NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F080732

Metagenome / Metatranscriptome Family F080732

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F080732
Family Type Metagenome / Metatranscriptome
Number of Sequences 114
Average Sequence Length 50 residues
Representative Sequence MTPDQLRGAARNLAHGLGIPVYIRDGRIYQNGPGLAFLPPNGDPA
Number of Associated Samples 74
Number of Associated Scaffolds 114

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 99.07 %
% of genes near scaffold ends (potentially truncated) 93.86 %
% of genes from short scaffolds (< 2000 bps) 88.60 %
Associated GOLD sequencing projects 67
AlphaFold2 3D model prediction Yes
3D model pTM-score0.42

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (91.228 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil
(53.509 % of family members)
Environment Ontology (ENVO) Unclassified
(81.579 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(50.877 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Fibrous Signal Peptide: No Secondary Structure distribution: α-helix: 20.55%    β-sheet: 10.96%    Coil/Unstructured: 68.49%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.42
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 114 Family Scaffolds
PF13975gag-asp_proteas 7.89
PF04964Flp_Fap 3.51
PF13650Asp_protease_2 1.75
PF00300His_Phos_1 1.75
PF05899Cupin_3 0.88
PF00239Resolvase 0.88
PF01555N6_N4_Mtase 0.88
PF13561adh_short_C2 0.88
PF13463HTH_27 0.88
PF00512HisKA 0.88
PF02321OEP 0.88
PF09190DALR_2 0.88
PF05598DUF772 0.88

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 114 Family Scaffolds
COG3847Flp pilus assembly protein, pilin FlpExtracellular structures [W] 3.51
COG1538Outer membrane protein TolCCell wall/membrane/envelope biogenesis [M] 1.75
COG0215Cysteinyl-tRNA synthetaseTranslation, ribosomal structure and biogenesis [J] 0.88
COG0863DNA modification methylaseReplication, recombination and repair [L] 0.88
COG1041tRNA G10 N-methylase Trm11Translation, ribosomal structure and biogenesis [J] 0.88
COG1961Site-specific DNA recombinase SpoIVCA/DNA invertase PinEReplication, recombination and repair [L] 0.88
COG2189Adenine specific DNA methylase ModReplication, recombination and repair [L] 0.88
COG2452Predicted site-specific integrase-resolvaseMobilome: prophages, transposons [X] 0.88


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms91.23 %
UnclassifiedrootN/A8.77 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300002245|JGIcombinedJ26739_101641573All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium541Open in IMG/M
3300005167|Ga0066672_10214971All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1229Open in IMG/M
3300005363|Ga0008090_15814078All Organisms → cellular organisms → Bacteria → Proteobacteria1390Open in IMG/M
3300005435|Ga0070714_100683527All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium989Open in IMG/M
3300010361|Ga0126378_10295924All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1721Open in IMG/M
3300010376|Ga0126381_101074652All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1162Open in IMG/M
3300016270|Ga0182036_10327455All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1174Open in IMG/M
3300016270|Ga0182036_11216842All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium627Open in IMG/M
3300016341|Ga0182035_11250873All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium664Open in IMG/M
3300016357|Ga0182032_10785389All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium804Open in IMG/M
3300016371|Ga0182034_10188724All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1584Open in IMG/M
3300016371|Ga0182034_10674741All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium877Open in IMG/M
3300016371|Ga0182034_11790680All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium541Open in IMG/M
3300016371|Ga0182034_11965876All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium517Open in IMG/M
3300016387|Ga0182040_10805739All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium774Open in IMG/M
3300016387|Ga0182040_10886316All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium739Open in IMG/M
3300016387|Ga0182040_11063453All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium677Open in IMG/M
3300016404|Ga0182037_10108181All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria2017Open in IMG/M
3300016404|Ga0182037_10316575All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1260Open in IMG/M
3300016404|Ga0182037_10864138All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium783Open in IMG/M
3300016404|Ga0182037_10871848All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium779Open in IMG/M
3300016445|Ga0182038_10906764All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium777Open in IMG/M
3300016445|Ga0182038_11274778All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium656Open in IMG/M
3300020580|Ga0210403_10337503All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1233Open in IMG/M
3300020580|Ga0210403_10775681All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium763Open in IMG/M
3300020582|Ga0210395_10972892All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium629Open in IMG/M
3300021171|Ga0210405_10531699All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium920Open in IMG/M
3300021403|Ga0210397_10518366All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium904Open in IMG/M
3300021404|Ga0210389_10105719All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria2169Open in IMG/M
3300021432|Ga0210384_10983516All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium745Open in IMG/M
3300021478|Ga0210402_11054938All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium740Open in IMG/M
3300025915|Ga0207693_10126497All Organisms → cellular organisms → Bacteria2009Open in IMG/M
3300026312|Ga0209153_1046526All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1528Open in IMG/M
3300027610|Ga0209528_1025929All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1294Open in IMG/M
3300027737|Ga0209038_10014813All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium2285Open in IMG/M
3300031231|Ga0170824_116040949All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium578Open in IMG/M
3300031543|Ga0318516_10395017All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium797Open in IMG/M
3300031545|Ga0318541_10069923Not Available1838Open in IMG/M
3300031545|Ga0318541_10421265All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium746Open in IMG/M
3300031546|Ga0318538_10731367All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium537Open in IMG/M
3300031549|Ga0318571_10158136All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium787Open in IMG/M
3300031561|Ga0318528_10016674All Organisms → cellular organisms → Bacteria → Proteobacteria3444Open in IMG/M
3300031561|Ga0318528_10392201All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium745Open in IMG/M
3300031561|Ga0318528_10442508All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium698Open in IMG/M
3300031572|Ga0318515_10093074All Organisms → cellular organisms → Bacteria1574Open in IMG/M
3300031668|Ga0318542_10500783All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium631Open in IMG/M
3300031681|Ga0318572_10067127All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1966Open in IMG/M
3300031719|Ga0306917_10254510All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1346Open in IMG/M
3300031723|Ga0318493_10400543All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium751Open in IMG/M
3300031724|Ga0318500_10088503All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1391Open in IMG/M
3300031744|Ga0306918_10664810All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium815Open in IMG/M
3300031744|Ga0306918_11097784All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium616Open in IMG/M
3300031744|Ga0306918_11549585All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium506Open in IMG/M
3300031763|Ga0318537_10250905All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium656Open in IMG/M
3300031771|Ga0318546_10624539All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium758Open in IMG/M
3300031771|Ga0318546_10810807All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium659Open in IMG/M
3300031777|Ga0318543_10313184All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium702Open in IMG/M
3300031781|Ga0318547_10414372All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium828Open in IMG/M
3300031782|Ga0318552_10720868All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium509Open in IMG/M
3300031792|Ga0318529_10513990All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium557Open in IMG/M
3300031793|Ga0318548_10161277All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1095Open in IMG/M
3300031833|Ga0310917_10438157All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium889Open in IMG/M
3300031835|Ga0318517_10412519All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium610Open in IMG/M
3300031835|Ga0318517_10462482All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria572Open in IMG/M
3300031845|Ga0318511_10209269All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium868Open in IMG/M
3300031879|Ga0306919_10311137All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1197Open in IMG/M
3300031879|Ga0306919_10693481All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium784Open in IMG/M
3300031879|Ga0306919_11028305All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium629Open in IMG/M
3300031890|Ga0306925_11056953All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium824Open in IMG/M
3300031890|Ga0306925_11599464All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium634Open in IMG/M
3300031890|Ga0306925_12197521All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium513Open in IMG/M
3300031896|Ga0318551_10784895All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium553Open in IMG/M
3300031897|Ga0318520_11088460Not Available506Open in IMG/M
3300031910|Ga0306923_10630189All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1200Open in IMG/M
3300031910|Ga0306923_11120988All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium846Open in IMG/M
3300031912|Ga0306921_10123971All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium3012Open in IMG/M
3300031912|Ga0306921_10297778All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1889Open in IMG/M
3300031912|Ga0306921_10747835All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales1120Open in IMG/M
3300031912|Ga0306921_11589447All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium711Open in IMG/M
3300031941|Ga0310912_10287368All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1271Open in IMG/M
3300031941|Ga0310912_11124167All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium600Open in IMG/M
3300031945|Ga0310913_10738540All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium695Open in IMG/M
3300031954|Ga0306926_11511172All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium774Open in IMG/M
3300031981|Ga0318531_10124848All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1144Open in IMG/M
3300032001|Ga0306922_12245667All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium525Open in IMG/M
3300032041|Ga0318549_10075604All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1436Open in IMG/M
3300032051|Ga0318532_10299436All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium571Open in IMG/M
3300032054|Ga0318570_10369070All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium654Open in IMG/M
3300032054|Ga0318570_10558288Not Available522Open in IMG/M
3300032055|Ga0318575_10467752All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium640Open in IMG/M
3300032059|Ga0318533_10109503All Organisms → cellular organisms → Bacteria → Proteobacteria1921Open in IMG/M
3300032059|Ga0318533_10502055All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium889Open in IMG/M
3300032060|Ga0318505_10038194All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium2002Open in IMG/M
3300032066|Ga0318514_10697082All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium540Open in IMG/M
3300032068|Ga0318553_10243135All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium940Open in IMG/M
3300032068|Ga0318553_10404010All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae715Open in IMG/M
3300032076|Ga0306924_10437373All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1495Open in IMG/M
3300032076|Ga0306924_10786013All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1062Open in IMG/M
3300032090|Ga0318518_10594472All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium565Open in IMG/M
3300032091|Ga0318577_10509621All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium573Open in IMG/M
3300032261|Ga0306920_102150574All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium777Open in IMG/M
3300032261|Ga0306920_103626047All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium568Open in IMG/M
3300033158|Ga0335077_11243094All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium727Open in IMG/M
3300033289|Ga0310914_11270123All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium638Open in IMG/M
3300033290|Ga0318519_10101987Not Available1546Open in IMG/M
3300033290|Ga0318519_10285151All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium964Open in IMG/M
3300033290|Ga0318519_10443261All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium777Open in IMG/M
3300033290|Ga0318519_10509057All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium726Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil53.51%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil35.96%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil1.75%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil1.75%
Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil1.75%
Bog Forest SoilEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil0.88%
Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil0.88%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil0.88%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere0.88%
Agricultural SoilEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil0.88%
Tropical Rainforest SoilEnvironmental → Terrestrial → Soil → Unclassified → Tropical Rainforest → Tropical Rainforest Soil0.88%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300002245Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027)EnvironmentalOpen in IMG/M
3300005167Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_121EnvironmentalOpen in IMG/M
3300005363Tropical rainforest soil microbial communities from the Amazon Forest, Brazil, analyzing deforestation - Metatranscriptome F II A100 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300005435Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaGEnvironmentalOpen in IMG/M
3300010361Tropical forest soil microbial communities from Panama - MetaG Plot_23EnvironmentalOpen in IMG/M
3300010376Tropical forest soil microbial communities from Panama - MetaG Plot_28EnvironmentalOpen in IMG/M
3300016270Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080EnvironmentalOpen in IMG/M
3300016341Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170EnvironmentalOpen in IMG/M
3300016357Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000EnvironmentalOpen in IMG/M
3300016371Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172EnvironmentalOpen in IMG/M
3300016387Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176EnvironmentalOpen in IMG/M
3300016404Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082EnvironmentalOpen in IMG/M
3300016445Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108EnvironmentalOpen in IMG/M
3300020580Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-MEnvironmentalOpen in IMG/M
3300020582Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-OEnvironmentalOpen in IMG/M
3300021171Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-MEnvironmentalOpen in IMG/M
3300021403Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-OEnvironmentalOpen in IMG/M
3300021404Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-OEnvironmentalOpen in IMG/M
3300021432Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-MEnvironmentalOpen in IMG/M
3300021478Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-MEnvironmentalOpen in IMG/M
3300025915Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300026312Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_120 (SPAdes)EnvironmentalOpen in IMG/M
3300027610Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M3 (SPAdes)EnvironmentalOpen in IMG/M
3300027737Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP03_OM3 (SPAdes)EnvironmentalOpen in IMG/M
3300029636Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031231Coassembly Site 11 (all samples) - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031543Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f20EnvironmentalOpen in IMG/M
3300031545Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f26EnvironmentalOpen in IMG/M
3300031546Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f23EnvironmentalOpen in IMG/M
3300031549Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f24EnvironmentalOpen in IMG/M
3300031561Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f26EnvironmentalOpen in IMG/M
3300031572Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f19EnvironmentalOpen in IMG/M
3300031668Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f23EnvironmentalOpen in IMG/M
3300031681Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f20EnvironmentalOpen in IMG/M
3300031719Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 (v2)EnvironmentalOpen in IMG/M
3300031723Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f23EnvironmentalOpen in IMG/M
3300031724Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f20EnvironmentalOpen in IMG/M
3300031744Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H (v2)EnvironmentalOpen in IMG/M
3300031763Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f29EnvironmentalOpen in IMG/M
3300031771Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f19EnvironmentalOpen in IMG/M
3300031777Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f24EnvironmentalOpen in IMG/M
3300031781Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f20EnvironmentalOpen in IMG/M
3300031782Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f20EnvironmentalOpen in IMG/M
3300031792Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f23EnvironmentalOpen in IMG/M
3300031793Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f21EnvironmentalOpen in IMG/M
3300031833Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF178EnvironmentalOpen in IMG/M
3300031835Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f21EnvironmentalOpen in IMG/M
3300031845Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f18EnvironmentalOpen in IMG/M
3300031879Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 (v2)EnvironmentalOpen in IMG/M
3300031890Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2)EnvironmentalOpen in IMG/M
3300031896Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f19EnvironmentalOpen in IMG/M
3300031897Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f16EnvironmentalOpen in IMG/M
3300031910Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2)EnvironmentalOpen in IMG/M
3300031912Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2)EnvironmentalOpen in IMG/M
3300031941Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX080EnvironmentalOpen in IMG/M
3300031945Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX082EnvironmentalOpen in IMG/M
3300031954Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2)EnvironmentalOpen in IMG/M
3300031981Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f25EnvironmentalOpen in IMG/M
3300032001Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2)EnvironmentalOpen in IMG/M
3300032041Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f22EnvironmentalOpen in IMG/M
3300032051Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f26EnvironmentalOpen in IMG/M
3300032054Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f23EnvironmentalOpen in IMG/M
3300032055Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f23EnvironmentalOpen in IMG/M
3300032059Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f27EnvironmentalOpen in IMG/M
3300032060Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f18EnvironmentalOpen in IMG/M
3300032066Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f18EnvironmentalOpen in IMG/M
3300032068Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f21EnvironmentalOpen in IMG/M
3300032076Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2)EnvironmentalOpen in IMG/M
3300032090Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f22EnvironmentalOpen in IMG/M
3300032091Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f25EnvironmentalOpen in IMG/M
3300032261Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2)EnvironmentalOpen in IMG/M
3300033158Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.1EnvironmentalOpen in IMG/M
3300033289Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN108EnvironmentalOpen in IMG/M
3300033290Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f15EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
JGIcombinedJ26739_10164157323300002245Forest SoilMTPHELADAARNLAHALGITVYIRDGRIYQHGPGVEVLPPPGAHPT
Ga0066672_1021497123300005167SoilMTPHELADAARNLAHALGITVYIRDGRIYQHGPGVEILPPPGACPT
Ga0008090_1581407833300005363Tropical Rainforest SoilMTPDQLRGAARNLARGLGIPVYIRDGRIYQDGPGLAFLPPNGDPAVAEV
Ga0070714_10068352713300005435Agricultural SoilMTSDELADAARNLAHALGIAVYIRDGRIYQHGPGIEILPPPG
Ga0126378_1029592443300010361Tropical Forest SoilMTPAQLRGAARKLAYGRGIPVYIRDRRIYQDGPGLAFFPPNGDPAVAEVTLDQR
Ga0126381_10107465223300010376Tropical Forest SoilMTPEQLRHAARNLARGLGIPLYIRDGRIYQDGPGLAFLPPNGDPAVAEEEEVDAANGSLTVPQAFGF
Ga0182036_1032745513300016270SoilMTPDQLADAARNLAYGLGIPVYVRDGRIYQNGPGLAFLPPSGTRPTVADAPF
Ga0182036_1121684213300016270SoilMTPDQLRGATRNLAYGLGIAVYIRDDRIYQNGPGLAFLPPNGDPAVTEVP
Ga0182035_1125087313300016341SoilMTPNQLANAARNLAYGLGIPLYVRDERIYQNGPGLAFLPPNGAPA
Ga0182032_1078538923300016357SoilMTPDQLRRAARNLAYGLGIPFYIRDGRIYQFGPGLVFLPPNGDTEVAE
Ga0182034_1018872433300016371SoilMTPDQLRGAARNLAYGLGIPVYIRDGRIYQDGPGRAFLPPNGDPAEAPFDQKEEVDAANESIT
Ga0182034_1067474113300016371SoilMLNKGTTAMTPDQLCRAARNLAYGLGIPVYIRDGRIYQEGPGVAFLPLNGDPVVAEVP
Ga0182034_1179068013300016371SoilMTPDQLRGATRNLAYGLGIAVYIRDDRIYQNGPGLAFLPPNGDPAV
Ga0182034_1196587613300016371SoilMLSKGRSAMTPEQLRRAARNLAYGLGIPFYIRDGRIYQFGPGL
Ga0182040_1080573913300016387SoilMNPDQLRGAARNLAYGLGIPVYIRDDRIYQNGPGLAFLPPNGDPPVTEVPFDQKEEAN
Ga0182040_1088631623300016387SoilMTPNELADAARNLAYGLGIPVYVRDGRIYQNGPGLAFLPPSG
Ga0182040_1106345323300016387SoilMTPDQLRRAARNLAYGLGIPFYIRDGRIYQFGPGL
Ga0182037_1010818113300016404SoilMTPDQLRGATRNLAYGLGIAVYIRDDRIYQNGPGLAFLPPNGDPAVTEVPLDQEEEANTA
Ga0182037_1031657523300016404SoilMTPDQLRGAARNLSYALGIPVYIRDGRIYQNGPGLAFLPPNGDPVVAKVPLDQEEEA
Ga0182037_1086413813300016404SoilMTPAQLRGAARNLAYGLGIPVYIRDGRIYQDGPGLAFLPPNGDPAAAEVPLDQREEADAANG
Ga0182037_1087184813300016404SoilMTPDQLRGAARNLAHGLGIPVYIRDGRIYQNGPGLAFLPPNGDPA
Ga0182038_1090676423300016445SoilMTPDQLRGAARNLAYGLGITFYIRDDRIYQNGPGLAFLPPNGGPAV
Ga0182038_1127477823300016445SoilMTPNQLASAARNLAYGLGIPVYVRDGRIYQAGPGLAFLPPNGDPAV
Ga0210403_1033750313300020580SoilMTPDELADAARNLAHALGITVYIRDGRIYQHGPGIEVLPPP
Ga0210403_1077568123300020580SoilMTPDELADAARNLAHALGITVYIRDGRIYQHGPGIEV
Ga0210395_1097289223300020582SoilMTPEELADAARNLAHALGITVYIRDGRIYQHGPGVEI
Ga0210405_1053169913300021171SoilMTPDALADAARNLAHALGITVYIRDGRIYQHGPGVEILPP
Ga0210397_1051836623300021403SoilMTPDELADAARNLAHALGITVYIRDGRIYQHGPGI
Ga0210389_1010571943300021404SoilMTPDELADAARNLAHALGITVYIRDGRIYQHGPGVEILPQPG
Ga0210384_1098351613300021432SoilMTPEELADAARNLAHALGITVYIRDGRIYQHGPGVEILP
Ga0210402_1105493823300021478SoilMTPNQLTSAARNLAYGLGIPVYVRDGRIYQNGPGLGFL
Ga0207693_1012649733300025915Corn, Switchgrass And Miscanthus RhizosphereMTPDQLTGAARDLAHGLGIPVYIRDGRIYQHGPGLAFLPPSSVRPAAGDASS
Ga0209153_104652613300026312SoilMTPHELADAARNLAHALGITVYIRDGRIYQHGPGVEILPPPGACPTT
Ga0209528_102592913300027610Forest SoilMTPDELADAARNLAHALGITVYIRDGRIYQHGPGIE
Ga0209038_1001481313300027737Bog Forest SoilMTPAELADAARNLAHALGITVYIRDGRIYQHGPGIEILPP
Ga0222749_1057974513300029636SoilMTPDELIGAARKLAHGLGIPVYIRDGRIYQRGPGTEFLPPNGVGPTVEEEGFFETDERG
Ga0170824_11604094923300031231Forest SoilMTPNQLASAARNLAYGLGIPVYVRDGRIYQHGPGLAFLPANGDPAVAEFPLDQKEE
Ga0318516_1039501713300031543SoilMTPDQLRGAARNLSYALGIPVYIRDGRIYQNGPGLAFLPPNGDPVVAKV
Ga0318541_1006992323300031545SoilMMTPDELSGAARNLAHGLGIPVYIRDGRIYQHGPGIEF
Ga0318541_1042126523300031545SoilMTPDQLRGAARNLSYGLGIPVYIRDGRIYQNGPGLAFLPPNGDPVVAEVPLDQEEEADAALTMPK
Ga0318538_1073136713300031546SoilMTPDQLRGAARNLSYGLGIPVYIRDGRIYQNGPGLAFLPPNGDPVVAKVPLDQEE
Ga0318571_1015813613300031549SoilMTPDQLRGAARNLAHGLGIPVYIRDGRIYQNGPGLAFLPPNGDPAVPEVTLAHEPDIANASLTMPK
Ga0318528_1001667473300031561SoilMPSRGKAVMTPDQLRGAARNLAYGLGIPVYIRDDRIYQNGAGLAFLPPNGDPPVTEVPFDQKEEAN
Ga0318528_1039220113300031561SoilMTPDQLRGAARNLSYGLGIPVYIRDGRIYQNGPGLAFLPPNGDPVVAEV
Ga0318528_1044250823300031561SoilMTPNELADAARNLAYGLGIPVYVRDGRIYQNGPGLAFLPPSGTR
Ga0318515_1009307413300031572SoilMTPDQLRGAARNLAYGLGIPIYIRDDRIYQNGPGLAFLPPNGDPAVTEVPLDQ
Ga0318542_1050078313300031668SoilTSAARNLAHGLGIPVYIRDGRIYQDGPGLVFLPSNGSRPTVADATSHGK
Ga0318572_1006712753300031681SoilMPSRGKAVMTPDQLRGAARNLAYGLGIPVYIRDDRIYQNGPGLAFLPPNGDPPVTEVPFDQKE
Ga0306917_1025451013300031719SoilMTPNQLRGAARNLAYGLGIPVYIRDGRICQDGPGLAFLPPNGDPAVAKV
Ga0318493_1040054313300031723SoilMTPDQLRGAARNLAYGLGIPVYIRDGRIYQNGPGLAFLPPSGDPAVAEVPL
Ga0318500_1008850343300031724SoilMTPDQLADAARNLAYGLGIPVYVRDGRIYQNGPGLAFLPPSGTRPTVADA
Ga0306918_1066481033300031744SoilMTPDQLRGAARNLAYGLGIPVYIRDDRIYQNGPGLAFLPPNGDPPVTEVP
Ga0306918_1109778413300031744SoilMTPDQLRGAARNLSYGLGIPVYIRDGRIYQNGPGLAFLPPNGDPVVAEVPLDQEEEADAALTMP
Ga0306918_1125677423300031744SoilMLNKGTTAMTPDQLCRAARNLAYGLGIPVYIRGGRIYQEGPGAAFLPQNGDPAVAEV
Ga0306918_1154958523300031744SoilMTPNQLAGAARNLAYGLGIPLYVRDGRIYQNGPGLAFLPPNGAPALAEVPLDQND
Ga0318537_1025090523300031763SoilMTPDQLRGAARNLAYGLGIPVYIRDDRIYQNGPGLAFLPPNGDPAVAKVPLDQ
Ga0318546_1062453933300031771SoilMTPDQLRGATRNLAYGLGIAVYIRDDRIYQNGPGLAFLPPNGDPAVTEVPL
Ga0318546_1081080723300031771SoilMTPDQLRGAARNLAHGLGIPVYIRDGRIYQNGPGLAFLPPNGDPAVPEVTLAHEPDIANASLTMP
Ga0318546_1100093113300031771SoilMTPDQLTGAARNLAHGLGIPVYIRDGRIYQDGPGVAFLPPSGARST
Ga0318543_1031318413300031777SoilMTPDQLRVAARNLAYGLGIPFYIRDSRIYQDGPGLAFLPPNGDPAEAPFDQKE
Ga0318543_1036563023300031777SoilMTPDQLTGAARNLAHGLGIPVYIRDGRIYQDGPGVAFLPPSGARSTVA
Ga0318547_1041437213300031781SoilMTPDQLRGAARNLAFGLGIPVYIRDGRIYQDAPGLAFLPPNGDPAVAKVPLDQADA
Ga0318552_1072086813300031782SoilMLSEGTGAMTPEQLCRAARNLAYGLGITVYIRDGKIYQFGPGLAFLPPNGDPEVAEVPRDNG
Ga0318529_1051399023300031792SoilMTPDQLHRAARNLAYGLGIPFYIRDGRIYQFGPGLVFLPPNGDTEVAEIPLDIGSLT
Ga0318548_1016127723300031793SoilMTPNELADAARNLAYGLGIPVYVRDGRIYQNGPGLA
Ga0310917_1043815713300031833SoilMTPDQLRGAARNLARGLGIPFYIRDGRIYQDGPGLAFLPPNGD
Ga0318517_1041251913300031835SoilMTPDQLRNAARNLAYGLDIPVYIRDGRIYQNGPGLAFLP
Ga0318517_1046248213300031835SoilMTPDQLRGAARNLAYGLGIPVYIRDDRIYQNGPGLAFLPPNGDPPVTEVPLDQKEEAN
Ga0318511_1020926913300031845SoilMTPDQLCRAARNLAYGLGIPVYIRDGRIYQEGPGVAFLPLNGDPVVAEV
Ga0306919_1031113733300031879SoilMTPDQLRVAARNLAYGLGIPFYIRDSRIYQDGPGLAFLPPNGDPAEAPFDQKEE
Ga0306919_1069348113300031879SoilMTPNQLRDAARNLAYGLGIPVYIRDGRICQDGPGLAFLPPNGDPAVAKV
Ga0306919_1102830513300031879SoilMTPNELADAARNLAYGLGIPVYVRDGRIYQNGPGLAFLPPSGTRPTVADA
Ga0306925_1105695313300031890SoilMTPNQLAGAARNLAYGLGIPLYVRDGRIYQNGPGLAFLPSNGAPAL
Ga0306925_1159946423300031890SoilMTPDQLRRAARNLAYGLGIPFYIRDGRIYQFGPGLVFLPPNGDTEVAEIPL
Ga0306925_1219752113300031890SoilMTPNQLRRAARNLAYGLGIPVYIRDGRIYQDGPGLAFLPPNGDLAAAEV
Ga0318551_1078489513300031896SoilMMTPDELSGAARNLAHGLGIPVYIRDGRIYQHGPGIEFLPPKYDGAI
Ga0318520_1108846023300031897SoilMTPNQLADAARNLAHGLGIPVYIRDGRLYQHGPSLPFLR
Ga0306923_1063018913300031910SoilMLSEGTGAMTPEQLCRAARNLAYGLGITVYIRDGKIYQFGPGLAFLPPNGDPEVAEVPRDNGSLTLPK
Ga0306923_1112098823300031910SoilMTPDQLRSAARNLSFGLGIPVYIRDGRIYQNGPGLAFLPPNGDPAVPEVPFAHEPDSANGSLTIAKA
Ga0306921_1012397163300031912SoilMTPDQLRVAARNLAYGLGIPFYIRDSRIYQDGPGLAFLPPNGDPAEAP
Ga0306921_1029777813300031912SoilMTPDQLRGAARNLSYALGIPVYIRDGRIYQDGPGLAFLPPKATQR
Ga0306921_1074783513300031912SoilMTPDQLRGAARNLAYGLGIPFYIRDDRIYQNGPGFAFLPPNGGPAVT
Ga0306921_1158944713300031912SoilMTSDQLTSAARNLAHGLGIPVYIRDGRIYQDGPGLVFLPSNGSRP
Ga0310912_1028736813300031941SoilMTPNQLRGAARNLAYGLGIPFYIRDGRICQDGPGLAFLPPNGDPAVAKVPLDQKEEADAANG
Ga0310912_1046573423300031941SoilMTPDQLRGAARNLAYGLGITFYIRDDRIYQNGPGLAFLPPNGGP
Ga0310912_1112416723300031941SoilMLSKGRAAMTPDQLRGAARSLAYGLGIPVYIRDGRIYQDGPGLAFLPPNGDPTM
Ga0310913_1073854013300031945SoilMTPDQLRRAARNLAYGLGITVYIRDGKIYQFGPGLAFLPPNGDPEAAEVPRDNGSLTMPK
Ga0306926_1151117213300031954SoilMTPDQLRVAARNLAYGLGIPFYIRDSRIYQDGPGLAFLPPNGDPAEAPFDQKEEVDAANESITVP
Ga0318531_1012484813300031981SoilMTPNELADAARNLAYGLGIPVYVRDGRIYQNGPGLAFLPPSGTRPT
Ga0306922_1032263013300032001SoilMTPDQLRGAARNLSYALGIPVYIRDGRIYQEGPGLAFLPPN
Ga0306922_1224566723300032001SoilMTPDQLRRAARNLAYGLGIPFYIRDGRIYQFGPGLV
Ga0318549_1007560413300032041SoilMTPDQLRGAARNLAYGLGIPVYIRDGRIYQDAPGLAFLPPNGDPAVAKVPLDQADA
Ga0318532_1029943623300032051SoilMTPDQLRRAARNLAYGLGIPFYIRDGRIYQFGPGLVFL
Ga0318570_1036907023300032054SoilMTPDQLRNAARNLAYGLDIPVYIRDGRIYQNGPGLAFLPPNGDPAVPEVP
Ga0318570_1055828813300032054SoilMTPNQLADAARNLAHGLGIPVYIRDGRLYQHGPSLAFLRPSDTHP
Ga0318575_1046775223300032055SoilMTPDQLRGATRNLAYGLGIAVYIRDDRIYQNGPGLAFLPPNGDPAVTEVPLDQEEEAN
Ga0318533_1010950333300032059SoilMLSRGRSAMTPDQLRRAARNLAYGLGIPFYIRDGRIYQFGPGLVFLPPNGDTEVAEIPLDNG
Ga0318533_1050205523300032059SoilMTPEELTSAARNLAHALGIPVYIRDGRIYQHGPGVVVLPPPGAC
Ga0318505_1003819443300032060SoilMTPDQLRGAARNLAYGLGIPVYIRDDRIYQNGPGLAFLPPNGDPPVTEVPF
Ga0318514_1069708213300032066SoilMTPDQLRGAARNLAYGLGIPCYIRDDRIYQNGPGLAFLPPNGGPAVTEVPLDQEEEANTASVS
Ga0318553_1024313513300032068SoilMTPDQLRGAARNLAYGLGIPFYIRDDRIYQNGPGLAFLPPNGGPAVTEVPLDQEEEANTASVSITI
Ga0318553_1040401033300032068SoilMTPDELARAARNLAHSLGIPVYIRNGRIYQHGPGVEFLPPSGVRSTVAG
Ga0306924_1043737313300032076SoilMTPDQLRVAARNLAYGLGIPFYIRDSRIYQDGPGLAFLPPNGDPAEAPFDQKEEVDAANESI
Ga0306924_1078601323300032076SoilMTPDQLRGAARNLAYGLGIPVYIRDGRIYQAGPGLAFLPPNGDPEVPEVLLDQKEAADTA
Ga0318518_1059447213300032090SoilMTPDQLHNAARNLAYGLGIAVYVRDGRIYQNGPGLAFLPPNG
Ga0318577_1050962113300032091SoilMTPDQLRRAARNLAYGLGIPFYIRDGRIYQFGPGLAFLPPNSDTEVAEIPLD
Ga0306920_10215057413300032261SoilMTPDQLRRAARNLAYGLGIPFYIRDGRIYQFGPGLVFLPPNGD
Ga0306920_10362604713300032261SoilMTPDQLRSAARNLSFGLGIPVYIRDGRIYQNGPGLAFLPPNGDPAVPEVPFAHEPDSANGSLTIAKAI
Ga0335077_1124309413300033158SoilMTPEQLADNARNLAHALGIAVYIRDGRIYQHGPGIEILPPPGAH
Ga0310914_1127012323300033289SoilMTPDQLRRAARNLAYGLGIPFYIRDGRIYQFGPGLVFLPPNGDTE
Ga0318519_1010198713300033290SoilMTPDQLRNAARNLAYGLDIPVYIRDGRIYQNGPGLAFLPPNGDPAVTEVP
Ga0318519_1028515113300033290SoilMTPDQLRGAARNLAHGLGIPVYIRDGRIYQNGPGLAFLPPNGDPAVPEVTLAHEPDIAN
Ga0318519_1044326113300033290SoilMTPDQLTSAARNLAHGLGIPVYIRDGRIYQDGPGLAFLPPSATRPVVA
Ga0318519_1050905723300033290SoilMTPDQLHNAARNLAYGLGIAVYVRDGRIYQNGPGLAFLPPNGDPAVPEVPHEPDIANGSLTFDKA


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.