182007_10254760	Not Available	631	Open in IMG/M
3300015373\|Ga0132257_101159667	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	977	Open in IMG/M
3300015373\|Ga0132257_103372913	Not Available	581	Open in IMG/M
3300015374\|Ga0132255_104022776	All Organisms → cellular organisms → Bacteria → Acidobacteria	624	Open in IMG/M
3300018429\|Ga0190272_11430393	All Organisms → cellular organisms → Bacteria → Acidobacteria	697	Open in IMG/M
3300018469\|Ga0190270_12113665	Not Available	622	Open in IMG/M
3300018476\|Ga0190274_12962796	Not Available	570	Open in IMG/M
3300021445\|Ga0182009_10115598	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	1241	Open in IMG/M
3300025271\|Ga0207666_1044194	Not Available	699	Open in IMG/M
3300025321\|Ga0207656_10718957	Not Available	512	Open in IMG/M
3300025914\|Ga0207671_10901947	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	699	Open in IMG/M
3300025917\|Ga0207660_10318970	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	1241	Open in IMG/M
3300025925\|Ga0207650_11875626	Not Available	506	Open in IMG/M
3300025932\|Ga0207690_11590853	Not Available	546	Open in IMG/M
3300025933\|Ga0207706_11518059	All Organisms → cellular organisms → Bacteria → Acidobacteria	546	Open in IMG/M
3300025940\|Ga0207691_11424322	Not Available	569	Open in IMG/M
3300025941\|Ga0207711_11587779	Not Available	598	Open in IMG/M
3300025945\|Ga0207679_10502733	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	1082	Open in IMG/M
3300025961\|Ga0207712_11254121	Not Available	662	Open in IMG/M
3300025981\|Ga0207640_10644224	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	902	Open in IMG/M
3300025981\|Ga0207640_11388100	Not Available	629	Open in IMG/M
3300026035\|Ga0207703_10210386	All Organisms → cellular organisms → Bacteria	1734	Open in IMG/M
3300026088\|Ga0207641_11363987	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	710	Open in IMG/M
3300026095\|Ga0207676_10370255	All Organisms → cellular organisms → Bacteria	1331	Open in IMG/M
3300026095\|Ga0207676_11266399	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	732	Open in IMG/M
3300026111\|Ga0208291_1093916	Not Available	525	Open in IMG/M
3300026116\|Ga0207674_10915081	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	845	Open in IMG/M
3300026118\|Ga0207675_101989685	Not Available	599	Open in IMG/M
3300026118\|Ga0207675_102515822	Not Available	525	Open in IMG/M
3300026142\|Ga0207698_10118871	All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes	2233	Open in IMG/M
3300026142\|Ga0207698_12112077	Not Available	577	Open in IMG/M
3300026974\|Ga0207555_101265	Not Available	579	Open in IMG/M
3300027018\|Ga0208475_1027654	Not Available	559	Open in IMG/M
3300027886\|Ga0209486_10979131	Not Available	567	Open in IMG/M
3300028146\|Ga0247682_1050443	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	750	Open in IMG/M
3300028380\|Ga0268265_11165103	Not Available	767	Open in IMG/M
3300028381\|Ga0268264_11626443	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	656	Open in IMG/M
3300030496\|Ga0268240_10203029	Not Available	507	Open in IMG/M
3300030511\|Ga0268241_10170694	Not Available	541	Open in IMG/M
3300031547\|Ga0310887_11029198	Not Available	526	Open in IMG/M
3300031901\|Ga0307406_10786495	Not Available	802	Open in IMG/M
3300031938\|Ga0308175_101918513	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	664	Open in IMG/M
3300032075\|Ga0310890_11598170	Not Available	539	Open in IMG/M
3300032122\|Ga0310895_10503886	Not Available	609	Open in IMG/M
3300032180\|Ga0307471_102426857	Not Available	663	Open in IMG/M
3300033412\|Ga0310810_11204230	Not Available	613	Open in IMG/M
3300034177\|Ga0364932_0018568	All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → unclassified Pyrinomonadaceae → Pyrinomonadaceae bacterium	2609	Open in IMG/M

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:

Habitat	Taxonomy	Distribution
Environmental	Environmental	53.91%
Host-Associated	Host-Associated	45.22%
Engineered	Engineered	0.87%

Habitat	Taxonomy	Distribution
Terrestrial	Environmental → Terrestrial	51.30%
Plants	Host-Associated → Plants	45.22%
Aquatic	Environmental → Aquatic	2.61%
Solid Waste	Engineered → Solid Waste	0.87%

Habitat	Taxonomy	Distribution
Soil	Environmental → Terrestrial → Soil	50.43%
Rhizosphere	Host-Associated → Plants → Rhizosphere	23.48%
Rhizoplane	Host-Associated → Plants → Rhizoplane	21.74%
Freshwater	Environmental → Aquatic → Freshwater	1.74%
Marine	Environmental → Aquatic → Marine	0.87%
Floodplain	Environmental → Terrestrial → Floodplain	0.87%
Grass	Engineered → Solid Waste → Grass	0.87%

Habitat	Taxonomy	Distribution
Unclassified	Environmental → Terrestrial → Soil → Unclassified	37.39%
Epiphytes	Host-Associated → Plants → Rhizoplane → Epiphytes	19.13%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified	15.65%
Loam	Environmental → Terrestrial → Soil → Loam	12.17%
Soil	Host-Associated → Plants → Rhizosphere → Soil	7.83%
Unclassified	Host-Associated → Plants → Rhizoplane → Unclassified	2.61%
Sediment	Environmental → Aquatic → Freshwater → Sediment	0.87%
Groundwater	Environmental → Aquatic → Freshwater → Groundwater	0.87%
Wetlands	Environmental → Aquatic → Marine → Wetlands	0.87%
Wetlands	Environmental → Terrestrial → Soil → Wetlands	0.87%
Sediment	Environmental → Terrestrial → Floodplain → Sediment	0.87%
Composting	Engineered → Solid Waste → Grass → Composting	0.87%

Habitat	Taxonomy	Distribution
Unclassified	Environmental → Terrestrial → Soil → Unclassified → Unclassified	21.74%
Unclassified	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified	19.13%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified	15.65%
Agricultural Soil	Environmental → Terrestrial → Soil → Loam → Agricultural Soil	11.30%
Unclassified	Host-Associated → Plants → Rhizosphere → Soil → Unclassified	7.83%
Agricultural Land	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land	6.96%
Grasslands	Environmental → Terrestrial → Soil → Unclassified → Grasslands	3.48%
Agricultural	Environmental → Terrestrial → Soil → Unclassified → Agricultural	3.48%
Unclassified	Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified	2.61%
Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil	1.74%
Unclassified	Environmental → Aquatic → Freshwater → Sediment → Unclassified	0.87%
Unclassified	Environmental → Aquatic → Freshwater → Groundwater → Unclassified	0.87%
Unclassified	Environmental → Aquatic → Marine → Wetlands → Unclassified	0.87%
Unclassified	Environmental → Terrestrial → Soil → Wetlands → Unclassified	0.87%
Grasslands	Environmental → Terrestrial → Soil → Loam → Grasslands	0.87%
Unclassified	Environmental → Terrestrial → Floodplain → Sediment → Unclassified	0.87%
Unclassified	Engineered → Solid Waste → Grass → Composting → Unclassified	0.87%

Habitat	Taxonomy	Distribution
Corn Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere	8.70%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere	7.83%
Corn, Switchgrass And Miscanthus Rhizosphere	Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere	6.96%
Vadose Zone Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil	6.09%
Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil	5.22%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere	5.22%
Soil	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil	4.35%
Populus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere	4.35%
Terrestrial Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil	3.48%
Soil	Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil	3.48%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere	3.48%
Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil	2.61%
Agricultural Soil	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil	2.61%
Soil	Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil	2.61%
Corn Rhizosphere	Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere	2.61%
Arabidopsis Rhizosphere	Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere	2.61%
Corn Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere	2.61%
Serpentine Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil	1.74%
Switchgrass Rhizosphere	Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere	1.74%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere	1.74%
Corn Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere	1.74%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere	1.74%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere	1.74%
Freshwater Sediment	Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment	0.87%
Soil	Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Soil	0.87%
Natural And Restored Wetlands	Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands	0.87%
Tropical Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil	0.87%
Termite Nest	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Termite Nest	0.87%
Corn, Switchgrass And Miscanthus Rhizosphere	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere	0.87%
Grasslands Soil	Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil	0.87%
Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil	0.87%
Hardwood Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil	0.87%
Natural And Restored Wetlands	Environmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands	0.87%
Soil	Environmental → Terrestrial → Soil → Loam → Grasslands → Soil	0.87%
Sediment	Environmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment	0.87%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere	0.87%
Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere	0.87%
Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere	0.87%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere	0.87%
Switchgrass, Maize And Mischanthus Litter	Engineered → Solid Waste → Grass → Composting → Unclassified → Switchgrass, Maize And Mischanthus Litter	0.87%

Visualization

Powered by ApexCharts

Associated Samples

Taxon OID	Sample Name	Habitat Type	IMG/M Link
2170459019	Litter degradation MG4	Engineered	Open in IMG/M
3300000364	Soil microbial communities from Great Prairies - Iowa, Native Prairie soil	Environmental	Open in IMG/M
3300000955	Soil microbial communities from Great Prairies - Iowa, Native Prairie soil	Environmental	Open in IMG/M
3300000956	Soil microbial communities from Great Prairies - Kansas, Native Prairie soil	Environmental	Open in IMG/M
3300002886	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_20cm	Environmental	Open in IMG/M
3300004052	Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushOxbow_ThreeSqC_D2	Environmental	Open in IMG/M
3300004114	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5	Environmental	Open in IMG/M
3300004157	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - - Combined assembly of AARS Block 2	Environmental	Open in IMG/M
3300004479	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAs	Environmental	Open in IMG/M
3300004480	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 4	Environmental	Open in IMG/M
3300005328	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG	Host-Associated	Open in IMG/M
3300005334	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2	Host-Associated	Open in IMG/M
3300005336	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG	Environmental	Open in IMG/M
3300005340	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG	Environmental	Open in IMG/M
3300005345	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG	Environmental	Open in IMG/M
3300005353	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG	Host-Associated	Open in IMG/M
3300005364	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG	Host-Associated	Open in IMG/M
3300005367	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG	Host-Associated	Open in IMG/M
3300005440	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG	Environmental	Open in IMG/M
3300005468	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG	Environmental	Open in IMG/M
3300005471	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG	Environmental	Open in IMG/M
3300005530	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG	Environmental	Open in IMG/M
3300005545	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG	Environmental	Open in IMG/M
3300005547	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG	Environmental	Open in IMG/M
3300005549	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG	Environmental	Open in IMG/M
3300005578	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2	Host-Associated	Open in IMG/M
3300005719	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2	Host-Associated	Open in IMG/M
3300005834	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2	Host-Associated	Open in IMG/M
3300005840	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2	Host-Associated	Open in IMG/M
3300006169	Termite nest microbial communities from Madurai, India	Environmental	Open in IMG/M
3300006804	Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200	Environmental	Open in IMG/M
3300006854	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4	Host-Associated	Open in IMG/M
3300006904	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3	Host-Associated	Open in IMG/M
3300007004	Agricultural soil microbial communities from Utah to study Nitrogen management - NC Compost	Environmental	Open in IMG/M
3300007076	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4	Host-Associated	Open in IMG/M
3300009038	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG	Environmental	Open in IMG/M
3300009156	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2)	Host-Associated	Open in IMG/M
3300009157	Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 19-21cm March2015	Environmental	Open in IMG/M
3300009174	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG	Host-Associated	Open in IMG/M
3300009177	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG	Host-Associated	Open in IMG/M
3300009553	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG	Host-Associated	Open in IMG/M
3300010041	Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot104A	Environmental	Open in IMG/M
3300010166	Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot27	Environmental	Open in IMG/M
3300010358	Tropical forest soil microbial communities from Panama - MetaG Plot_3	Environmental	Open in IMG/M
3300010397	Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4	Environmental	Open in IMG/M
3300010399	Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3	Environmental	Open in IMG/M
3300010403	Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3	Environmental	Open in IMG/M
3300011332	Soil microbial communities from California, USA to study soil gas exchange rates - SR-CA-SC2 metaT (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300012189	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG	Environmental	Open in IMG/M
3300012203	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG	Environmental	Open in IMG/M
3300012356	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_40_16 metaG	Environmental	Open in IMG/M
3300012360	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_113_16 metaG	Environmental	Open in IMG/M
3300012896	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S118-311C-2	Environmental	Open in IMG/M
3300012922	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaG	Environmental	Open in IMG/M
3300012929	Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly)	Environmental	Open in IMG/M
3300012986	Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_217_MG	Environmental	Open in IMG/M
3300013297	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG	Host-Associated	Open in IMG/M
3300013306	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG	Host-Associated	Open in IMG/M
3300014326	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG	Host-Associated	Open in IMG/M
3300014968	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG	Host-Associated	Open in IMG/M
3300015262	Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG	Host-Associated	Open in IMG/M
3300015373	Combined assembly of cpr5 rhizosphere	Host-Associated	Open in IMG/M
3300015374	Col-0 rhizosphere combined assembly	Host-Associated	Open in IMG/M
3300018429	Populus adjacent soil microbial communities from riparian zone of Shoshone River, Wyoming, USA - 504 T	Environmental	Open in IMG/M
3300018469	Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 320 T	Environmental	Open in IMG/M
3300018476	Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 531 T	Environmental	Open in IMG/M
3300021445	Bulk soil microbial communities from the field in Mead, Nebraska, USA - 072115-187_1 MetaG	Environmental	Open in IMG/M
3300025271	Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes)	Environmental	Open in IMG/M
3300025321	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes)	Host-Associated	Open in IMG/M
3300025914	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025917	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes)	Environmental	Open in IMG/M
3300025925	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025932	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025933	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025940	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025941	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025945	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025961	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025981	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes)	Host-Associated	Open in IMG/M
3300026035	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes)	Host-Associated	Open in IMG/M
3300026088	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes)	Host-Associated	Open in IMG/M
3300026095	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes)	Host-Associated	Open in IMG/M
3300026111	Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberrySE_CattailB_D1 (SPAdes)	Environmental	Open in IMG/M
3300026116	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes)	Host-Associated	Open in IMG/M
3300026118	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes)	Host-Associated	Open in IMG/M
3300026142	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes)	Host-Associated	Open in IMG/M
3300026974	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-BECK01-E (SPAdes)	Environmental	Open in IMG/M
3300027018	Grasslands soil microbial communities from Kansas, USA, that are Nitrogen fertilized - NN575 (SPAdes)	Environmental	Open in IMG/M
3300027886	Agricultural soil microbial communities from Utah to study Nitrogen management - NC Compost (SPAdes)	Environmental	Open in IMG/M
3300028146	Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK23	Environmental	Open in IMG/M
3300028380	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes)	Host-Associated	Open in IMG/M
3300028381	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes)	Host-Associated	Open in IMG/M
3300030496	Bulk soil microbial communities from Mexico - Penjamo (Pe) metaG (v2)	Environmental	Open in IMG/M
3300030511	Bulk soil microbial communities from Mexico - Amatitan (Am) metaG (v2)	Environmental	Open in IMG/M
3300031547	Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D4	Environmental	Open in IMG/M
3300031901	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2	Host-Associated	Open in IMG/M
3300031938	Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R1	Environmental	Open in IMG/M
3300032075	Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D3	Environmental	Open in IMG/M
3300032122	Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C0D4	Environmental	Open in IMG/M
3300032180	Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515	Environmental	Open in IMG/M
3300033412	Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - NC	Environmental	Open in IMG/M
3300034177	Sediment microbial communities from East River floodplain, Colorado, United States - 17_j17	Environmental	Open in IMG/M

Geographical Distribution

Zoom:	Powered by OpenStreetMap

Family Sequences

Protein ID	Sample Taxon ID	Habitat	Sequence
4MG_04096570	2170459019	Switchgrass, Maize And Mischanthus Litter	MIMTNKLLPVALIAALIGGSVGALVMHKSQPASAET
INPhiseqgaiiFebDRAFT_1045565502	3300000364	Soil	MTNKLLPVALIAALIGGSVGALVMHKSQPATAETTARSQNLAT
JGI1027J12803_1001946821	3300000955	Soil	MIITNKLLPVALIAALIGGSVGALVMHKSQPAAAET
JGI10216J12902_1180273711	3300000956	Soil	MIITNKLLPVALIAALIGGSVGALVMHKSQPAAAETVAQ
JGI25612J43240_10623412	3300002886	Grasslands Soil	MIMTNKLLPVALVAALIGGSVGAVVMHSRSQPTTAEPMSTTAT
Ga0055490_101017291	3300004052	Natural And Restored Wetlands	MILTNKLLPVALIAALIGGSVGAIVMHKSQPATAETILPSPQTSPA
Ga0062593_1033644841	3300004114	Soil	MIMTNKLLPVALIAALIGGSVGALVMHKSQPASAETAVASDYTA
Ga0062590_1011629992	3300004157	Soil	MIMTNKLLPVALIAALVGGSVGALVMHKSQPASAETTVAA
Ga0062595_1006243852	3300004479	Soil	MIFTNKLLPVALIAALIGGSVGALVMHKSQPADAQTVSQSNA
Ga0062592_1017682351	3300004480	Soil	MIMTNKLLPVALIAALIGGSVGALVMNRSQSATAETTTQDTAR
Ga0070676_102336282	3300005328	Miscanthus Rhizosphere	MIMTNKLLPVALIAALIGGSVGALVMHKSEPAAAETVAQTTPAT
Ga0068869_1001816361	3300005334	Miscanthus Rhizosphere	MIMTNKLLPVALIAALVGGSVGALVMHKSQPASAETTTAAAQ
Ga0070680_1003698482	3300005336	Corn Rhizosphere	MILTNKLLPVALIAALIGGSVGAIVMHKSQPATAETLAQTTTPTN
Ga0070689_1002502871	3300005340	Switchgrass Rhizosphere	MTMTNKLLPVALIAALVGGSVGALVMHKSQPATAETATTTPDTTKVAA
Ga0070689_1014542581	3300005340	Switchgrass Rhizosphere	MIMTNKLLPVALIAALIGGSVGALVMNKSQSATAETATTQDTARTGAPV
Ga0070692_100304661	3300005345	Corn, Switchgrass And Miscanthus Rhizosphere	MIMTNKLLPVALIAALIGGSVGALVMHKSQPATAETTTST
Ga0070669_1005295682	3300005353	Switchgrass Rhizosphere	MILTNKLLPVALIAALIGGSVGALVMHKSEPAAAENVAQNNAVPSTTT
Ga0070673_1005279951	3300005364	Switchgrass Rhizosphere	MILTNKLLPVALIAALIGGSVGAIVMHKSQPATAETLAQTTTPTNT
Ga0070667_1011547302	3300005367	Switchgrass Rhizosphere	MILTNKLLPVALIAALIGGSVGALVMHKSQPAAAETVAQNSPENMQPTN
Ga0070705_1001628602	3300005440	Corn, Switchgrass And Miscanthus Rhizosphere	MILTNKLLPVALIAALFGGSVGALVMHKSQPASAETTTTAAPLAQDAANN
Ga0070707_1001214923	3300005468	Corn, Switchgrass And Miscanthus Rhizosphere	MIMTNKLLPVALIAALIGGSVGALVMHKSQPAAAETTAQDQANSTPVAGQQQ
Ga0070698_1019135602	3300005471	Corn, Switchgrass And Miscanthus Rhizosphere	MILTNKLLPVALIAALVGGSVGALVMHKSQPATAETTSTSAPLAQ
Ga0070679_1018974551	3300005530	Corn Rhizosphere	MIMTNKLLPVALVAALIGGSVGAFVMHSRNQSTTADTATTAPA
Ga0070695_1014669911	3300005545	Corn, Switchgrass And Miscanthus Rhizosphere	MIMTNKLLPVALIAALIGGSVGALVMHKSQPSTAATVAADNAKYS
Ga0070693_1000433001	3300005547	Corn, Switchgrass And Miscanthus Rhizosphere	MILTNKLLPVALIAALIGGSVGALVMHKSQPAAAETTTAA
Ga0070704_1001600601	3300005549	Corn, Switchgrass And Miscanthus Rhizosphere	MIMTNKLLPVALIAALIGGSVGALVMHRSQPTTAETTTSTGA
Ga0070704_1009338921	3300005549	Corn, Switchgrass And Miscanthus Rhizosphere	MIFTNKLLPVALIAALIGGSVGALVMHKSQPAAAETLSQNNSAPTAST
Ga0068854_1003434771	3300005578	Corn Rhizosphere	MIMTNKLLPVALIAALVGGSVGALVMHKSQPAEAQTTTAAPNT
Ga0068854_1005289482	3300005578	Corn Rhizosphere	MIFTNKLLPVALIAALIGGSVGALVMHKSQPAAAETAQNAITTPATSQ
Ga0068854_1005513301	3300005578	Corn Rhizosphere	MIMTNKLLPVALIAALIGGSVGALVMHRSQPATAETT
Ga0068861_1025956711	3300005719	Switchgrass Rhizosphere	MIMTNKLLPVALIAALVGGSVGALVMHKSQPATAETKVASAQET
Ga0068851_106024312	3300005834	Corn Rhizosphere	MIMTNKLLPVALIAALVGGSVGALVMHKSQPASAETTTYAAQD
Ga0068870_102717742	3300005840	Miscanthus Rhizosphere	MILTNKLLPVALIAALIGGSVGALVMHKSQPAAAETTTAAQTT
Ga0082029_15890801	3300006169	Termite Nest	MIMTNKLLPVALIAALIGGSVGALVMHRSQPATADNTAQ
Ga0079221_115800781	3300006804	Agricultural Soil	MILTNKLLPVALIAALIGGSVGALVMHKSQPASAETMTA
Ga0075425_1016980291	3300006854	Populus Rhizosphere	MIITNKLLPVALIAALIGGSVGALVMHKSQPAAAE
Ga0075424_1003837241	3300006904	Populus Rhizosphere	MIFTNKLLPVALIAALIGGSVGAFVMHKSQPADAQTVQSNAAP
Ga0075424_1011580282	3300006904	Populus Rhizosphere	MIFTNKLLPVALIAALIGGSVGAFVMHKSQPADAQTVQSNA
Ga0079218_137736751	3300007004	Agricultural Soil	MITNKLLPVALIAALIGGSVGALVMHKSQPATAAETTTAPATVKT
Ga0075435_1019238342	3300007076	Populus Rhizosphere	MILTNKLLPVALIAALIGGSVGALVMHKSQPAAAET
Ga0099829_106640853	3300009038	Vadose Zone Soil	MIMTNKLLPVALVAGLIGGSVGAFVMHSRNQSTTADTTTT
Ga0111538_102461493	3300009156	Populus Rhizosphere	MIMTNKLLPVALIAALIGGSVGALVMHRSQPTTAETTTT
Ga0105092_109062932	3300009157	Freshwater Sediment	MIMTNKLLPVALIAALVGGSVGALVMHTRNQSNTAAATTER
Ga0105241_114308591	3300009174	Corn Rhizosphere	MIMTNKLLPVALIAALVGGSVGALVMHKSQPAAAETLVASE
Ga0105248_100313731	3300009177	Switchgrass Rhizosphere	MILTNKLLPVALIAALIGGSVGALVMHKSQPAAAETGAQNNAV
Ga0105248_120377431	3300009177	Switchgrass Rhizosphere	MIMTNKLLPVALIAALVGGSVGALVMHKSQPAAAETTTAAQTTTQPLATNASQQQE
Ga0105249_100673031	3300009553	Switchgrass Rhizosphere	MIMTNKLLPVALIAALIGGSVGALVMHKSEPAAAETVAQTTPA
Ga0126312_101847431	3300010041	Serpentine Soil	MIMTNKLLPVALIAALIGGSVGALVMHKSSPASAETTTAQNTARTT
Ga0126306_107052791	3300010166	Serpentine Soil	MIMTNKLLPVALIAALVGGSVGALVMHKSQPASAETTTAAAQDTGKTAPT
Ga0126370_126674112	3300010358	Tropical Forest Soil	MILTNKLLPVALIAALIGGSVGALVMHKSQPASAETTTNAVPVARDTAN
Ga0134124_116688481	3300010397	Terrestrial Soil	MIMTNKLLPVALIAALVGGSVGALVMHKSQPATAETKVASAQE
Ga0134124_122914861	3300010397	Terrestrial Soil	MILTNKLLPVALIAALIGGSVGALVMHKSQPAAAETTTAAQTTAQPL
Ga0134127_114312252	3300010399	Terrestrial Soil	MIMTNKLLPVALIAALIGGSVGALVMHKTQPATAETTTAANNAQTAYSPA
Ga0134123_132025971	3300010403	Terrestrial Soil	MIMTNKLLPVALVAALIGGSVGAFVMHSKNQTAATT
Ga0126317_106527501	3300011332	Soil	MIMTNKLLPVALIAALVGGSVGALVMHKSQPAEAETITKAAPNTTATA
Ga0137388_108243331	3300012189	Vadose Zone Soil	MIMTNKLLPVALIAALIGGSVGAFVMHSRNQSTSGA
Ga0137399_103589912	3300012203	Vadose Zone Soil	MIMTNKLLPVALVAALIGGSVGAFVMHSRNQSTTA
Ga0137371_106369301	3300012356	Vadose Zone Soil	MIMTNKLLPVALVAALIGGSVGAFVMHSRSQTTSEPQTTQSSLA
Ga0137375_101800523	3300012360	Vadose Zone Soil	MIMTNKLLPVALVAALIGGSVGAFVMHSRNQTAAAEPQT
Ga0157303_101657131	3300012896	Soil	MILTNKLLPVALIAALVGGAVGALVMYNAQPATAETTT
Ga0137394_101267251	3300012922	Vadose Zone Soil	MIMTNKLLPVALVAALIGGSVGALVMHKSQPAAAETTAQDRANYTP
Ga0137404_102555142	3300012929	Vadose Zone Soil	MIMTNKLLPVALIAALIGGSVGALVMHRSQPAAAET
Ga0164304_115073742	3300012986	Soil	MILTNKLLPVALIAALVGGSVGALVMHKSQPAAAETV
Ga0157378_118874711	3300013297	Miscanthus Rhizosphere	MIMTNKLLPVALIAALIGGSVGALVMNRTQSASAETTTQNTAR
Ga0163162_120895951	3300013306	Switchgrass Rhizosphere	MILTNKLLPVALIAALVGGSVGALVMHKSQPAAAETTTAAP
Ga0157380_126272782	3300014326	Switchgrass Rhizosphere	MIFTNKLLPVALIAALIGGSVGALVMHKSQPAEAETT
Ga0157379_118502022	3300014968	Switchgrass Rhizosphere	MIMTNKLLPVALIAALIGGSVGALVMHKSEPAAAETVAQTTPAANAAQ
Ga0182007_102547602	3300015262	Rhizosphere	MILTNKLLPVALIAALVGGSVGALVMHKSQPASAETTTTAAPLAQD
Ga0132257_1011596672	3300015373	Arabidopsis Rhizosphere	MIFTNKLLPVALIAALIGGSVGALVMHKSQPADAQTV
Ga0132257_1033729132	3300015373	Arabidopsis Rhizosphere	MIMTNKLLPVALIAALVGGSVGALVMHKSQPAAAE
Ga0132255_1040227761	3300015374	Arabidopsis Rhizosphere	MIMTNKLLPVALIAALIGGSVGALVMHRSQPATAESTAA
Ga0190272_114303932	3300018429	Soil	MIMTNKLLPVALIAALVGGSVGALVMHSKNQPATSAESVSQDTPLVASQA
Ga0190270_121136652	3300018469	Soil	MIMTNKLLPVALIAALVGGSVGALVMHKSQPATAETTTA
Ga0190274_129627962	3300018476	Soil	MIMTNKLLPVALIAALVGGSVGALVMHKSQPASAE
Ga0182009_101155982	3300021445	Soil	MIMTNKLLPVALIAALIGGSVGALVMHRSQPATAQTATTTAPQDATTAAQQN
Ga0207666_10441941	3300025271	Corn, Switchgrass And Miscanthus Rhizosphere	MIMTNKLLPVALIAALIGGSVGALVMHKSEPAAAETVAQTTPAANAAQPADS
Ga0207656_107189571	3300025321	Corn Rhizosphere	MILTNKLLPVALIAALIGGSVGALVMHKSQPAAAETDAQNSPENMQ
Ga0207671_109019471	3300025914	Corn Rhizosphere	MILTNKLLPVALIAALIGGSVGALVMHKSQPASAETTTTAAPLAQDTAN
Ga0207660_103189701	3300025917	Corn Rhizosphere	MILTNKLLPVALIAALIGGSVGAIVMHKSQPATAETLAQTTTPTNTLP
Ga0207650_118756261	3300025925	Switchgrass Rhizosphere	MIMTNKLLPVALIAALIGGSVGALVMHKSQPASAETA
Ga0207690_115908532	3300025932	Corn Rhizosphere	MILTNKLLPVALIAALIGGSVGAIVMHKSQPATAETLAQTTTPT
Ga0207706_115180592	3300025933	Corn Rhizosphere	MILTNKLLPVALVAALIGGSVGAFVMHSKNQPADTQ
Ga0207691_114243222	3300025940	Miscanthus Rhizosphere	MIMTNKLLPVALIAALIGGSVGALVMNRSQSATAETTTQDTARTATPV
Ga0207711_112620722	3300025941	Switchgrass Rhizosphere	MILTNKLLPVALIAALVGGSVGALVMHKSQRASAETTTTAAPATPTQAANT
Ga0207711_115877792	3300025941	Switchgrass Rhizosphere	MTMTNKLLPVALIAALVGGSVGALVMHKSQPATAETATTTPDTTKVAAA
Ga0207679_105027331	3300025945	Corn Rhizosphere	MIMTNKLLPVALIAALVGGSVGALVMHKSQPASAETTNYAAQ
Ga0207712_112541212	3300025961	Switchgrass Rhizosphere	MIMTNKLLPVALIAALVGGSVGALVMHKSQPASAETTTA
Ga0207640_106442242	3300025981	Corn Rhizosphere	MIMTNKLLPVALIAALVGGSVGALVMHKSQPAEAQTT
Ga0207640_113881001	3300025981	Corn Rhizosphere	MIFTNKLLPVALIAALIGGSVGALVMHKSQPAAAETAQNATTTPATSQPS
Ga0207703_102103861	3300026035	Switchgrass Rhizosphere	MIMTNKLLPVALIAALVGGSVGALVMHKSQPAAAETTTAAAQD
Ga0207641_113639872	3300026088	Switchgrass Rhizosphere	MTMTNKLLPVALIAALVGGSVGALVMHKSQPATAETATTTPDTT
Ga0207676_103702551	3300026095	Switchgrass Rhizosphere	MIMTNKLLPVALIAALVGGSVGALVMHKSQPASAETTTYAAQDTAR
Ga0207676_112663992	3300026095	Switchgrass Rhizosphere	MIMTNKLLPVALIAALVGGSVGALVMYRSQPASAETATA
Ga0208291_10939161	3300026111	Natural And Restored Wetlands	MIMTNKLLPVALIAALIGGSVGALVMNKSQSTTDTTASQNTVKT
Ga0207674_109150812	3300026116	Corn Rhizosphere	MILTNKLLPVALIAALVGGSVGALVMHKSQPASAETTTTAAPA
Ga0207675_1019896851	3300026118	Switchgrass Rhizosphere	MIFTNKLLPVALIAALVGGSVGALVMHKSQPAAAE
Ga0207675_1025158222	3300026118	Switchgrass Rhizosphere	MIMKRNLILPVALVAALIGGSVGALVVHKQDTTADTPTVAS
Ga0207698_101188713	3300026142	Corn Rhizosphere	MTMTNKLLPVALIAALVGGSVGALVMHKSQPATAETATTTPDTTK
Ga0207698_121120771	3300026142	Corn Rhizosphere	MIMTNKLLPVALIAALIGGSVGALVMHRSQPATAETTTPTGAQVAG
Ga0207555_1012652	3300026974	Soil	MIFTNKLLPVALIAALVGGSVGALVMHKSQPAEAETT
Ga0208475_10276541	3300027018	Soil	MIITNKLLPVALIAALIGGSVGALVMHKSQPAAAETVAQNGATPDTQATNS
Ga0209486_109791311	3300027886	Agricultural Soil	MIMTNKLLPVALVAALIGGSVGALVMNRTQSATAETTRTMQDTAQTAT
Ga0247682_10504432	3300028146	Soil	MIMTNKLLPVALIAALVGGSVGALVMHRSQPAAAETTTTAQDTTKT
Ga0268265_111651031	3300028380	Switchgrass Rhizosphere	MIMTNKLLPVALIAALIGGSVGALVMHKSEPAAAETVAQTTPATNSAQ
Ga0268264_116264432	3300028381	Switchgrass Rhizosphere	MIMTNKLLPVALIAALVGGSVGALVMHKSQPASAETTTYA
Ga0268240_102030291	3300030496	Soil	MIMTNKLLPVALIAALIGGSVGALVMNRTQSATAETTTQQDTART
Ga0268241_101706941	3300030511	Soil	MIMTNKLLPVALIAALIGGSVGALVMHRSQPASAE
Ga0310887_110291981	3300031547	Soil	MIMTNKLLPVALIAALIGGSVGALVMNKSQSATAETATTQDTARTGAP
Ga0307406_107864951	3300031901	Rhizosphere	MIMTNKLLPVALIAALVGGSVGALVMNRSQSATAE
Ga0308175_1019185131	3300031938	Soil	MILTNKLLPVALIAALIGGSVGALVMHKSQPAAAETT
Ga0310890_115981702	3300032075	Soil	MIMTNKLLPVALIAALVGGSVGALVMNRTQSATAETTPAQDNLR
Ga0310895_105038861	3300032122	Soil	MIMTNKLLPVALIAALIGGSVGALVMHRSQPATAETTTSTGAQV
Ga0307471_1024268571	3300032180	Hardwood Forest Soil	MIMTNKLLPVALIAALIGGSVGALVMHRSQPATAETTTST
Ga0310810_112042301	3300033412	Soil	MILTNKLLPVALIAALVGGSVGALVMHQSQPAAAETTTTAAPLAQ
Ga0364932_0018568_1_120	3300034177	Sediment	MIMTNKLLPVALVAALIGGSVGAFVMHSKNQTAAEPQTAQ

Structure Viewer


Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100	pTM-score: 0.39
Secondary Structure: α-helix β-sheet Coil Turn	pTM-score: 0.39
Powered by PDBe Molstar

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

Metagenome / Metatranscriptome Family F080469

Overview

Multiple Sequence Alignments

Structure & Topology

Predicted Secondary Structure and Topology

Predicted 3D Structure

Low Quality Model:

Gene Neighborhood

Neighboring Pfam domains

Neighboring Clusters of Orthologous Genes (COGs)

Phylogeny

NCBI Taxonomy

Associated Scaffolds

Environmental Properties

Associated Habitat Types

Associated Samples

Family Sequences

Hidden Markov Model


Click on a Sequence Logo column to get its information.
Powered by Skylign