Metagenome / Metatranscriptome Family F080773

Basic Information
Family ID	F080773
Family Type	Metagenome / Metatranscriptome
Number of Sequences	114
Average Sequence Length	43 residues
Representative Sequence	MGSSLALSCNIRSFVIELDYGYRYLLEVYSELSSICFLSWLRY
Number of Associated Samples	71
Number of Associated Scaffolds	114

Quality Assessment
Transcriptomic Evidence	Yes
Most common taxonomic group	Unclassified
% of genes with valid RBS motifs	100.00 %
% of genes near scaffold ends (potentially truncated)	13.16 %
% of genes from short scaffolds (< 2000 bps)	13.16 %
Associated GOLD sequencing projects	70
AlphaFold2 3D model prediction	Yes
3D model pTM-score	0.55

Most Common Taxonomy
Group	Unclassified (99.123 % of family members)
NCBI Taxonomy ID	N/A
Taxonomy	N/A

Most Common Ecosystem
GOLD Ecosystem	Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Switchgrass Phyllosphere (73.684 % of family members)
Environment Ontology (ENVO)	Unclassified (88.596 % of family members)
Earth Microbiome Project Ontology (EMPO)	Host-associated → Plant → Plant surface (80.702 % of family members)

Full Alignment
Alignment of all the sequences in the family.

Powered by MSAViewer

Seed Alignment
Alignment of a non-redundant set of sequences, used to build the family's HMM profile.

Powered by MSAViewer

AlphaFold2 Input Alignment
Refined alignment used as input for AlphaFold2.

Powered by MSAViewer

Predicted Topology & Secondary Structure
Classification:	Globular	Signal Peptide:	No	Secondary Structure distribution:	α-helix: 57.75% β-sheet: 0.00% Coil/Unstructured: 42.25%
Feature Viewer

Powered by Feature Viewer

Pfam ID	Name	% Frequency in 114 Family Scaffolds
PF13456	RVT_3	0.88
PF00078	RVT_1	0.88

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	99.12 %
All Organisms	root	All Organisms	0.88 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	99.12 %
cellular organisms	root	All Organisms → cellular organisms	0.88 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	99.12 %
Eukaryota	superkingdom	All Organisms → cellular organisms → Eukaryota	0.88 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	99.12 %
Viridiplantae	kingdom	All Organisms → cellular organisms → Eukaryota → Viridiplantae	0.88 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	99.12 %
Streptophyta	phylum	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta	0.88 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	99.12 %
Streptophytina	subphylum	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina	0.88 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	99.12 %
Embryophyta	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	0.88 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	99.12 %
Tracheophyta	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta	0.88 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	99.12 %
Euphyllophyta	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta	0.88 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	99.12 %
Spermatophyta	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta	0.88 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	99.12 %
Magnoliopsida	class	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida	0.88 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	99.12 %
Mesangiospermae	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae	0.88 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	99.12 %
Liliopsida	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida	0.88 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	99.12 %
Petrosaviidae	subclass	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae	0.88 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	99.12 %
commelinids	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids	0.88 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	99.12 %
Poales	order	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales	0.88 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	99.12 %
Poaceae	family	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae	0.88 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	99.12 %
PACMAD clade	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade	0.88 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	99.12 %
Panicoideae	subfamily	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae	0.88 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	99.12 %
Panicodae	no rank	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae	0.88 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	99.12 %
Paniceae	tribe	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae	0.88 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	99.12 %
Panicinae	subtribe	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae	0.88 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	99.12 %
Panicum	genus	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum	0.88 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	99.12 %
Panicum sect. Hiantes	section	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes	0.88 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	99.12 %
Panicum virgatum	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	0.88 %

Visualization

Powered by ApexCharts

Associated Scaffolds

Scaffold	Taxonomy	Length	IMG/M Link
3300009988\|Ga0105035_109341	Not Available	849	Open in IMG/M
3300010399\|Ga0134127_11881933	Not Available	675	Open in IMG/M
3300010403\|Ga0134123_11219537	Not Available	783	Open in IMG/M
3300015301\|Ga0182184_1086038	Not Available	532	Open in IMG/M
3300015327\|Ga0182114_1146844	Not Available	524	Open in IMG/M
3300015331\|Ga0182131_1121586	Not Available	557	Open in IMG/M
3300015333\|Ga0182147_1005094	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	1595	Open in IMG/M
3300015334\|Ga0182132_1165521	Not Available	507	Open in IMG/M
3300015348\|Ga0182115_1189869	Not Available	659	Open in IMG/M
3300015349\|Ga0182185_1036686	Not Available	1229	Open in IMG/M
3300015352\|Ga0182169_1305336	Not Available	512	Open in IMG/M
3300017421\|Ga0182213_1236441	Not Available	523	Open in IMG/M
3300017439\|Ga0182200_1132521	Not Available	543	Open in IMG/M
3300032465\|Ga0214493_1101611	Not Available	682	Open in IMG/M
3300032934\|Ga0314741_1150948	Not Available	518	Open in IMG/M

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:

Habitat	Taxonomy	Distribution
Host-Associated	Host-Associated	94.74%
Environmental	Environmental	5.26%

Habitat	Taxonomy	Distribution
Plants	Host-Associated → Plants	94.74%
Terrestrial	Environmental → Terrestrial	5.26%

Habitat	Taxonomy	Distribution
Phyllosphere	Host-Associated → Plants → Phyllosphere	78.95%
Unclassified	Host-Associated → Plants → Unclassified	8.77%
Soil	Environmental → Terrestrial → Soil	5.26%
Rhizosphere	Host-Associated → Plants → Rhizosphere	4.39%
Rhizoplane	Host-Associated → Plants → Rhizoplane	1.75%
Roots	Host-Associated → Plants → Roots	0.88%

Habitat	Taxonomy	Distribution
Unclassified	Host-Associated → Plants → Phyllosphere → Unclassified	78.95%
Unclassified	Host-Associated → Plants → Unclassified → Unclassified	8.77%
Unclassified	Environmental → Terrestrial → Soil → Unclassified	4.39%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified	4.39%
Epiphytes	Host-Associated → Plants → Rhizoplane → Epiphytes	1.75%
Loam	Environmental → Terrestrial → Soil → Loam	0.88%
Rhizosphere	Host-Associated → Plants → Roots → Rhizosphere	0.88%

Habitat	Taxonomy	Distribution
Unclassified	Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified	78.95%
Unclassified	Host-Associated → Plants → Unclassified → Unclassified → Unclassified	8.77%
Unclassified	Environmental → Terrestrial → Soil → Unclassified → Unclassified	4.39%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified	4.39%
Unclassified	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified	1.75%
Agricultural Soil	Environmental → Terrestrial → Soil → Loam → Agricultural Soil	0.88%
Soil	Host-Associated → Plants → Roots → Rhizosphere → Soil	0.88%

Habitat	Taxonomy	Distribution
Switchgrass Phyllosphere	Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Switchgrass Phyllosphere	73.68%
Switchgrass Associated	Host-Associated → Plants → Unclassified → Unclassified → Unclassified → Switchgrass Associated	8.77%
Phyllosphere	Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Phyllosphere	5.26%
Terrestrial Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil	4.39%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere	2.63%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere	1.75%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere	1.75%
Switchgrass Rhizosphere	Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere	0.88%
Switchgrass Rhizosphere	Host-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere	0.88%

Visualization

Powered by ApexCharts

Associated Samples

Taxon OID	Sample Name	Habitat Type	IMG/M Link
3300005841	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2	Host-Associated	Open in IMG/M
3300009553	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG	Host-Associated	Open in IMG/M
3300009972	Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_224 metaG	Host-Associated	Open in IMG/M
3300009973	Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_222 metaG	Host-Associated	Open in IMG/M
3300009988	Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_233 metaG	Host-Associated	Open in IMG/M
3300009989	Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_197 metaG	Host-Associated	Open in IMG/M
3300009990	Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_206 metaG	Host-Associated	Open in IMG/M
3300009994	Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_171 metaG	Host-Associated	Open in IMG/M
3300009995	Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_227 metaG	Host-Associated	Open in IMG/M
3300010373	Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4	Environmental	Open in IMG/M
3300010399	Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3	Environmental	Open in IMG/M
3300010400	Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2	Environmental	Open in IMG/M
3300010403	Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3	Environmental	Open in IMG/M
3300014325	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG	Host-Associated	Open in IMG/M
3300014326	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG	Host-Associated	Open in IMG/M
3300014968	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG	Host-Associated	Open in IMG/M
3300015273	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_09MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015280	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_09MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015284	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_09MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015290	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_09MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015293	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_09MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015301	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_22AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015306	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_22AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015309	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_MAIN_09MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015311	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_22AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015313	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_01AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015316	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_31MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015317	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_20JUN2016_LD1 MG	Host-Associated	Open in IMG/M
3300015319	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_MAIN_20JUN2016_LD1 MG	Host-Associated	Open in IMG/M
3300015320	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_01AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015325	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_12JUL2016_LD1 MG	Host-Associated	Open in IMG/M
3300015326	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_01AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015327	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_MAIN_31MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015328	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_12JUL2016_LD1 MG	Host-Associated	Open in IMG/M
3300015331	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_20JUN2016_LD1 MG	Host-Associated	Open in IMG/M
3300015332	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_31MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015333	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_12JUL2016_LD1 MG	Host-Associated	Open in IMG/M
3300015334	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_20JUN2016_LD1 MG	Host-Associated	Open in IMG/M
3300015335	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_31MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015336	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_12JUL2016_LD1 MG	Host-Associated	Open in IMG/M
3300015337	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_12JUL2016_LD1 MG	Host-Associated	Open in IMG/M
3300015339	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_12JUL2016_LD1 MG	Host-Associated	Open in IMG/M
3300015348	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_31MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015349	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_22AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015350	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_01AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015352	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_01AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015353	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_22AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015354	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_01AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300017412	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_12SEP2016_LD1 MG	Host-Associated	Open in IMG/M
3300017414	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_12SEP2016_LD1 MG	Host-Associated	Open in IMG/M
3300017421	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_03OCT2016_LD1 MG	Host-Associated	Open in IMG/M
3300017422	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_12SEP2016_LD1 MG	Host-Associated	Open in IMG/M
3300017439	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_12SEP2016_LD1 MG	Host-Associated	Open in IMG/M
3300017440	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_03OCT2016_LD1 MG	Host-Associated	Open in IMG/M
3300017445	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_12SEP2016_LD1 MG	Host-Associated	Open in IMG/M
3300017693	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_03OCT2016_LD1 MG	Host-Associated	Open in IMG/M
3300025918	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes)	Environmental	Open in IMG/M
3300025961	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300028050	Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_NF_17JUL2017_LD1	Host-Associated	Open in IMG/M
3300028061	Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_NF_05JUN2017_LD1	Host-Associated	Open in IMG/M
3300028140	Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_MAIN_07AUG2017_LD1	Host-Associated	Open in IMG/M
3300028154	Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R2_MAIN_28AUG2017_LD1	Host-Associated	Open in IMG/M
3300028475	Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R4_MAIN_17JUL2017_LD1	Host-Associated	Open in IMG/M
3300032465	Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R4_MAIN_12JUL2016_LR1 (Metagenome Metatranscriptome)	Host-Associated	Open in IMG/M
3300032502	Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_MAIN_12JUL2016_LR1 (Metagenome Metatranscriptome)	Host-Associated	Open in IMG/M
3300032625	Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R4_MAIN_12SEP2016_LR1 (Metagenome Metatranscriptome)	Host-Associated	Open in IMG/M
3300032791	Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_07AUG2017_LR1 (Metagenome Metatranscriptome)	Host-Associated	Open in IMG/M
3300032913	Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_MAIN_17JUL2017_LR1 (Metagenome Metatranscriptome)	Host-Associated	Open in IMG/M
3300032934	Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_17JUL2017_LR1 (Metagenome Metatranscriptome)	Host-Associated	Open in IMG/M
3300033534	Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_28AUG2017_LR1 (Metagenome Metatranscriptome)	Host-Associated	Open in IMG/M
3300033538	Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_MAIN_28AUG2017_LR1 (Metagenome Metatranscriptome)	Host-Associated	Open in IMG/M

Geographical Distribution

Zoom:	Powered by OpenStreetMap

Family Sequences

Protein ID	Sample Taxon ID	Habitat	Sequence
Ga0068863_1015541452	3300005841	Switchgrass Rhizosphere	MGSSLALSFNIRSFVIELDYGYRYLLEVYSELSDICFLIWLRYCSMLAL
Ga0068863_1024469511	3300005841	Switchgrass Rhizosphere	MGSSLALSCNIRSFVIELDYGYRYLLEVYSELSDICFLIW
Ga0105249_115356141	3300009553	Switchgrass Rhizosphere	MGSSLALSCNIRAFVIELDYGYQYLLEVYSELSSI
Ga0105137_1027201	3300009972	Switchgrass Associated	MGSSLALSCNIRLFVTELDYGYQYLLEVCSELSDI
Ga0105137_1033451	3300009972	Switchgrass Associated	MRSSLALSCNIRSFVIELDYGYRYLLEVYSELSVIC
Ga0105136_1075881	3300009973	Switchgrass Associated	MGLSLVISCNIRLFVIELDYGYRYMLEVCSELSDICFL
Ga0105035_1093411	3300009988	Switchgrass Rhizosphere	MSSSLALSCNIRSFVIELDYGYRYLLEVCSELSDICFLIWLRYYSMLALHDR
Ga0105131_1144341	3300009989	Switchgrass Associated	MGSSLALSCNIQSFVIELDYGYQYLLEVYSELSSIC
Ga0105132_1086411	3300009990	Switchgrass Associated	MGSSLSLSCNVRLFVIELDYGYRYLLKVCSELSDI
Ga0105126_10133861	3300009994	Switchgrass Associated	MGSSLTLSYNIRSFVIELDYGYRYLFEVYSKLSSICLLSWLRYYSMLALHD
Ga0105139_10449141	3300009995	Switchgrass Associated	MGSSLVLSCNSQSFVIELDYGYRYLLEVCSELSDICFVIWLCYHSMLVLH
Ga0105139_10822151	3300009995	Switchgrass Associated	MGSSLVLSYNIRSFVIELDYSYRYLLEVCSELSDICFLIWLYY
Ga0105139_10844732	3300009995	Switchgrass Associated	MGLSLVLSCNIWLFKIELDYGYRYLLEVCSESSDICFLIWLR
Ga0105139_11173041	3300009995	Switchgrass Associated	MGSSLALSCNIRLFVIELDYGYRYLLDICSELLDICFVIWLRYHSM
Ga0134128_113456691	3300010373	Terrestrial Soil	MGSSLPLSCNIRSFVIELDYGYRYLLEVYSELSSI
Ga0134127_118819331	3300010399	Terrestrial Soil	MGSSLALSCNIWLFVIELDYGYRCLLEVCSELSDICFLISLHYYSMLSLHDRP
Ga0134122_112557191	3300010400	Terrestrial Soil	MGSSLALSCNIRSFVIELDYDYGYLLEVCSESSDICFLSWLCYYSML
Ga0134123_112195372	3300010403	Terrestrial Soil	MGSSLVLFCNIWLFVIELDYGYRYLLEVYSELSSICFLSWLHYYSMISLHNC
Ga0134123_131519952	3300010403	Terrestrial Soil	MGSSLALSCNIRLFVIELDYGYRYLLEVYSELSSI
Ga0163163_124778941	3300014325	Switchgrass Rhizosphere	MGSSLALSCNIRLFVIELDYGYRYLLEVYSELSSICFLSWLRYHS
Ga0157380_128054021	3300014326	Switchgrass Rhizosphere	MGSSLALSCNIQLFVIELDYGYRYLLEVYSELSTICFLSWLRYHSMLAL
Ga0157379_117575141	3300014968	Switchgrass Rhizosphere	MGSSLALSCNIRLFVIELDYGYRYLLEVYSELSSICFLSWL
Ga0182102_10349851	3300015273	Switchgrass Phyllosphere	MGSPLALSCNIRSFVIKLDYGYRYLLEVYSELSSICF
Ga0182100_10217421	3300015280	Switchgrass Phyllosphere	MGSSLALSYNIRLFVIELDYGYRYLLEVCSELSDICFLIWLRYCSMLAL
Ga0182100_10710341	3300015280	Switchgrass Phyllosphere	MGSFLVLSCNIWSFIIELDYGHRYLLEVCFELSDICFLI
Ga0182101_10263611	3300015284	Switchgrass Phyllosphere	MGSPLALSCSIRSFVIELDYGYRYLLEVYSKLSSICFLSWLRY
Ga0182101_10285591	3300015284	Switchgrass Phyllosphere	MGSSLALSCNIRSFVIELDYGYRYLLELYSKLSSICFLSWLCY
Ga0182101_10503601	3300015284	Switchgrass Phyllosphere	MGSSLALSCNIRSFVIELDYGYRYLLEVYSELSSICFLSWL
Ga0182101_10876951	3300015284	Switchgrass Phyllosphere	MGSSLALSCNIRSFVIELDYGYRYLLEVYSELSSICFLSWLRYYSMLALHD
Ga0182105_10664081	3300015290	Switchgrass Phyllosphere	MGSSLALSCNIRLLVIELDYGYRYLLEIYSEFSSICFLSWLRYHSML
Ga0182103_10901321	3300015293	Switchgrass Phyllosphere	MGSSVALSYNIQLFVIELDYGYRYMLEVCSELSDICFLIWLRYYS
Ga0182184_10446981	3300015301	Switchgrass Phyllosphere	MGSSLALSCNIRLFVIELDYGYRYLLEVCSELSDICFLSWLRYYS
Ga0182184_10860381	3300015301	Switchgrass Phyllosphere	MGSSLVLSYNIQSFVIELDYGYRYLLEVCSELLDICFLIWLHYYSMLALHD
Ga0182180_10501081	3300015306	Switchgrass Phyllosphere	MGLSLALSCNIRSFIIELDYGYRYLVEEYSELSSICFLSWLH
Ga0182098_10387601	3300015309	Switchgrass Phyllosphere	MGSSLALSCNIRSFVIELDYGYRYLLEVCFELSDICFLIWFV
Ga0182098_10918671	3300015309	Switchgrass Phyllosphere	MGSSLALSCNIRLFVIKLDYGHRYLLEVCSELSDICFLI
Ga0182182_10509941	3300015311	Switchgrass Phyllosphere	MGSSLALSCNIWLFVIELDYGYRYLLEVYSELSSICFFSWL
Ga0182164_10648451	3300015313	Switchgrass Phyllosphere	MGSSLSLSCNIRLFVIKLDYGYRYLLEVYSELSSICFLSWLHYCDTLGVCT
Ga0182164_11028501	3300015313	Switchgrass Phyllosphere	MGSSLALSCNIQLFVIELDYSYRYMLEVCSELSDICFLIWLRCYLM
Ga0182121_10696231	3300015316	Switchgrass Phyllosphere	MGSSLALSCNIRLFVIELDYGYRYLLEVCSELSDICF
Ga0182136_10395561	3300015317	Switchgrass Phyllosphere	MGSSLALTCNIRLFVIELDYGYRYLLELYSKLSDICFL
Ga0182130_10380361	3300015319	Switchgrass Phyllosphere	MGSSLALSCNIRLFIIELDYGYQYLLEVCSELSNICFVIWLRYYSMLALH
Ga0182165_11418091	3300015320	Switchgrass Phyllosphere	MGSSLALSCNIRLFVIELDYGYRYLLEVYSELSDIYFYIWLRYCSMLALHD
Ga0182148_10885691	3300015325	Switchgrass Phyllosphere	VLLGSSGMGSSLVLSCNVRSFVIEVDYGYRYLLEVCSELLDICFLIWLRYH
Ga0182166_11334642	3300015326	Switchgrass Phyllosphere	MGSSLALSCNIRSFVIELDYGYQYLLEVYSELSSIC
Ga0182114_10815111	3300015327	Switchgrass Phyllosphere	NSRSFVIELDYSYLYLLEVYFELSDIYFVIWLRYHSDACIA*
Ga0182114_11468441	3300015327	Switchgrass Phyllosphere	MDSSLALSRNIRLFVIELDYDYRYLLEVCSELSDICFLICLRYCLMLA
Ga0182153_11107001	3300015328	Switchgrass Phyllosphere	MGPSLALSCNIWLFVIELDYGYRYLFEVYSELSSICFLS
Ga0182153_11312331	3300015328	Switchgrass Phyllosphere	MGSSLALSCNIRLFIIELDYGYRYLLEVYSELSVICFLSWLHY
Ga0182131_11100311	3300015331	Switchgrass Phyllosphere	MGSSLALSCNIRLFVKELDYGYRYLLEVYSELSDTCFL
Ga0182131_11215862	3300015331	Switchgrass Phyllosphere	MGSSLALSCNIRLFVIELDYSYRYLLEVCSELSDICFLIWLRYHSMLALHD
Ga0182117_10978571	3300015332	Switchgrass Phyllosphere	MGSSLALSCNIQSFIIELDYGYRYLLEVCSELSDLCFLIWL
Ga0182117_11170361	3300015332	Switchgrass Phyllosphere	MGLSLALSCNIRLFVIELDYGYRYLLEVCSELSNICFLIWL
Ga0182117_11686951	3300015332	Switchgrass Phyllosphere	MGSSLVLSCNIRSFIIELDYGYQYLLEVYSELSDIYFFIWLHYIIRCLHC
Ga0182147_10050941	3300015333	Switchgrass Phyllosphere	MGSSLFVSYNYRLFVIEIDYGYYRYLLEVCYELSDICFMIWLHYHSML
Ga0182147_11003832	3300015333	Switchgrass Phyllosphere	MGSSLALSCNIRSFVIELDYGYRYLLEVYSELSSI
Ga0182132_11639251	3300015334	Switchgrass Phyllosphere	MGSSLALFCNIQLFVIELDYGYRYLLEVCSELSDIC
Ga0182132_11655211	3300015334	Switchgrass Phyllosphere	MGSSLALSCNIRLFVMELDYGYRYLLEVCSKLSDICFLIWLHYYSMLALHD
Ga0182116_10916661	3300015335	Switchgrass Phyllosphere	MGSSLALSCNIWSFVIELDYGYRYLLEVYSELSSICF
Ga0182116_11617331	3300015335	Switchgrass Phyllosphere	MGLSLALSCNIRSFVIELDYGYRYLLEVCSELLNLCFVIWL
Ga0182150_10844141	3300015336	Switchgrass Phyllosphere	MGSSLVLSCNIRSFVIELDYGYRYLLEVCSELSDIC
Ga0182151_11190431	3300015337	Switchgrass Phyllosphere	LLDNSGMGSSLTLSCNIRLFVIELDYGYRYLLEVCSALSDIWFLIWLRY
Ga0182149_10862672	3300015339	Switchgrass Phyllosphere	MGSSLALSCNIRSFVIELDYGYRYLLEVCSELSDICFLIWLRYCSMLALH
Ga0182149_10933731	3300015339	Switchgrass Phyllosphere	MGSSLALSCNIWLFVIELDYGYRYLLEVYSELSSICFLLW
Ga0182149_11213141	3300015339	Switchgrass Phyllosphere	MGSSLVLCCNIRSFVIELDYGYRYLLEVYYELSSICFL
Ga0182115_11851021	3300015348	Switchgrass Phyllosphere	MGSSLALSCNIRLFVIELDYGYRYLLEVCSELSDI
Ga0182115_11898691	3300015348	Switchgrass Phyllosphere	MGSYLVLSCNIRLFVIELNYGYQYLLEVCSELSDICFLIWLCYHSMLAL
Ga0182115_11938921	3300015348	Switchgrass Phyllosphere	MGSSLALSCNIRLFVIELDYGYRYLLEVCSELSDICFLIWLRYC
Ga0182115_12268701	3300015348	Switchgrass Phyllosphere	MGSSLALSCNIRSFVIELDYGYRYLIEVYSELSSICFLSWLHYYSTL
Ga0182115_12434512	3300015348	Switchgrass Phyllosphere	GSSLALSCNIRSFVIGLDYGYRYLLEVYSELLSICFLL*
Ga0182115_12444481	3300015348	Switchgrass Phyllosphere	MGSSLALSCNSRSFVIELDYGYLYLLEVYSELSSICFL
Ga0182115_12692431	3300015348	Switchgrass Phyllosphere	MGSSLALFCNIRLFIIELDYGYRYLLEVCSELSGICFLSWLLLGILT
Ga0182185_10366861	3300015349	Switchgrass Phyllosphere	MGSSLALSCNIRSFVIELDYGYRYLLEVCSELSDICFLIWLHYCSMLALHDRP
Ga0182185_11597772	3300015349	Switchgrass Phyllosphere	MGSSLALSCNIRLFVIELDYGYRYLLEVYFDLSDICFLIWLRYCSMFALH
Ga0182163_11683981	3300015350	Switchgrass Phyllosphere	MGSSLVLSCNIRSFVIELDYGYRYFLEVCYELSDICFVIWLR
Ga0182163_12269821	3300015350	Switchgrass Phyllosphere	MGSSLALSCNIRSYVIELDYGYRYLLEVYSELSVIC
Ga0182169_10517671	3300015352	Switchgrass Phyllosphere	MGSSLALSCNIQLFVIELDYGYRYLLEVCSELSDICFLIWLRYCSMLAL
Ga0182169_13053361	3300015352	Switchgrass Phyllosphere	MGSSLALSCNILSFVIELDYGYRYLLEVYSELSSICFLSWLRYYSMLALHDR
Ga0182179_12704331	3300015353	Switchgrass Phyllosphere	MGSSLALSCNIRLFVIELDYGYRYLLEEYSELSSICFLSWLCYHSML
Ga0182179_13145141	3300015353	Switchgrass Phyllosphere	MSLSLALSCNIRLFIIELDYGYRYLLEVCSELSDICFLIWLRYCSMLAL
Ga0182167_11768382	3300015354	Switchgrass Phyllosphere	MGSSLVLSCNIGSFVIELDYSYRYLLEVCSELSDICFVIWLCYH
Ga0182167_12565231	3300015354	Switchgrass Phyllosphere	MGSSLVLYCNIQSFVIELDYGYRYLLKVCSEFSDICFLIWLHYHS
Ga0182167_13066472	3300015354	Switchgrass Phyllosphere	MGSSPVLSCNSRSFVIELDYGYRYLLEVCSELSDYFV
Ga0182199_11844261	3300017412	Switchgrass Phyllosphere	MGSSLALSCNIRSFVIELDCGYRYLLEVCSELSDICFL
Ga0182195_11814161	3300017414	Switchgrass Phyllosphere	MGSSLDLSCNIRSFVIELDYGYRYLLEVCSELSDICFLI
Ga0182195_12112161	3300017414	Switchgrass Phyllosphere	MGSFLVLSCNIWSFIIELDYGYRYLLEVYSELSSIC
Ga0182213_12364412	3300017421	Switchgrass Phyllosphere	MGSSLALSCNIRLFVIELDYGYRYLLGVYSELSSICFLSWLCYHSMLALYDR
Ga0182201_10361161	3300017422	Switchgrass Phyllosphere	MGSSLALSCNIRSFVIELDYGYRYLLEVYSELSSICFLSWLRYYSMLAL
Ga0182201_10664621	3300017422	Switchgrass Phyllosphere	MGSSLALSYNIRSFVIELDYGYRYLLEVYSELSSICFLSWLRYYSMLAL
Ga0182200_10639911	3300017439	Switchgrass Phyllosphere	MGSSLALSYNIRSFVIELDYGYRYLLEVYSELLSICFLSW
Ga0182200_11325211	3300017439	Switchgrass Phyllosphere	MGSSLALSCNIQLFEIELNYGYRYLLEVCSELSDICFLIWLCYHSMLA
Ga0182200_11371501	3300017439	Switchgrass Phyllosphere	MGSSLVLSCNIRLFVIELDYGYRYLLEVSSELLDIYF
Ga0182214_10942721	3300017440	Switchgrass Phyllosphere	MGSSLALSYNIRSFVIELGYGYRYLLEVYSELSSICFLSWLRYYS
Ga0182214_11243011	3300017440	Switchgrass Phyllosphere	MGLSLALSCNIRSFVIELDYGYRYLLEVYSKLSSICFLSW
Ga0182198_11701492	3300017445	Switchgrass Phyllosphere	MGSSLVLSCNIRSFVIELDYGYQYLLEVCFELSDICFLIWLHYHSMLA
Ga0182198_11978422	3300017445	Switchgrass Phyllosphere	MGSSLALSCNIRLFVIELDYGYRYLLEVYSELSSICFLSWLR
Ga0182216_10482541	3300017693	Switchgrass Phyllosphere	MGSSLVLSSNIRSFVIEFDYGYRYLLEVCSELSDICFL
Ga0207662_110966711	3300025918	Switchgrass Rhizosphere	MGSSLALSCNIRLFVIELDYGYRYLLEVYSELPSICFLSWLRYHSM
Ga0207712_116604131	3300025961	Switchgrass Rhizosphere	MGSSLAVSCNIRSFVIELDYGYRYLLEVYSELSSICFLSWLRYYSMLA
Ga0268328_10116991	3300028050	Phyllosphere	MGSSLVLSCNIRSFVIELDYGYQYLLEVYSELSSICFLSWLHYYS
Ga0268314_10474341	3300028061	Phyllosphere	MGSSLALSCNIRSFVIELDYGYRYLLEVYSELSGICFL
Ga0268334_10107341	3300028140	Phyllosphere	MGSSLALSCNIWSFVIELDYGYRYLPVVCSELSDISFLIWLRY
Ga0268341_10108251	3300028154	Phyllosphere	MGSSLALSCNIRPFVIELDYGYQYLLEVYSELSVICFLSWL
Ga0268327_10095851	3300028475	Phyllosphere	MGSSLALFYNIRLFIIELDYGYRYLLEVCSELSGICFLSWLR
Ga0268327_10227271	3300028475	Phyllosphere	MGSSLALSCNIQSFVIELDYGYRYLLEVYSELSSISFLSWLCYYSMLA
Ga0214493_11016111	3300032465	Switchgrass Phyllosphere	MGLSLVLSCNIRSLVIELDYGYRYLLEVCSKLSNICFLIWLCYHSVLTLHDR
Ga0214490_11206091	3300032502	Switchgrass Phyllosphere	MGSSLALSYNIRSFVIELGYGYRYLLEVYSELSSICFLSWLRYYSMLALHD
Ga0214501_11136501	3300032625	Switchgrass Phyllosphere	MGSSLALSCNIRSFVIELDYGYRYLLEVYSELSSICFLSWLRY
Ga0314748_11310211	3300032791	Switchgrass Phyllosphere	MGSSLVPSCNIRLFVIELDYGYRYLLEVGSELSDICFLIW
Ga0314739_10236151	3300032913	Switchgrass Phyllosphere	MGSSLALSCNIRLFVIELDYGYQYLLEVCSELSDIYFLIWLPYCSM
Ga0314741_11330361	3300032934	Switchgrass Phyllosphere	MGSSLVLSCNIRSFVIELYNGYRYLLEVYSELSNI
Ga0314741_11509482	3300032934	Switchgrass Phyllosphere	MGSSLALSCNIRLFVIELDYGYRYLLEVCSELSDICFLIWLHYYSMFVLYDR
Ga0314757_11008131	3300033534	Switchgrass Phyllosphere	MGSSLTLSCNIRSFVIELDYGYRNLLEVYSELSSICFLSWLRY
Ga0314755_11920632	3300033538	Switchgrass Phyllosphere	MGSSLALSRNIRLFVIELDYSYRYLLEVYSKLSSICFLSWL

Structure Viewer


Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100	pTM-score: 0.55
Secondary Structure: α-helix β-sheet Coil Turn	pTM-score: 0.55
Powered by PDBe Molstar

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

Metagenome / Metatranscriptome Family F080773

Overview

Multiple Sequence Alignments

Structure & Topology

Predicted Secondary Structure and Topology

Predicted 3D Structure

Low Quality Model:

Gene Neighborhood

Neighboring Pfam domains

Phylogeny

NCBI Taxonomy

Associated Scaffolds

Environmental Properties

Associated Habitat Types

Associated Samples

Family Sequences

Hidden Markov Model


Click on a Sequence Logo column to get its information.
Powered by Skylign