Metagenome Family F080705

Basic Information
Family ID	F080705
Family Type	Metagenome
Number of Sequences	114
Average Sequence Length	46 residues
Representative Sequence	MGRPAFPFIGQGKAWVIVEGKEENEKEKKSSRIAGSFFSFTWVSPTL
Number of Associated Samples	57
Number of Associated Scaffolds	114

Quality Assessment
Transcriptomic Evidence	No
Most common taxonomic group	Unclassified
% of genes with valid RBS motifs	30.56 %
% of genes near scaffold ends (potentially truncated)	29.82 %
% of genes from short scaffolds (< 2000 bps)	94.74 %
Associated GOLD sequencing projects	57
AlphaFold2 3D model prediction	Yes
3D model pTM-score	0.25

Most Common Taxonomy
Group	Unclassified (100.000 % of family members)
NCBI Taxonomy ID	N/A
Taxonomy	N/A

Most Common Ecosystem
GOLD Ecosystem	Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Miscanthus Phyllosphere (97.368 % of family members)
Environment Ontology (ENVO)	Unclassified (98.246 % of family members)
Earth Microbiome Project Ontology (EMPO)	Host-associated → Plant → Plant surface (98.246 % of family members)

Full Alignment
Alignment of all the sequences in the family.

Powered by MSAViewer

Seed Alignment
Alignment of a non-redundant set of sequences, used to build the family's HMM profile.

Powered by MSAViewer

AlphaFold2 Input Alignment
Refined alignment used as input for AlphaFold2.

Powered by MSAViewer

Predicted Topology & Secondary Structure
Classification:	Globular	Signal Peptide:	No	Secondary Structure distribution:	α-helix: 32.00% β-sheet: 0.00% Coil/Unstructured: 68.00%
Feature Viewer

Powered by Feature Viewer

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	100.00 %

Scaffold	Taxonomy	Length	IMG/M Link
3300013297\|Ga0157378_11235547	Not Available	787	Open in IMG/M
3300015268\|Ga0182154_1038483	Not Available	605	Open in IMG/M
3300015268\|Ga0182154_1061153	Not Available	531	Open in IMG/M
3300015269\|Ga0182113_1050905	Not Available	613	Open in IMG/M
3300015274\|Ga0182188_1034803	Not Available	587	Open in IMG/M
3300015275\|Ga0182172_1056581	Not Available	551	Open in IMG/M
3300015275\|Ga0182172_1061260	Not Available	538	Open in IMG/M
3300015275\|Ga0182172_1067965	Not Available	521	Open in IMG/M
3300015276\|Ga0182170_1034661	Not Available	634	Open in IMG/M
3300015279\|Ga0182174_1052718	Not Available	583	Open in IMG/M
3300015282\|Ga0182124_1045998	Not Available	597	Open in IMG/M
3300015282\|Ga0182124_1050452	Not Available	581	Open in IMG/M
3300015282\|Ga0182124_1083984	Not Available	500	Open in IMG/M
3300015283\|Ga0182156_1042153	Not Available	625	Open in IMG/M
3300015283\|Ga0182156_1071843	Not Available	535	Open in IMG/M
3300015285\|Ga0182186_1058697	Not Available	558	Open in IMG/M
3300015285\|Ga0182186_1074719	Not Available	519	Open in IMG/M
3300015288\|Ga0182173_1028350	Not Available	692	Open in IMG/M
3300015289\|Ga0182138_1048860	Not Available	601	Open in IMG/M
3300015291\|Ga0182125_1077998	Not Available	533	Open in IMG/M
3300015292\|Ga0182141_1058346	Not Available	581	Open in IMG/M
3300015294\|Ga0182126_1025346	Not Available	740	Open in IMG/M
3300015294\|Ga0182126_1047981	Not Available	618	Open in IMG/M
3300015294\|Ga0182126_1062767	Not Available	572	Open in IMG/M
3300015294\|Ga0182126_1073488	Not Available	545	Open in IMG/M
3300015294\|Ga0182126_1084604	Not Available	523	Open in IMG/M
3300015296\|Ga0182157_1062473	Not Available	587	Open in IMG/M
3300015296\|Ga0182157_1088502	Not Available	528	Open in IMG/M
3300015298\|Ga0182106_1035711	Not Available	690	Open in IMG/M
3300015298\|Ga0182106_1050983	Not Available	623	Open in IMG/M
3300015299\|Ga0182107_1037279	Not Available	685	Open in IMG/M
3300015299\|Ga0182107_1046089	Not Available	645	Open in IMG/M
3300015299\|Ga0182107_1098788	Not Available	511	Open in IMG/M
3300015300\|Ga0182108_1075837	Not Available	560	Open in IMG/M
3300015300\|Ga0182108_1102256	Not Available	509	Open in IMG/M
3300015302\|Ga0182143_1058689	Not Available	600	Open in IMG/M
3300015302\|Ga0182143_1091384	Not Available	524	Open in IMG/M
3300015303\|Ga0182123_1029114	Not Available	713	Open in IMG/M
3300015303\|Ga0182123_1069245	Not Available	559	Open in IMG/M
3300015304\|Ga0182112_1106755	Not Available	501	Open in IMG/M
3300015305\|Ga0182158_1089936	Not Available	527	Open in IMG/M
3300015305\|Ga0182158_1093063	Not Available	521	Open in IMG/M
3300015308\|Ga0182142_1054612	Not Available	633	Open in IMG/M
3300015313\|Ga0182164_1125732	Not Available	521	Open in IMG/M
3300015314\|Ga0182140_1051283	Not Available	646	Open in IMG/M
3300015314\|Ga0182140_1114216	Not Available	505	Open in IMG/M
3300015321\|Ga0182127_1040027	Not Available	714	Open in IMG/M
3300015321\|Ga0182127_1068059	Not Available	610	Open in IMG/M
3300015322\|Ga0182110_1021493	Not Available	852	Open in IMG/M
3300015322\|Ga0182110_1046705	Not Available	680	Open in IMG/M
3300015322\|Ga0182110_1060535	Not Available	630	Open in IMG/M
3300015322\|Ga0182110_1083772	Not Available	571	Open in IMG/M
3300015322\|Ga0182110_1086641	Not Available	564	Open in IMG/M
3300015341\|Ga0182187_1102640	Not Available	640	Open in IMG/M
3300015341\|Ga0182187_1160571	Not Available	545	Open in IMG/M
3300015342\|Ga0182109_1144049	Not Available	595	Open in IMG/M
3300015342\|Ga0182109_1151211	Not Available	584	Open in IMG/M
3300015344\|Ga0182189_1196384	Not Available	533	Open in IMG/M
3300015344\|Ga0182189_1202378	Not Available	527	Open in IMG/M
3300015344\|Ga0182189_1214022	Not Available	516	Open in IMG/M
3300015345\|Ga0182111_1089694	Not Available	737	Open in IMG/M
3300015345\|Ga0182111_1170871	Not Available	579	Open in IMG/M
3300015345\|Ga0182111_1232734	Not Available	512	Open in IMG/M
3300015346\|Ga0182139_1113445	Not Available	676	Open in IMG/M
3300015347\|Ga0182177_1106881	Not Available	694	Open in IMG/M
3300015347\|Ga0182177_1143443	Not Available	622	Open in IMG/M
3300015347\|Ga0182177_1158217	Not Available	599	Open in IMG/M
3300015347\|Ga0182177_1205326	Not Available	542	Open in IMG/M
3300015347\|Ga0182177_1219320	Not Available	528	Open in IMG/M
3300015347\|Ga0182177_1237578	Not Available	511	Open in IMG/M
3300015351\|Ga0182161_1096459	Not Available	751	Open in IMG/M
3300015351\|Ga0182161_1132839	Not Available	664	Open in IMG/M
3300015351\|Ga0182161_1156036	Not Available	624	Open in IMG/M
3300015351\|Ga0182161_1201159	Not Available	564	Open in IMG/M
3300015351\|Ga0182161_1240520	Not Available	524	Open in IMG/M
3300015351\|Ga0182161_1261962	Not Available	506	Open in IMG/M
3300015355\|Ga0182159_1293689	Not Available	544	Open in IMG/M
3300015355\|Ga0182159_1331497	Not Available	515	Open in IMG/M
3300015361\|Ga0182145_1103653	Not Available	621	Open in IMG/M
3300015361\|Ga0182145_1149043	Not Available	550	Open in IMG/M
3300015361\|Ga0182145_1178406	Not Available	517	Open in IMG/M
3300015361\|Ga0182145_1196577	Not Available	500	Open in IMG/M
3300017404\|Ga0182203_1111841	Not Available	571	Open in IMG/M
3300017409\|Ga0182204_1054646	Not Available	638	Open in IMG/M
3300017410\|Ga0182207_1114198	Not Available	584	Open in IMG/M
3300017411\|Ga0182208_1117696	Not Available	518	Open in IMG/M
3300017413\|Ga0182222_1029850	Not Available	702	Open in IMG/M
3300017415\|Ga0182202_1042089	Not Available	733	Open in IMG/M
3300017415\|Ga0182202_1118962	Not Available	529	Open in IMG/M
3300017420\|Ga0182228_1080334	Not Available	598	Open in IMG/M
3300017424\|Ga0182219_1010935	Not Available	1136	Open in IMG/M
3300017425\|Ga0182224_1058274	Not Available	700	Open in IMG/M
3300017425\|Ga0182224_1135124	Not Available	538	Open in IMG/M
3300017430\|Ga0182192_1056583	Not Available	740	Open in IMG/M
3300017430\|Ga0182192_1092744	Not Available	625	Open in IMG/M
3300017430\|Ga0182192_1173105	Not Available	502	Open in IMG/M
3300017433\|Ga0182206_1079107	Not Available	629	Open in IMG/M
3300017436\|Ga0182209_1119781	Not Available	568	Open in IMG/M
3300017442\|Ga0182221_1109631	Not Available	578	Open in IMG/M
3300017443\|Ga0182193_1107873	Not Available	620	Open in IMG/M
3300017443\|Ga0182193_1141902	Not Available	564	Open in IMG/M
3300017682\|Ga0182229_1090686	Not Available	537	Open in IMG/M
3300017683\|Ga0182218_1048771	Not Available	714	Open in IMG/M
3300017683\|Ga0182218_1073979	Not Available	631	Open in IMG/M
3300017685\|Ga0182227_1103504	Not Available	557	Open in IMG/M
3300017685\|Ga0182227_1127169	Not Available	516	Open in IMG/M
3300017689\|Ga0182231_1071310	Not Available	659	Open in IMG/M
3300026089\|Ga0207648_12175928	Not Available	515	Open in IMG/M

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:

Habitat	Taxonomy	Distribution
Host-Associated	Host-Associated	100.00%

Habitat	Taxonomy	Distribution
Plants	Host-Associated → Plants	100.00%

Habitat	Taxonomy	Distribution
Phyllosphere	Host-Associated → Plants → Phyllosphere	98.25%
Rhizoplane	Host-Associated → Plants → Rhizoplane	0.88%
Rhizosphere	Host-Associated → Plants → Rhizosphere	0.88%

Habitat	Taxonomy	Distribution
Unclassified	Host-Associated → Plants → Phyllosphere → Unclassified	98.25%
Epiphytes	Host-Associated → Plants → Rhizoplane → Epiphytes	0.88%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified	0.88%

Habitat	Taxonomy	Distribution
Unclassified	Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified	98.25%
Unclassified	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified	0.88%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified	0.88%

Habitat	Taxonomy	Distribution
Miscanthus Phyllosphere	Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Miscanthus Phyllosphere	97.37%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere	0.88%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere	0.88%
Switchgrass Phyllosphere	Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Switchgrass Phyllosphere	0.88%

Visualization

Powered by ApexCharts

Associated Samples

Taxon OID	Sample Name	Habitat Type	IMG/M Link
3300013297	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG	Host-Associated	Open in IMG/M
3300015268	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_12JUL2016_LD1 MG	Host-Associated	Open in IMG/M
3300015269	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_09MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015274	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_22AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015275	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_01AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015276	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_01AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015279	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_01AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015282	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_31MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015283	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_12JUL2016_LD1 MG	Host-Associated	Open in IMG/M
3300015285	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_22AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015286	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_01AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015288	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_01AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015289	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_20JUN2016_LD1 MG	Host-Associated	Open in IMG/M
3300015291	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_31MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015292	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_20JUN2016_LD1 MG	Host-Associated	Open in IMG/M
3300015294	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_31MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015296	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_12JUL2016_LD1 MG	Host-Associated	Open in IMG/M
3300015298	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_09MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015299	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_09MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015300	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_09MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015302	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_20JUN2016_LD1 MG	Host-Associated	Open in IMG/M
3300015303	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_31MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015304	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_09MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015305	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_12JUL2016_LD1 MG	Host-Associated	Open in IMG/M
3300015308	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_20JUN2016_LD1 MG	Host-Associated	Open in IMG/M
3300015313	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_01AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015314	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_20JUN2016_LD1 MG	Host-Associated	Open in IMG/M
3300015321	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_31MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015322	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_09MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015341	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_22AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015342	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_09MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015344	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_22AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015345	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_09MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015346	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_20JUN2016_LD1 MG	Host-Associated	Open in IMG/M
3300015347	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_01AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015351	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_12JUL2016_LD1 MG	Host-Associated	Open in IMG/M
3300015355	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_12JUL2016_LD1 MG	Host-Associated	Open in IMG/M
3300015361	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_20JUN2016_LD1 MG	Host-Associated	Open in IMG/M
3300017404	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_12SEP2016_LD1 MG	Host-Associated	Open in IMG/M
3300017409	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_12SEP2016_LD1 MG	Host-Associated	Open in IMG/M
3300017410	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_12SEP2016_LD1 MG	Host-Associated	Open in IMG/M
3300017411	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_12SEP2016_LD1 MG	Host-Associated	Open in IMG/M
3300017413	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_03OCT2016_LD1 MG	Host-Associated	Open in IMG/M
3300017415	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_12SEP2016_LD1 MG	Host-Associated	Open in IMG/M
3300017420	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_07NOV2016_LD1 MG	Host-Associated	Open in IMG/M
3300017424	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_03OCT2016_LD1 MG	Host-Associated	Open in IMG/M
3300017425	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_03OCT2016_LD1 MG	Host-Associated	Open in IMG/M
3300017430	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_22AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300017433	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_12SEP2016_LD1 MG	Host-Associated	Open in IMG/M
3300017436	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_12SEP2016_LD1 MG	Host-Associated	Open in IMG/M
3300017442	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_03OCT2016_LD1 MG	Host-Associated	Open in IMG/M
3300017443	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_22AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300017682	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_07NOV2016_LD1 MG	Host-Associated	Open in IMG/M
3300017683	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_03OCT2016_LD1 MG	Host-Associated	Open in IMG/M
3300017685	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_07NOV2016_LD1 MG	Host-Associated	Open in IMG/M
3300017689	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_07NOV2016_LD1 MG	Host-Associated	Open in IMG/M
3300026089	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes)	Host-Associated	Open in IMG/M

Geographical Distribution

Zoom:	Powered by OpenStreetMap

Family Sequences

Protein ID	Sample Taxon ID	Habitat	Sequence
Ga0157378_112355471	3300013297	Miscanthus Rhizosphere	MGRPAFPFIGQGKAWVIVEGKEENEKEKKSSRIAGSFFSFTWVSPTL*
Ga0182154_10384832	3300015268	Miscanthus Phyllosphere	GQGKARVTVEGKEEDEKEKKSSRIAESFFSFTWVPPTL*
Ga0182154_10611531	3300015268	Miscanthus Phyllosphere	MGCPTFPFIGQGKARVIVEEKEENEKEKKSLRIVGSFSFTWVPPTL*
Ga0182113_10509052	3300015269	Miscanthus Phyllosphere	CVAMPFMGHPAFPFIGQEKAQVIVEGKEEDEKEKKSSRIVGSFFSFMWVPPTL*
Ga0182188_10348031	3300015274	Miscanthus Phyllosphere	SMGCPAFPFIGQGKARATVEGKEEKEKEKKSSRIARSFFSFMRVLLTQ*
Ga0182172_10565811	3300015275	Miscanthus Phyllosphere	MGRPTFPFIGQGKARVTVEGKEEIEKEEKSPRIAGSFSFTWVLSTL*
Ga0182172_10612601	3300015275	Miscanthus Phyllosphere	PTFSFIGQGKVGVIAEGNGENEKEKRSSRIIGSFFSFTLISSTL*
Ga0182172_10679651	3300015275	Miscanthus Phyllosphere	PAFPFIGQGKARVILEGKEEDEKEKKSSRIIGSFFSFTWVPPTL*
Ga0182170_10346612	3300015276	Miscanthus Phyllosphere	MGHPAFPFIGQGKAHVTVGGKEENEKEKKSSRIIGSFFSFTRVMPTL*
Ga0182174_10527181	3300015279	Miscanthus Phyllosphere	HVFPFIGIGKAWVTMEGKEEDEKEKKSSRIVGSFFCFTWVPLTL*
Ga0182124_10459981	3300015282	Miscanthus Phyllosphere	MGHPAFPFIGQGKAWVTGEGKEENEKERKSSRIAGSFFSFTWVPLTL*
Ga0182124_10504521	3300015282	Miscanthus Phyllosphere	MGCPAFPFIGQGKAWITVEGKEENEKEKKSSKIVRSFFSFTRVPPTL*
Ga0182124_10839841	3300015282	Miscanthus Phyllosphere	VPFMGHLAFPFIGQGKARVTVEGKEENEKEKKSYRIVGSFFSFMRVPSTL*
Ga0182156_10421531	3300015283	Miscanthus Phyllosphere	MGCSAFPVIGQGKARVIVEGKEENEKEKKSSRIVGSFFSFMRVLPTL*
Ga0182156_10718431	3300015283	Miscanthus Phyllosphere	MPIVGRPAFPFIGQEKARVTVKEKEEDEKEKFSRIAGSFFSFTWVRPTL*
Ga0182186_10586971	3300015285	Miscanthus Phyllosphere	MGCPAFPFIDQGKAWVIVEGKEENEKGKKSSRIIGSFFSFMRVPPTL*
Ga0182186_10747191	3300015285	Miscanthus Phyllosphere	MGRPAFPFIGQGKAWVTVEGKEENEKEKKSSRIAGSFFSFTRVPPS
Ga0182176_10264231	3300015286	Miscanthus Phyllosphere	DQRKAWVTVEGKEEDEKEKKSSRIAGSFFSFAWVPPTL*
Ga0182173_10283501	3300015288	Miscanthus Phyllosphere	GCPAFPFIGQGKAKVIAKGKEGNEKDKKSSRIDGSFLSFMWVQTTL*
Ga0182138_10488601	3300015289	Miscanthus Phyllosphere	GRPAFRFIGQEKARVIVEEKEEDEKEKKSSRIVRSFFSFMRVSSTL*
Ga0182125_10779981	3300015291	Miscanthus Phyllosphere	TMRLSRVEVLFMGCPAFPFIVQGKTRVIVEGQEENEEKKSSRIAGSFFSFTWVLPTL*
Ga0182141_10583461	3300015292	Miscanthus Phyllosphere	MGLSAFLFIGQGKAGVTAEGKKENQKEKKSSRIAESFFSSMRVPLTL*
Ga0182126_10253461	3300015294	Miscanthus Phyllosphere	MGCPAFPFIGQGKARVTVEGKEEDEKEKKSSRIAGSFFSFTQVPLTM*
Ga0182126_10479811	3300015294	Miscanthus Phyllosphere	MGCPAFPFIGQGKAWATVEGKEDDEKGKKSSRIAGSFFSFMWVPLTL*
Ga0182126_10627671	3300015294	Miscanthus Phyllosphere	MGCPVFPFIGQGKARVTVKEKEEDEKEKKSSRIDGSFFSFRWVPLTM*
Ga0182126_10734881	3300015294	Miscanthus Phyllosphere	MPFMGCPVFPFIGQGKSRVIVEGKEEDEKEKKSSNIAGSFISFTWAPPTL*
Ga0182126_10846041	3300015294	Miscanthus Phyllosphere	FIGQEKVRVTVEEKEGNENEKKSSRIVGFFFSFTRVLPTL*
Ga0182157_10624732	3300015296	Miscanthus Phyllosphere	MGCLAFPFIGQGKARVIAKKKVKNEREKKAFRITGSFFSFMRVLSIM*
Ga0182157_10885022	3300015296	Miscanthus Phyllosphere	MGYPAFPFIGKGKAWVIVEGKEENEKEKKSSRITGSFFSFTRVPPTL*
Ga0182106_10357112	3300015298	Miscanthus Phyllosphere	MGYPAFPFIGQGKARVIVEGKEEEENEKKSSRIIGSSFSFTRVPPTL*
Ga0182106_10509831	3300015298	Miscanthus Phyllosphere	MVQVPFMGHPAFPFIGQGKIWGTVEGKEENEKEKKSSRITGSFFSFMRVPLTL*
Ga0182107_10372791	3300015299	Miscanthus Phyllosphere	MGCPAFPFIGQGKARVTVEEKEENEKEKKSSRIAKSFFSFTWVPLTL*
Ga0182107_10460891	3300015299	Miscanthus Phyllosphere	MGCPAFSFIGQGKAWVIVEGKEEDEKEKKSSRIAGPFFSFMWVPPTL*
Ga0182107_10709302	3300015299	Miscanthus Phyllosphere	KAWVTVEGKEENEKEKKSSRIVGSFSFTWVPPTL*
Ga0182107_10987881	3300015299	Miscanthus Phyllosphere	GQRKARVIVEGKEENEKEKKSSRITGSFFSFTQVPSTL*
Ga0182108_10758371	3300015300	Miscanthus Phyllosphere	MGCPASPFIGQGKAEVIVEGKEENEKEKKSSRNDGSFFSFTWVPLT
Ga0182108_11022561	3300015300	Miscanthus Phyllosphere	MGCPAFPFIGQRKARVIVKGKEEKEKEKKSSRIAGSFFSFTRVPPTL*
Ga0182143_10586891	3300015302	Miscanthus Phyllosphere	MGRPAFPFIGQGKARVIVEGKEENEKGKKSSRIVESFFSFTSVPLTL*
Ga0182143_10913841	3300015302	Miscanthus Phyllosphere	MGRPAFPFICQGKAGVTAKGKEGNEKEKKSSRIDGSFFFFTWVP
Ga0182123_10291141	3300015303	Miscanthus Phyllosphere	MGRPAFPFIGQGKAWVIVEGKEDNEKEKKSSRIAESFFSFTWVPPTL*
Ga0182123_10692451	3300015303	Miscanthus Phyllosphere	MGRPAFLFIGQGKTQVIVERKEENEKEKSSRIAGSFFSFTRVPPTL*
Ga0182112_11067551	3300015304	Miscanthus Phyllosphere	MPFMGHPAFPFIGQEKARVVVERKEEDEKEKKSSRIAGSFFSFMWVAPTL*
Ga0182158_10818621	3300015305	Miscanthus Phyllosphere	MGLSAFLFIGQGKAGVTAEGKKENQKEKKSSRITESFFSSMRVSPTL*
Ga0182158_10899361	3300015305	Miscanthus Phyllosphere	MGCPAFPFIGQGKAWVIVEEKEENEKEKKSYRIAESFFSFTRVPPTL*
Ga0182158_10930631	3300015305	Miscanthus Phyllosphere	MGRHAFPFIGLGKARVTVEGKEENEKEKFSRIIGSFFIFTRVMPTL*
Ga0182142_10546121	3300015308	Miscanthus Phyllosphere	MGCPTFPFIDQGKVWVIVEGKEEDEKEKKSSRIARSFSFTWVPPTL*
Ga0182164_11257321	3300015313	Switchgrass Phyllosphere	MGRPAFPFIGQGKAWVIAEKKEERERETKAFSIVGSFSFMRVS
Ga0182140_10512831	3300015314	Miscanthus Phyllosphere	MGRPAFTFIGQGKAVVTSEGKKRNQKEKKSSRIIGSFFSSMR
Ga0182140_11142161	3300015314	Miscanthus Phyllosphere	MGRPAFLFIGQGKAQVTKEEKEEDEKVKKSFRIVGSFFSFTRIPSTL*
Ga0182127_10400271	3300015321	Miscanthus Phyllosphere	MGCPAFPFIGQGKAWVTVEREKNEREKKAFRITESFSFMWYPLIL*
Ga0182127_10680591	3300015321	Miscanthus Phyllosphere	MGCPTLHFIGQGKARVIVEGKEENEKEKKSSRIIRSFFSFTRVPPTL*
Ga0182110_10214931	3300015322	Miscanthus Phyllosphere	MGCPAFSFIGQEKARVTVEGKEENEKEKKSSRIAGFFFSFTRVPPTL*
Ga0182110_10467051	3300015322	Miscanthus Phyllosphere	MPLIGHPAFPFIGQGKAWVTVEEKEENEKKSYRIAGSFFSFMRVPPTL*
Ga0182110_10605351	3300015322	Miscanthus Phyllosphere	MHFIGCPAFHFIGQGKAWVIVEAKEEDEKEKKSSRIAGSFFSFTRVP*
Ga0182110_10837721	3300015322	Miscanthus Phyllosphere	KARVTVEGKEENEKEKSSKIVGSFFPFSWVPLTL*
Ga0182110_10866411	3300015322	Miscanthus Phyllosphere	MGHPAFPFIGQGKARVTVEGKEEDEKEKKSSKIVGSFFSFMGVTPTL*
Ga0182187_11026401	3300015341	Miscanthus Phyllosphere	MERPAFPFIGQEKALVTMEGKEENKEEKKSSRITGSFFSFTWVTPTL*
Ga0182187_11605711	3300015341	Miscanthus Phyllosphere	MGRPAFPFIGQGKAWVILEGKEENEKEMKTSRIVGSFFSFMWVSPTL*
Ga0182109_11440491	3300015342	Miscanthus Phyllosphere	MGHPAFLFIGQGKARATVEGKEEDKKEKKSSRIAESFFSFTWVPPTL*
Ga0182109_11512111	3300015342	Miscanthus Phyllosphere	MTLMGCPAFPFIGQGKARVTVERKKENEKEKKSYRIAGSFSFTWVSLTL*
Ga0182109_12180981	3300015342	Miscanthus Phyllosphere	GQRKSRVTVEGKEENEKEKKSSKTAGSFFSFTQVPPTL*
Ga0182189_11963841	3300015344	Miscanthus Phyllosphere	MILMGRPAFPFIGQEKARITVEGKEENEKEKKSSRIIGSFFSITQVPPTL*
Ga0182189_12023781	3300015344	Miscanthus Phyllosphere	MASFYFIGQGKTCVIVEGKEENEKEKKSFTIAGSFFSFTWVPPTL*
Ga0182189_12140221	3300015344	Miscanthus Phyllosphere	MGNPAFPFIGQGKAWVIVEGKEENEKEKKSSRIVGSCFSFMRVSLTL*
Ga0182189_12223522	3300015344	Miscanthus Phyllosphere	QGKARVIVEGKEKEKEKKPSWISGSFFSFMWVPPTL*
Ga0182111_10896941	3300015345	Miscanthus Phyllosphere	MGCPAFPFIGQGKEQVTVEGKEEEKKEKKFTRIAGSFFSITWVPPTL*
Ga0182111_11708711	3300015345	Miscanthus Phyllosphere	MGCLAFPFIGQGKARVTVEGKEEDEKEKKSSRIDGSFFSFRWVPPTM*
Ga0182111_12327341	3300015345	Miscanthus Phyllosphere	MPVLGCPAFPFIDQGKVWVIVEGKEEDEKEKKSSRIARSFSFTWVPPTL*
Ga0182139_11134451	3300015346	Miscanthus Phyllosphere	VRVPFMGCHVFPFIGQGKARVIIEEKEENEKEKNSSRIAESFFSFMWVPSTL*
Ga0182177_11068811	3300015347	Miscanthus Phyllosphere	FPFIGQEKARVTLKEKEENEKEKKSSRIAGSFFSFTRVSSTL*
Ga0182177_11434431	3300015347	Miscanthus Phyllosphere	MGCPASYFIGQGKARVTVEEKEVNEKEKKSSRIVGFFFSFMWVLPTL*
Ga0182177_11582171	3300015347	Miscanthus Phyllosphere	CPAFPFIGQGKAWVTVEGKEENEKEKKSSRITGSFFSFMRVSPTL*
Ga0182177_12053261	3300015347	Miscanthus Phyllosphere	MGCPAFPFIRQGKAWITVEGKEENEKEKKSSKIAGSFFS
Ga0182177_12193201	3300015347	Miscanthus Phyllosphere	MGCPTFPFIGQGKAWVIVEGKEENEKEKKSSRIPMPFFSFTWVPPTL*
Ga0182177_12375781	3300015347	Miscanthus Phyllosphere	AFPFIGQGKAGVTAEGREEKEKEESSRIDGSFFYFMRVPPTL*
Ga0182161_10616831	3300015351	Miscanthus Phyllosphere	KSRVTVEGKEENEKEKKSSKTAGSFFSFMQVPPTL*
Ga0182161_10964591	3300015351	Miscanthus Phyllosphere	MPHIGRPAFLFIGQGKARVTVEGKEEKEKEKRSYWIAGSFFSFTQVPLTL*
Ga0182161_11328391	3300015351	Miscanthus Phyllosphere	MERPAFPCIGQGKARITVEEKEENEKKKKSTRIVGFFFSFTRVPPTL*
Ga0182161_11560361	3300015351	Miscanthus Phyllosphere	MGRPAFPFIGQGKPWVIVEGKEEDEKEKKSSRITGSFFSFTWVPPTL*
Ga0182161_12011591	3300015351	Miscanthus Phyllosphere	MGRPAFPFIGQEKVRVIVEGKEEDEKEKKSSRIIGSFFSFTWVPLTL*
Ga0182161_12405202	3300015351	Miscanthus Phyllosphere	IGQGKARVTVEGKEENEKEKKSSRIIGSFFSFTRVMPTL*
Ga0182161_12619621	3300015351	Miscanthus Phyllosphere	TFPFIGQAKAQVTVEGKEEKEKEKESSRIVGSFFSFTWDPLTL*
Ga0182159_12936891	3300015355	Miscanthus Phyllosphere	MGCPTFPFIGQGKARVIAKEKEKNERERRASRIAGSFFSFMRVPPTL*
Ga0182159_13314971	3300015355	Miscanthus Phyllosphere	MCFDAMTLMGCLGFPFIGQGKARIIVKEKEENEKEKKSSKITGSFFSFTWVPPTL*
Ga0182145_11036531	3300015361	Miscanthus Phyllosphere	MGRPAFPFIGQEKVRVIVEGKEEDEKEKKSSRIVGSFFSITWVPLTL*
Ga0182145_11490431	3300015361	Miscanthus Phyllosphere	MPLMGCPAFPFIGQGKARVTVEGKEENEKEKKSSRIDGSFFSFMWVPSTL*
Ga0182145_11784061	3300015361	Miscanthus Phyllosphere	GRPAFPFIGQGKARVIVQGKEEDEKEKKSSRIVGFFFSFTWVPPTL*
Ga0182145_11965771	3300015361	Miscanthus Phyllosphere	MGCHVFPFIGQGKARVIIEEKEENEKEKRSFGIAGSFFSFLQVPPTL*
Ga0182203_11118412	3300017404	Miscanthus Phyllosphere	MGRPAFPFIGQGKAWIIVEGKEENEKEKKSSRIAGSFFSFTRVPPSL
Ga0182204_10546461	3300017409	Miscanthus Phyllosphere	MPFMGHPAFPFIGQEKAQVIVEGKEEDEKEKKSSRMVGSFFSFIWVPPIL
Ga0182207_11141982	3300017410	Miscanthus Phyllosphere	MGCPAFPFIGQGKAWVIVEGKEEDEKEKKPSKIIGTFFSFMWVWPTL
Ga0182208_11176961	3300017411	Miscanthus Phyllosphere	MGRSAFSFIGQGKTRVTVEGKEENEKGKKSPRIVGFFFSFTRVPLTL
Ga0182222_10298501	3300017413	Miscanthus Phyllosphere	MGCPAFPFIGQGKARVTVEGKEKKKKEKKSSRIAGSFFSFTRVPPTL
Ga0182202_10420891	3300017415	Miscanthus Phyllosphere	MGCPAFPFIGQGKASVTVEGKEEDEKEESSRIVGSFFYFMWVPLTL
Ga0182202_11189621	3300017415	Miscanthus Phyllosphere	MGRLAFSFIGQGKAWVIVKEKGENEKEKKSSRIAGSFFSFTRVPLTL
Ga0182228_10803341	3300017420	Miscanthus Phyllosphere	MLCAEMPLMGHPAFPFIGQGKARIIVEGKEENEKEKFSRITGSFFIFTRVMLTL
Ga0182219_10109352	3300017424	Miscanthus Phyllosphere	MGCPAFPFIGKGKTRVILEGKEEIEKEKKSSRIAESFFSFMRVPPTL
Ga0182224_10582741	3300017425	Miscanthus Phyllosphere	MPYFPFLGQGKAWVTVEGKEEKEKEKSYRIAGSFFSFTQVPLTL
Ga0182224_11351241	3300017425	Miscanthus Phyllosphere	MRCPAFLFIGQGKAWVIVEGKEENEKEKKSSRITGSFFSFRRVPLTL
Ga0182192_10565831	3300017430	Miscanthus Phyllosphere	MSPDAMPLMGCPAFPFIGQGKAWVIVEGKEENEKEKKSSRITGSFSFTQVPPTL
Ga0182192_10927441	3300017430	Miscanthus Phyllosphere	PAFPFIGQGKARVTVEGKEENEKEKKSYRIAGSFSFTRVPPTL
Ga0182192_11731051	3300017430	Miscanthus Phyllosphere	PAFPFIGQGKARVTVEGKEENEKEKKSYRIAGSLFSFTWVPPTL
Ga0182206_10791072	3300017433	Miscanthus Phyllosphere	MGHPAFPFIVQGKARVTVKGKEEKEKEKKSLRIVGSFFSFTWVLPTL
Ga0182209_11197811	3300017436	Miscanthus Phyllosphere	LVVPLMGCPTFPFIVQGKARVIVEGKQENQKEKKSSRITRSFFSFMQVPPTL
Ga0182221_11096311	3300017442	Miscanthus Phyllosphere	MGRPAFPFIGQGKAWVILEGKEENEKEMKTSRIVGSFFSFMWVSPTL
Ga0182193_11078731	3300017443	Miscanthus Phyllosphere	MGCPIFPFIGQGKARVTVEGKEEKEKEKRSYWIAGSFFSFTQVPLTL
Ga0182193_11419022	3300017443	Miscanthus Phyllosphere	MLLMGCPALPFIGQGKARVTVEGKEENEKEKKSYRIIGSFFSFTRVPPTL
Ga0182229_10906862	3300017682	Miscanthus Phyllosphere	MGCPTFSIIGQGKARVTVEGKEEDEKEKKSSRITGSFFSFMWVPPTL
Ga0182218_10487712	3300017683	Miscanthus Phyllosphere	MGHPAFPFIGQGKAGVTVEGKEEDEKEKKSSRIVGPFFSFTWVPPTL
Ga0182218_10739792	3300017683	Miscanthus Phyllosphere	MERPAFPLISQEKAQVIVEGKEEDEKEKKSSRIAGSFFSFMWVPLTL
Ga0182227_11035041	3300017685	Miscanthus Phyllosphere	MGCHVFPFIGQGKARVIIEEKEENEKEKKSSRIVGSFFSFMRVPSTL
Ga0182227_11271691	3300017685	Miscanthus Phyllosphere	PLMGCLAFPFIGQGKAWVTMEEKDENEKEKKSYRIAGSFFSFMRVPPTQ
Ga0182231_10713102	3300017689	Miscanthus Phyllosphere	LFMGHPAFSFIGQEKARITVERDENEKEKKSFRIAGSFFSFTRVPPTL
Ga0207648_121759282	3300026089	Miscanthus Rhizosphere	FIGQGKAWVTVEGKEEDEKEKSYRIAGSFFSFMWVPLTL

Structure Viewer


Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100	pTM-score: 0.25
Secondary Structure: α-helix β-sheet Coil Turn	pTM-score: 0.25
Powered by PDBe Molstar

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

Metagenome Family F080705

Overview

Multiple Sequence Alignments

Structure & Topology

Predicted Secondary Structure and Topology

Predicted 3D Structure

Low Quality Model:

Phylogeny

NCBI Taxonomy

Associated Scaffolds

Environmental Properties

Associated Habitat Types

Associated Samples

Family Sequences

Hidden Markov Model


Click on a Sequence Logo column to get its information.
Powered by Skylign