Basic Information | |
---|---|
Family ID | F080808 |
Family Type | Metagenome |
Number of Sequences | 114 |
Average Sequence Length | 40 residues |
Representative Sequence | FCGTHSSMLEAKSVHDPKIKVVPYVKHYNFALVNSSMQGL |
Number of Associated Samples | 65 |
Number of Associated Scaffolds | 114 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | No |
Most common taxonomic group | Unclassified |
% of genes with valid RBS motifs | 1.79 % |
% of genes near scaffold ends (potentially truncated) | 93.86 % |
% of genes from short scaffolds (< 2000 bps) | 98.25 % |
Associated GOLD sequencing projects | 62 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.17 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Unclassified (99.123 % of family members) |
NCBI Taxonomy ID | N/A |
Taxonomy | N/A |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Miscanthus Phyllosphere (84.210 % of family members) |
Environment Ontology (ENVO) | Unclassified (86.842 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant surface (85.965 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 0.00% β-sheet: 0.00% Coil/Unstructured: 100.00% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.17 |
Powered by PDBe Molstar |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
Unclassified | root | N/A | 99.12 % |
All Organisms | root | All Organisms | 0.88 % |
Visualization |
---|
Powered by ApexCharts |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Miscanthus Phyllosphere | Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Miscanthus Phyllosphere | 84.21% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 7.02% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 4.39% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.75% |
Phyllosphere | Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Phyllosphere | 1.75% |
Corn, Switchgrass And Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 0.88% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Host-Associated | Open in IMG/M |
3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Host-Associated | Open in IMG/M |
3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Host-Associated | Open in IMG/M |
3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Host-Associated | Open in IMG/M |
3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Host-Associated | Open in IMG/M |
3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Host-Associated | Open in IMG/M |
3300015268 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_12JUL2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015269 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_09MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015274 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_22AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015275 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_01AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015276 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_01AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015277 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_31MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015279 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_01AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015281 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_12JUL2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015285 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_22AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015287 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_01AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015288 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_01AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015289 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_20JUN2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015291 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_31MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015292 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_20JUN2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015294 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_31MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015295 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_01AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015296 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_12JUL2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015298 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_09MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015299 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_09MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015302 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_20JUN2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015303 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_31MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015304 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_09MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015305 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_12JUL2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015307 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_20JUN2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015308 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_20JUN2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015321 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_31MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015322 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_09MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015341 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_22AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015342 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_09MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015343 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_12JUL2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015344 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_22AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015346 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_20JUN2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015355 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_12JUL2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015361 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_20JUN2016_LD1 MG | Host-Associated | Open in IMG/M |
3300017404 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_12SEP2016_LD1 MG | Host-Associated | Open in IMG/M |
3300017407 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_03OCT2016_LD1 MG | Host-Associated | Open in IMG/M |
3300017409 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_12SEP2016_LD1 MG | Host-Associated | Open in IMG/M |
3300017410 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_12SEP2016_LD1 MG | Host-Associated | Open in IMG/M |
3300017411 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_12SEP2016_LD1 MG | Host-Associated | Open in IMG/M |
3300017413 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_03OCT2016_LD1 MG | Host-Associated | Open in IMG/M |
3300017415 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_12SEP2016_LD1 MG | Host-Associated | Open in IMG/M |
3300017420 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_07NOV2016_LD1 MG | Host-Associated | Open in IMG/M |
3300017424 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_03OCT2016_LD1 MG | Host-Associated | Open in IMG/M |
3300017425 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_03OCT2016_LD1 MG | Host-Associated | Open in IMG/M |
3300017430 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_22AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
3300017433 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_12SEP2016_LD1 MG | Host-Associated | Open in IMG/M |
3300017438 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_22AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
3300017443 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_22AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
3300017680 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_07NOV2016_LD1 MG | Host-Associated | Open in IMG/M |
3300017684 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_03OCT2016_LD1 MG | Host-Associated | Open in IMG/M |
3300017686 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_12SEP2016_LD1 MG | Host-Associated | Open in IMG/M |
3300017689 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_07NOV2016_LD1 MG | Host-Associated | Open in IMG/M |
3300017690 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_03OCT2016_LD1 MG | Host-Associated | Open in IMG/M |
3300021060 | Phyllosphere microbial comminities from miscanthus, Michigan, USA - G6R3_NF_07NOV2016_LD2 MG | Host-Associated | Open in IMG/M |
3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) | Host-Associated | Open in IMG/M |
3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) | Host-Associated | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
Ga0068867_1006537762 | 3300005459 | Miscanthus Rhizosphere | LDFADFCGTYSSILEAKSVNDPKIKVVPYVKHYNFDLVNS |
Ga0068867_1016247001 | 3300005459 | Miscanthus Rhizosphere | *KADFCESISSMLEAKSVNDPKIKVVPYTKYYNFALVTTSMQGL* |
Ga0068867_1023443782 | 3300005459 | Miscanthus Rhizosphere | FCGTHSSMLEAKSVHDPKIKVVPYVKHYNFALVNSSMQGL* |
Ga0068866_108135012 | 3300005718 | Miscanthus Rhizosphere | DSCDPNSSMLGAKSVNDPKIKVVPHLTYYNFALVTTYMQSL* |
Ga0105243_111624711 | 3300009148 | Miscanthus Rhizosphere | SMLEAKSVHDIKIKVVPNVKHYNFALVNPSMQGL* |
Ga0157378_115448891 | 3300013297 | Miscanthus Rhizosphere | FDDSCDPISNMLGAESFNDPKIKVVPYSTYYNFALVTTSMQGL* |
Ga0157378_125523011 | 3300013297 | Miscanthus Rhizosphere | *KLGFAGFCGTHLSMLEAESVHDPKIKVVPYVKHYNFALVNSSMQGL* |
Ga0157377_114664201 | 3300014745 | Miscanthus Rhizosphere | IDDSCEPNSSMLGAKLVYAPNIKVVPYTKYYNFALVISMQGL* |
Ga0157376_113963342 | 3300014969 | Miscanthus Rhizosphere | DFSDFCGTYSSMLGAKSVYDLKIKVVPYVKHYNFALVNSSMQGL* |
Ga0157376_124871751 | 3300014969 | Miscanthus Rhizosphere | SMLEAKSVHDLKIKVVPYVKHYNFALVISSMQGL* |
Ga0182154_10331751 | 3300015268 | Miscanthus Phyllosphere | SMLGAESINDPKIKVVPYVKHYNFDLVNSSMQGL* |
Ga0182154_10622571 | 3300015268 | Miscanthus Phyllosphere | HSSMLEAKSVHDLKIKVVPYVKHYNFALVISSMQGL* |
Ga0182113_10549851 | 3300015269 | Miscanthus Phyllosphere | LDFADFCGTYSSILEAKSVNDPKIKVVPYVKHYNFDLVNSSMQGL |
Ga0182113_10873631 | 3300015269 | Miscanthus Phyllosphere | DDSCDPISNMLGAESCDDPKIKVVPNVKHYNIALVNSSMQGL* |
Ga0182188_10365011 | 3300015274 | Miscanthus Phyllosphere | ISNMLGAESCDDPKIKVVPNVKHYNIALVNSSMQGS* |
Ga0182172_10261761 | 3300015275 | Miscanthus Phyllosphere | LDFADFCGTYSSILEAKSVNDPKIKVVPYVKHYNFDLVNSSMQG |
Ga0182172_10396411 | 3300015275 | Miscanthus Phyllosphere | DFAGFCGTHSSMLEAKSVHVIKIKVVPYVKHYNFALVNSSMQGP* |
Ga0182170_10279271 | 3300015276 | Miscanthus Phyllosphere | PISHMLGAKSVKDPKIKVVPYVKHYNFALMNSSMQGL* |
Ga0182170_10611521 | 3300015276 | Miscanthus Phyllosphere | SNMLGAESCDDPKIKVVPNVKHYNIALVNSSMQGL* |
Ga0182170_10616851 | 3300015276 | Miscanthus Phyllosphere | LDFADFCGTYSSILEAKSVNDPKIKVVPYVKHYNFDLVNSS |
Ga0182170_10628861 | 3300015276 | Miscanthus Phyllosphere | DPISHMLGAESVKDPKIKVVPYVKHYNIALVNSSMQGL* |
Ga0182128_10095451 | 3300015277 | Miscanthus Phyllosphere | MDFADFCGTYSSMLEAKSVNDPNIKVVPYTKYYNFALVISSMQGL* |
Ga0182128_10605721 | 3300015277 | Miscanthus Phyllosphere | NSHMLGAESVKGPKIKVVPYVKHYNIALVNSSMQGP* |
Ga0182174_10361581 | 3300015279 | Miscanthus Phyllosphere | VGFADSCDPNSSMLGAKSVSNPKIKVVPLAKHYNFALVTTSMQGL* |
Ga0182160_10236142 | 3300015281 | Miscanthus Phyllosphere | PNSSMIGAESVKGPNIKVVPYVKHYNIVLVNSSMQGP* |
Ga0182160_10495032 | 3300015281 | Miscanthus Phyllosphere | SSMLEAKSVNDPKIKVVPYVKHYNFDLVNSSMQGL* |
Ga0182186_10365791 | 3300015285 | Miscanthus Phyllosphere | PDFCGTYSSMLEAKSVNDPKIKVVPYTKYYNFALVISSMQGL* |
Ga0182186_10535071 | 3300015285 | Miscanthus Phyllosphere | MLGAESVKDPKIKVVPYVKHYNIALVNSSMQGLEHL |
Ga0182171_10691521 | 3300015287 | Miscanthus Phyllosphere | ISNMLGAESCDDPKIKVVPNVKHYNIALVNSSMQGL* |
Ga0182173_10679901 | 3300015288 | Miscanthus Phyllosphere | SMLEAKSVKDPKIKVVPHAKHYNFALVTSSMQGL* |
Ga0182138_10298192 | 3300015289 | Miscanthus Phyllosphere | MLIFSDSCDANSSMLEAKSVNDPKIKVVPYVKYYNFALVISSMQGL* |
Ga0182138_10478152 | 3300015289 | Miscanthus Phyllosphere | MESCEPISSMLGAKLVYDPKIKVVPLIKYYNFALVTTSMQGL |
Ga0182138_10904032 | 3300015289 | Miscanthus Phyllosphere | EIFVKS*NADFPDFCGTYSSMLEAKSVNDPKIKVVPYVKHYNFDLVNSSMQGL* |
Ga0182125_10560761 | 3300015291 | Miscanthus Phyllosphere | PISNMLGAESVKDPKIKVVPYVKHYNIALVNSSMQGL* |
Ga0182141_10792951 | 3300015292 | Miscanthus Phyllosphere | NMLGAKSVNDPKIKVVPYVKHYNFALVNSSMQGL* |
Ga0182126_10578551 | 3300015294 | Miscanthus Phyllosphere | MLIFADSCETNSSMLEAKSVNDPKIKVVPYVKYYNFALVISSMQGL* |
Ga0182175_10783392 | 3300015295 | Miscanthus Phyllosphere | HMLGAESVKDPKIKVVPYVKHYNIALVNSSMQGL* |
Ga0182157_11008981 | 3300015296 | Miscanthus Phyllosphere | *NSNSHMLGAESVKDPKIKVVPYVKHYNFALVNSSMQGP* |
Ga0182106_10486931 | 3300015298 | Miscanthus Phyllosphere | VGFADSCELISSMLGAKPVNDPKIKVVPHVKHYNFALVISSMQGL* |
Ga0182106_10593291 | 3300015298 | Miscanthus Phyllosphere | PISHMLGAESVKDPKIKVVPYVKHYNIALVNSSMQGL* |
Ga0182106_10980031 | 3300015298 | Miscanthus Phyllosphere | SNMLGAESCDDPKIKVVPNVKHYNIALVNSSMQGS* |
Ga0182107_10742301 | 3300015299 | Miscanthus Phyllosphere | SMLEGKSVNDPKIKVVAYTKYYNFALVTTSMQGP* |
Ga0182107_10760451 | 3300015299 | Miscanthus Phyllosphere | VLNLGFADFCGTNSSRLEAKSVNDLKIKVVPYVKHYNFALV |
Ga0182107_10994741 | 3300015299 | Miscanthus Phyllosphere | DF*NPNSHMLGAESVKGPKIKVVPYVKHYNIDLVNSSMQGP* |
Ga0182143_10142121 | 3300015302 | Miscanthus Phyllosphere | MLIFADSCETNSSMLEAKSVNDPKIKVVPYIKYYNFALVTTSMQGL |
Ga0182123_10887371 | 3300015303 | Miscanthus Phyllosphere | SMLGAESVNDPKIKVVPYVKHYNFALVNSSMQGL* |
Ga0182112_10709441 | 3300015304 | Miscanthus Phyllosphere | HSSMLEAESVHDPKIKVVPYVKHSNFALVNSSMQGS* |
Ga0182158_10533611 | 3300015305 | Miscanthus Phyllosphere | CGTHSSMLEAKSASDQKIKVVPYVKHYNFALVISSMEGL* |
Ga0182158_11012961 | 3300015305 | Miscanthus Phyllosphere | KCLKQWKADFCEPISSMLGAKLVYDPKIKVVPLVKYYNIALVTTSMQGL* |
Ga0182144_10998231 | 3300015307 | Miscanthus Phyllosphere | SMLEAKSVNDPKIKVVPYVKHYNFDLVNSSMQGL* |
Ga0182144_11027971 | 3300015307 | Miscanthus Phyllosphere | VLNLGFADFCGTNSNMLEAKSVHDLKIKVVPYVKHYNF |
Ga0182142_10498251 | 3300015308 | Miscanthus Phyllosphere | ADFCGTHSSMLEAKSVNDLEIKVVPYVKHYNFALVNSSMQGL* |
Ga0182127_10763961 | 3300015321 | Miscanthus Phyllosphere | EFFVKS*NADFPDFCGTYSSMLEAKSVNDPKIKVVPYVKHYNFDLVNSSMQGL* |
Ga0182110_10716781 | 3300015322 | Miscanthus Phyllosphere | DFCEPNSSMLGAKPVNDPKIKVVPLAKYYNFALVTTSMQGL* |
Ga0182187_11505121 | 3300015341 | Miscanthus Phyllosphere | FADFCGTYSSMLEAKSVNDPKIKVVPYTKYYNFALVISSIQGL* |
Ga0182187_11794441 | 3300015341 | Miscanthus Phyllosphere | HMLGAESVKGPKIKVVPYVKHYNIALVNSSMQGP* |
Ga0182109_11099342 | 3300015342 | Miscanthus Phyllosphere | HSSMLEAKSVHDLKIKVVPYVKHYNFALVISSMQGH* |
Ga0182155_11962262 | 3300015343 | Miscanthus Phyllosphere | VLNLGFADFCGTNSSMLEAKSVNGPKIKVVPYVKHYNFALVISSMQGF* |
Ga0182189_11384941 | 3300015344 | Miscanthus Phyllosphere | SSMLEAKLVNDPKIKVVPYVKYYNFALVISSMQGL* |
Ga0182139_11074972 | 3300015346 | Miscanthus Phyllosphere | GFAGFCGTHSSMLEAKSVHDPKIKVVPYVKHYNFDLVNSSMQGL* |
Ga0182139_12017571 | 3300015346 | Miscanthus Phyllosphere | VLNLGFADFCGTNSNMLEAKSVHDLKIKVVPYVKHYNFALVISSM |
Ga0182139_12297302 | 3300015346 | Miscanthus Phyllosphere | DDSCEPNSSMLGAKPVNDPKIKVVPLAKYYNFVLVTTSMQGL* |
Ga0182159_12781101 | 3300015355 | Miscanthus Phyllosphere | SMLEAKSVHDLKIKVVPYVKHYNFALVNSSMQGL* |
Ga0182145_11063921 | 3300015361 | Miscanthus Phyllosphere | QDFDDSCDPISNMLGAESVKDPKIKVVPYVKHYNIALVNSSTQGL* |
Ga0182145_11108062 | 3300015361 | Miscanthus Phyllosphere | *NPNSHMLGAESINDPKIKVVPYVKHYNFDLLNSSMQGL* |
Ga0182145_11404971 | 3300015361 | Miscanthus Phyllosphere | VGSCGPISSILGAKLVYDPKIKVVPLAKYYNFALVTTCM |
Ga0182145_11667771 | 3300015361 | Miscanthus Phyllosphere | FCGTYSSMLEAKSVNDPKIKVVPYTKYYNFALVISSMQGL* |
Ga0182203_10734091 | 3300017404 | Miscanthus Phyllosphere | XKQXKADFCESISSMLEAKSVNDPKIKVVPYTKYYNFALVTTSMQGL |
Ga0182203_10765781 | 3300017404 | Miscanthus Phyllosphere | LDFADFCGTYSSMLEAKSVNDPKIKVVPYVKHYNIALVISSMQGL |
Ga0182203_10916981 | 3300017404 | Miscanthus Phyllosphere | GFADFCEPKSNMLVAKPANDPKIKVVPHIKYYNFALVTTSMQGL |
Ga0182203_11224421 | 3300017404 | Miscanthus Phyllosphere | DDSCDPISNMLGAESCDDPKIKVVPNVKHYNIALVNSSMQGL |
Ga0182220_10484671 | 3300017407 | Miscanthus Phyllosphere | NSHMLGADSVKDPKIKVVPYVKHYNIALVNSSMQGL |
Ga0182204_10293261 | 3300017409 | Miscanthus Phyllosphere | KQGIDDSCEPNSSMLGAKPVYDPKIKVVPLAKYYNFALVTTSMQGL |
Ga0182204_10540531 | 3300017409 | Miscanthus Phyllosphere | DFAGFCGTHSSMLEAKSVHDPKIKVVPYVKHYNFDLVNSSMQGL |
Ga0182207_11276121 | 3300017410 | Miscanthus Phyllosphere | ISNMLGAESVKDPKIKVVPYVKHYNIALVNSSMQGL |
Ga0182207_11571161 | 3300017410 | Miscanthus Phyllosphere | FDDFXNPNSSMLGAESINDPKIKVVPYTKHYNIALVNSSMQGL |
Ga0182208_10554252 | 3300017411 | Miscanthus Phyllosphere | XNVDFADSCETNSSMLEAKSVNDPKIKVVPSVKYYNFALVISSMQGL |
Ga0182208_10682271 | 3300017411 | Miscanthus Phyllosphere | SSMLEAKSVNDPKIKFVPYSKYYNFSLVTTSMQGL |
Ga0182222_11027721 | 3300017413 | Miscanthus Phyllosphere | SSMLEAKSVNDPKIKVIPYVKHYNFALVISSMQGL |
Ga0182202_10543332 | 3300017415 | Miscanthus Phyllosphere | LDFADFCGTHSSMLEAKSVHDPKIKVVPYVKHYNFDLLNSSMQGL |
Ga0182202_11353571 | 3300017415 | Miscanthus Phyllosphere | NNLEIFVKSXNADFPDFCGTYSSMLEAKSVNDPKIKVVPYVKHYNFDLVNSSMQGL |
Ga0182228_10486891 | 3300017420 | Miscanthus Phyllosphere | XKLDFAGFCGTHSSMLEAKSVHDLKIKVVPYVKHYNFALVISSMQGL |
Ga0182219_10483722 | 3300017424 | Miscanthus Phyllosphere | KAGFAGFCGTHSSMLEAKSVHVIKIKVVPYVKHYNFALVNSSMQGP |
Ga0182219_11090721 | 3300017424 | Miscanthus Phyllosphere | DPISNMLGAESCDDPKIKVVPNVKHYNIALVNSSMQGL |
Ga0182219_11277901 | 3300017424 | Miscanthus Phyllosphere | LDFADFCGTYSSILEAKSVNDPKIKVVPYVKHYNFDLVNSSM |
Ga0182224_10988621 | 3300017425 | Miscanthus Phyllosphere | THSSMLEAKSVHVIKIKVVPYVKHYNFALVNSSMQGP |
Ga0182224_11177611 | 3300017425 | Miscanthus Phyllosphere | DFADFCGTYSSMLEAKSVNDPKIKVVPYTKYYNFALVISSMQGL |
Ga0182192_11745631 | 3300017430 | Miscanthus Phyllosphere | DFADFCGTHSSMLEAKSVHDPKIKVVPYVKHYNFDLVNSSMQGL |
Ga0182206_10857411 | 3300017433 | Miscanthus Phyllosphere | LDFADFCGTYSSMLEAKSVNDPKIKVVPYTKYYNFALVISSMQGL |
Ga0182206_11515061 | 3300017433 | Miscanthus Phyllosphere | SNMLGAESCDDPKIKVVPNVKHYNIALVNSSMQGL |
Ga0182191_11077872 | 3300017438 | Miscanthus Phyllosphere | DSCDPNSSMLGAKSVNDPKIKVVPYSKYYNFALVSSSMQGL |
Ga0182191_11162222 | 3300017438 | Miscanthus Phyllosphere | XNPNSHMLGAESVKGPKIKVVPYVKHYNIALVNSSMQGP |
Ga0182193_11198371 | 3300017443 | Miscanthus Phyllosphere | CEPNSSMLGAKPVNDPKIKVVPLAKYYNFDLVTTSMQGL |
Ga0182233_10176832 | 3300017680 | Miscanthus Phyllosphere | GTHSSMLEAKSVHDLKIKVVPYVKHYNFALVISSMQGL |
Ga0182233_10769731 | 3300017680 | Miscanthus Phyllosphere | PISHMLGAESVNDPKIKVVPYVKHYNIALVISSMQGL |
Ga0182233_11055921 | 3300017680 | Miscanthus Phyllosphere | MLIFPDFCGTYSSMLEAKSVNNQKIKVVPYVKHYNFDLVNSSMQGL |
Ga0182225_11029331 | 3300017684 | Miscanthus Phyllosphere | CKADFCEPISSMLGAKLVYDPKIKVFTLIQYYNFALVTTSVQGL |
Ga0182205_11485721 | 3300017686 | Miscanthus Phyllosphere | DSCDPISNMLGAESCDDPKIKVVPNVKHYNIALVNSSMQGL |
Ga0182205_11641941 | 3300017686 | Miscanthus Phyllosphere | PNSSMLEAKSVHDIKIKVVPNVKHYNFALVNPSMQGL |
Ga0182231_10603611 | 3300017689 | Miscanthus Phyllosphere | GTHSSMLEAKSVHDPKIKVVPYVKHYNFDLLNSSMQGL |
Ga0182231_10678752 | 3300017689 | Miscanthus Phyllosphere | SSMLGAKPVNDPKIKVVHYIKYYNFALVTTSMQGL |
Ga0182231_10861241 | 3300017689 | Miscanthus Phyllosphere | XKQXKADFCESNSNMLEAKSVHDIKIKVVPYVKHYNFALVNSSMQGL |
Ga0182223_10560361 | 3300017690 | Miscanthus Phyllosphere | CKAYFCEPISSMLGAELAYDPKIEVVPLMKYYNFALVTTSMQSF |
Ga0182223_10664491 | 3300017690 | Miscanthus Phyllosphere | GTYSSMLEAKSVNDPKIKVVPYVKHYNIALVSSSMQGP |
Ga0182223_11031841 | 3300017690 | Miscanthus Phyllosphere | PNSSMIGAESVKGPNIKVVPYVKHYNIVLVNSSMQGP |
Ga0182223_11036951 | 3300017690 | Miscanthus Phyllosphere | SSMLGAESVSDPKIKVVPYVKHYNFALVSSSMQGL |
Ga0182232_10580511 | 3300021060 | Phyllosphere | SCDTNSSMLEAKSVNDPKIKVVPYVKYYNFALVISSMQGL |
Ga0182232_10587192 | 3300021060 | Phyllosphere | FCNSNSSMLEAKSVNDSKIKVVPYVKHYNFALVISSMQGL |
Ga0207642_108984242 | 3300025899 | Miscanthus Rhizosphere | MLEAKSVNDPKIKVVPYTKYYNIALVNSSMQGLQHLVP |
Ga0207688_105742792 | 3300025901 | Corn, Switchgrass And Miscanthus Rhizosphere | PNPHMLGAKSVKDPKIKVVPYVKHYNIALVIFSMQGL |
Ga0207709_109274071 | 3300025935 | Miscanthus Rhizosphere | TNSSMLEAKSVDDPKIKVVPYVKYYNFALVISSMQGL |
Ga0207677_116102711 | 3300026023 | Miscanthus Rhizosphere | PISNMLGAESVKDPKIKVVPYVKHYNIALVNSSMQGL |
Ga0207677_121182201 | 3300026023 | Miscanthus Rhizosphere | GFCGTHSSMLEAETVHDPKIKVVPYVKHSNFALVNSSMQGP |
Ga0207648_103679651 | 3300026089 | Miscanthus Rhizosphere | SCEPKSSMLGAKPVNDPKIKVVPLAEYYNFVLVTTSMQGI |
⦗Top⦘ |