NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F081372

Metagenome / Metatranscriptome Family F081372

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F081372
Family Type Metagenome / Metatranscriptome
Number of Sequences 114
Average Sequence Length 105 residues
Representative Sequence CVVPKSTLFASRLGMTNKYAYDYACEDEFFEREMTLLDAKTTSLPLPTDFKHVEAPTDEIQPPHWNDVRFNFFPQNLDRRCYVHDNLAIFYDMQNDYHHGVGY
Number of Associated Samples 98
Number of Associated Scaffolds 114

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Eukaryota
% of genes with valid RBS motifs 10.53 %
% of genes near scaffold ends (potentially truncated) 56.14 %
% of genes from short scaffolds (< 2000 bps) 99.12 %
Associated GOLD sequencing projects 91
AlphaFold2 3D model prediction Yes
3D model pTM-score0.24

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Eukaryota (100.000 % of family members)
NCBI Taxonomy ID 2759
Taxonomy All Organisms → cellular organisms → Eukaryota

Most Common Ecosystem
GOLD Ecosystem Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine
(14.035 % of family members)
Environment Ontology (ENVO) Unclassified
(50.000 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Saline → Water (saline)
(75.439 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 25.95%    β-sheet: 9.16%    Coil/Unstructured: 64.89%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  		pTM-score: 0.24
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 114 Family Scaffolds
PF00076RRM_1 2.63


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms100.00 %
UnclassifiedrootN/A0.00 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300001355|JGI20158J14315_10089954All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida1091Open in IMG/M
3300001951|GOS2249_1001415All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida1586Open in IMG/M
3300002835|B570J40625_101397414All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida578Open in IMG/M
3300003216|JGI26079J46598_1022822All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida1557Open in IMG/M
3300003621|JGI26083J51738_10121197All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida547Open in IMG/M
3300003909|JGI26087J52781_1019843All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida726Open in IMG/M
3300004095|Ga0007829_10089421All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida617Open in IMG/M
3300005516|Ga0066831_10013089All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida2271Open in IMG/M
3300005942|Ga0070742_10175090All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida598Open in IMG/M
3300006029|Ga0075466_1077432All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida932Open in IMG/M
3300006115|Ga0007816_1085390All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea697Open in IMG/M
3300006396|Ga0075493_1391124All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida714Open in IMG/M
3300006415|Ga0099654_10607059All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida754Open in IMG/M
3300006803|Ga0075467_10320951All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida820Open in IMG/M
3300007550|Ga0102880_1139663All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida635Open in IMG/M
3300007992|Ga0105748_10548229All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida508Open in IMG/M
3300008111|Ga0114344_1230015All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea556Open in IMG/M
3300008113|Ga0114346_1327188All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida512Open in IMG/M
3300008117|Ga0114351_1253121All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida872Open in IMG/M
3300008120|Ga0114355_1201929All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea639Open in IMG/M
3300009049|Ga0102911_1044173All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida1310Open in IMG/M
3300009071|Ga0115566_10101018All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida1855Open in IMG/M
3300009071|Ga0115566_10110156All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida1760Open in IMG/M
3300009080|Ga0102815_10353668All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida814Open in IMG/M
3300009151|Ga0114962_10314518All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida870Open in IMG/M
3300009172|Ga0114995_10267469All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida943Open in IMG/M
3300009263|Ga0103872_1021119All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida796Open in IMG/M
3300009263|Ga0103872_1022088All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida787Open in IMG/M
3300009263|Ga0103872_1038366All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida667Open in IMG/M
3300009265|Ga0103873_1070948All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida693Open in IMG/M
3300009265|Ga0103873_1074847All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida677Open in IMG/M
3300009445|Ga0115553_1057879All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida1750Open in IMG/M
3300009445|Ga0115553_1174455All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida869Open in IMG/M
3300009508|Ga0115567_10253388All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida1118Open in IMG/M
3300009526|Ga0115004_10306056All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida943Open in IMG/M
3300009599|Ga0115103_1356424All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida526Open in IMG/M
3300009599|Ga0115103_1457301All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida772Open in IMG/M
3300009599|Ga0115103_1617485All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida542Open in IMG/M
3300009606|Ga0115102_10196256All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea733Open in IMG/M
3300009606|Ga0115102_10444051All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida761Open in IMG/M
3300009606|Ga0115102_10660492All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida709Open in IMG/M
3300010368|Ga0129324_10152107All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida963Open in IMG/M
3300012504|Ga0129347_1178917All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida718Open in IMG/M
3300012520|Ga0129344_1384029All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida755Open in IMG/M
3300012522|Ga0129326_1420368All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida779Open in IMG/M
3300012523|Ga0129350_1246301All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida727Open in IMG/M
3300012524|Ga0129331_1207636All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida587Open in IMG/M
3300012528|Ga0129352_10080505All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida730Open in IMG/M
3300012963|Ga0129340_1272872All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida643Open in IMG/M
3300012963|Ga0129340_1326270All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida809Open in IMG/M
3300012965|Ga0129346_1245790All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida574Open in IMG/M
3300012965|Ga0129346_1257792All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida584Open in IMG/M
3300012969|Ga0129332_1479592All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida791Open in IMG/M
3300016703|Ga0182088_1278643All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida695Open in IMG/M
3300016726|Ga0182045_1202594All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida638Open in IMG/M
3300016727|Ga0182051_1301394All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida606Open in IMG/M
3300016729|Ga0182056_1245734All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida648Open in IMG/M
3300016737|Ga0182047_1422737All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida613Open in IMG/M
3300017786|Ga0181424_10469037All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida506Open in IMG/M
3300017950|Ga0181607_10291350All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida921Open in IMG/M
3300018413|Ga0181560_10202567All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida966Open in IMG/M
3300018420|Ga0181563_10277115All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida989Open in IMG/M
3300018649|Ga0192969_1037998All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea719Open in IMG/M
3300018730|Ga0192967_1052391All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea683Open in IMG/M
3300018968|Ga0192894_10234371All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea613Open in IMG/M
3300018981|Ga0192968_10081111All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea875Open in IMG/M
3300018982|Ga0192947_10127902All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida848Open in IMG/M
3300019021|Ga0192982_10115895All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea910Open in IMG/M
3300019022|Ga0192951_10184861All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea756Open in IMG/M
3300019043|Ga0192998_10199587All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea591Open in IMG/M
3300019050|Ga0192966_10140230All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida854Open in IMG/M
3300019051|Ga0192826_10234912All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida676Open in IMG/M
3300019261|Ga0182097_1064322All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida634Open in IMG/M
3300019262|Ga0182066_1305461All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida675Open in IMG/M
3300019272|Ga0182059_1288989All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida711Open in IMG/M
3300019276|Ga0182067_1449008All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida532Open in IMG/M
3300020013|Ga0182086_1098533All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida620Open in IMG/M
3300021336|Ga0210307_1077294All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1149Open in IMG/M
3300021350|Ga0206692_1587449All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea811Open in IMG/M
3300021359|Ga0206689_10586322All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida714Open in IMG/M
3300021378|Ga0213861_10131145All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida1448Open in IMG/M
3300021378|Ga0213861_10366478All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida718Open in IMG/M
3300021902|Ga0063086_1022946All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea778Open in IMG/M
3300021902|Ga0063086_1060193All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea692Open in IMG/M
3300021962|Ga0222713_10328305All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida964Open in IMG/M
3300023175|Ga0255777_10291448All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida928Open in IMG/M
3300025340|Ga0208866_1004658All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida846Open in IMG/M
3300025426|Ga0208739_1047817All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea698Open in IMG/M
3300025608|Ga0209654_1041026All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida1495Open in IMG/M
3300025701|Ga0209771_1041609All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida1749Open in IMG/M
3300025869|Ga0209308_10155254All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida1048Open in IMG/M
3300025869|Ga0209308_10194448All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida903Open in IMG/M
3300025897|Ga0209425_10253680All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida905Open in IMG/M
3300026182|Ga0208275_1011406All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida1956Open in IMG/M
3300027720|Ga0209617_10163559All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida871Open in IMG/M
3300027752|Ga0209192_10147949All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida930Open in IMG/M
(restricted) 3300027997|Ga0255057_10381060All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida684Open in IMG/M
3300028109|Ga0247582_1126081All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida664Open in IMG/M
3300028134|Ga0256411_1266852All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida524Open in IMG/M
3300030699|Ga0307398_10643981All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida587Open in IMG/M
3300031036|Ga0073978_1577365All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea731Open in IMG/M
3300031522|Ga0307388_10355715All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida939Open in IMG/M
3300031522|Ga0307388_10790106All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea637Open in IMG/M
3300031737|Ga0307387_10434017All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida805Open in IMG/M
3300031738|Ga0307384_10547445All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida551Open in IMG/M
3300031758|Ga0315907_10845093All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida678Open in IMG/M
3300032650|Ga0314673_10301428All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida810Open in IMG/M
3300032707|Ga0314687_10486656All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida687Open in IMG/M
3300032734|Ga0314706_10547677All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida555Open in IMG/M
3300032745|Ga0314704_10320257All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida857Open in IMG/M
3300032751|Ga0314694_10259685All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida741Open in IMG/M
3300032751|Ga0314694_10283373All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida708Open in IMG/M
3300033572|Ga0307390_10722892All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea625Open in IMG/M
3300033984|Ga0334989_0282324All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida889Open in IMG/M

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
MarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Marine14.04%
MarineEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Marine12.28%
AqueousEnvironmental → Aquatic → Marine → Coastal → Unclassified → Aqueous12.28%
Salt MarshEnvironmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh12.28%
Pelagic MarineEnvironmental → Aquatic → Marine → Pelagic → Unclassified → Pelagic Marine6.14%
SeawaterEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Seawater5.26%
MarineEnvironmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine5.26%
Surface Ocean WaterEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Surface Ocean Water4.39%
FreshwaterEnvironmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater3.51%
Freshwater, PlanktonEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton3.51%
SeawaterEnvironmental → Aquatic → Marine → Coastal → Unclassified → Seawater3.51%
EstuarineEnvironmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine3.51%
SeawaterEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Seawater1.75%
Pelagic MarineEnvironmental → Aquatic → Marine → Neritic Zone → Unclassified → Pelagic Marine1.75%
FreshwaterEnvironmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater0.88%
Freshwater And SedimentEnvironmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater And Sediment0.88%
FreshwaterEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater0.88%
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake0.88%
LakeEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Lake0.88%
FreshwaterEnvironmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater0.88%
Freshwater To Marine Saline GradientEnvironmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient0.88%
Estuary WaterEnvironmental → Aquatic → Marine → Coastal → Unclassified → Estuary Water0.88%
EstuarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine0.88%
Estuarine WaterEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water0.88%
SeawaterEnvironmental → Aquatic → Marine → Strait → Unclassified → Seawater0.88%
SeawaterEnvironmental → Aquatic → Marine → Gulf → Unclassified → Seawater0.88%

Visualization
Powered by ApexCharts



Associated Samples

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Taxon OIDSample NameHabitat TypeIMG/M Link
3300001355Pelagic Microbial community sample from North Sea - COGITO 998_met_08EnvironmentalOpen in IMG/M
3300001951Marine microbial communities from North Seamore Island, Equador - GS034EnvironmentalOpen in IMG/M
3300002835Freshwater microbial communities from Lake Mendota, WI - (Lake Mendota Combined Ray assembly, ASSEMBLY_DATE=20140605)EnvironmentalOpen in IMG/M
3300003216Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - ESP_59LU_5_DNAEnvironmentalOpen in IMG/M
3300003621Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - ESP_85LU_5_DNAEnvironmentalOpen in IMG/M
3300003909Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - ESP_133SG_5_DNAEnvironmentalOpen in IMG/M
3300004095Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE03Jun09EnvironmentalOpen in IMG/M
3300005516Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201306PF49BEnvironmentalOpen in IMG/M
3300005942Estuarine microbial communities from the Columbia River estuary, USA - metaG S.757EnvironmentalOpen in IMG/M
3300006029Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_20_<0.8_DNAEnvironmentalOpen in IMG/M
3300006115Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE27Jul09EnvironmentalOpen in IMG/M
3300006396Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_20_>0.8_RNA2 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006415Algae and Fungi communities from freshwater lake (pre-blooming) in Auvergne, France - collected by filtering lake water, a 'reference genome' of the lake communityEnvironmentalOpen in IMG/M
3300006803Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_20_>0.8_DNAEnvironmentalOpen in IMG/M
3300007550Estuarine microbial communities from the Columbia River estuary - metaG 1549A-3EnvironmentalOpen in IMG/M
3300007992Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1461AB_0.2umEnvironmentalOpen in IMG/M
3300008111Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE4, Sample E2014-0050-C-NAEnvironmentalOpen in IMG/M
3300008113Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE4, Sample E2014-0050-3-NAEnvironmentalOpen in IMG/M
3300008117Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0108-C-NAEnvironmentalOpen in IMG/M
3300008120Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0108-3-NAEnvironmentalOpen in IMG/M
3300009049Estuarine microbial communities from the Columbia River estuary - metaG 1558A-02EnvironmentalOpen in IMG/M
3300009071Pelagic marine microbial communities from North Sea - COGITO_mtgs_120405EnvironmentalOpen in IMG/M
3300009080Estuarine microbial communities from the Columbia River estuary - Ebb tide ETM metaG S.759EnvironmentalOpen in IMG/M
3300009151Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130820_MF_MetaGEnvironmentalOpen in IMG/M
3300009172Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB2_154EnvironmentalOpen in IMG/M
3300009263Eukaryotic communities of water from the North Atlantic ocean - ACM27EnvironmentalOpen in IMG/M
3300009265Eukaryotic communities of water from the North Atlantic ocean - ACM8EnvironmentalOpen in IMG/M
3300009445Pelagic marine microbial communities from North Sea - COGITO_mtgs_110331EnvironmentalOpen in IMG/M
3300009508Pelagic marine microbial communities from North Sea - COGITO_mtgs_120412EnvironmentalOpen in IMG/M
3300009526Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB11_90EnvironmentalOpen in IMG/M
3300009599Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - MBTS_5May14_M1_3um Metatranscriptome (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300009606Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - MBTS_5May14_M2_3um Metatranscriptome (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300010368Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_15_0.2_DNAEnvironmentalOpen in IMG/M
3300012504Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_20_0.8_RNA2 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012520Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_15_0.2_RNA2 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012522Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_15_0.2_RNA2 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012523Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_27_0.8_RNA2 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012524Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_31_0.2_RNA1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012528Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_27_0.2_RNA1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012963Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_15_0.8_RNA1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012965Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_20_0.8_RNA1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012969Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_31_0.2_RNA2 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300016703Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 041407CT metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300016726Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 011504BT metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300016727Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 011510BT metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300016729Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 101402AT metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300016737Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 011506CT metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300017786Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 47 SPOT_SRF_2013-09-18EnvironmentalOpen in IMG/M
3300017950Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 041413US metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300018413Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011509CT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300018420Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011512CT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300018649Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_084 - TARA_N000001440 (ERX1782476-ERR1712161)EnvironmentalOpen in IMG/M
3300018730Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_084 - TARA_N000001438 (ERX1782285-ERR1712028)EnvironmentalOpen in IMG/M
3300018968Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_068 - TARA_N000000713 (ERX1782205-ERR1712096)EnvironmentalOpen in IMG/M
3300018981Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_084 - TARA_N000001440 (ERX1782157-ERR1712238)EnvironmentalOpen in IMG/M
3300018982Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_082 - TARA_N000001384 (ERX1782271-ERR1711935)EnvironmentalOpen in IMG/M
3300019021Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_085 - TARA_N000001034 (ERX1782268-ERR1711957)EnvironmentalOpen in IMG/M
3300019022Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_082 - TARA_N000001390 (ERX1782474-ERR1712194)EnvironmentalOpen in IMG/M
3300019043Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_109 - TARA_N000001784 (ERX1782103-ERR1712098)EnvironmentalOpen in IMG/M
3300019050Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_084 - TARA_N000001438 (ERX1782371-ERR1711865)EnvironmentalOpen in IMG/M
3300019051Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_040 - TARA_N000000064 (ERX1782232-ERR1712227)EnvironmentalOpen in IMG/M
3300019261Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 041413BS (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300019262Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 101412AT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300019272Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 101405AT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300019276Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 101413AT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300020013Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 041406CT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021336Metatranscriptome of estuarine water microbial communities from the Columbia River estuary, Oregon, United States ? R1073 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021350Metatranscriptome of ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M2 40m 12015 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021359Metatranscriptome of ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 100m 12015 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021378Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO131EnvironmentalOpen in IMG/M
3300021902Metatranscriptome of marine eukaryotic phytoplankton communities from the Arctic Ocean - ARK-1S (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021962Estuarine water microbial communities from San Francisco Bay, California, United States - C33_649DEnvironmentalOpen in IMG/M
3300023175Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101402AT metaGEnvironmentalOpen in IMG/M
3300025340Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE20Aug07 (SPAdes)EnvironmentalOpen in IMG/M
3300025426Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE27Jul09 (SPAdes)EnvironmentalOpen in IMG/M
3300025608Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - ESP_161SG_22_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300025701Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - ESP_59LU_5_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300025869Pelagic marine microbial communities from North Sea - COGITO_mtgs_120405 (SPAdes)EnvironmentalOpen in IMG/M
3300025897Pelagic Microbial community sample from North Sea - COGITO 998_met_05 (SPAdes)EnvironmentalOpen in IMG/M
3300026182Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201306PF49B (SPAdes)EnvironmentalOpen in IMG/M
3300027720Freshwater microbial communities from dead zone in Lake Erie, Canada - CCB epilimnion July 2011 (SPAdes)EnvironmentalOpen in IMG/M
3300027752Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB2_154 (SPAdes)EnvironmentalOpen in IMG/M
3300027997 (restricted)Seawater microbial communities from Amundsen Gulf, Northwest Territories, Canada - Cases_109_6EnvironmentalOpen in IMG/M
3300028109Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 41R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300028134Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - WCR_12 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300030699Metatranscriptome of marine eukaryotic phytoplankton communities from Antarctic Ocean - PS103-11 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031036Seawater microbial communities from Saanich Inlet, British Columbia, Canada - DeepDOM_E7_X_0.2 metaT (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031522Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean ? PS103-3.R2 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031737Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean ? PS103-3.R1 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031738Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean ? PS103-2.R1 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031758Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA123EnvironmentalOpen in IMG/M
3300032650Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red2_22May_deep (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032707Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red4_22May_deep (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032734Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Amb9_26May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032745Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Shad8_28May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032751Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Plim5_26May_deep (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300033572Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean ? PS103-4.R1 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300033984Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME13Mar2001-rr0030EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Protein ID Sample Taxon ID Habitat Sequence
JGI20158J14315_1008995423300001355Pelagic MarineMSHPSRIALQMVLGRRATCVVPKSTLFSSRLGMTNKYAHDYACEDEFFEREMTMLDAKITTLPLPTDFRHKEAPTDEIQPPHWNDVRFNFFPENLDRRCYIHDNLAIFYDMQNDYHHGVGY*
GOS2249_100141533300001951MarineMSNKYAYDYACEDEFFEREMTMLDAKITKLPLPLDFKHVEAPTDEIQPPHWNDVRFNFLPQNLDRRCYVHDNLAIFYDMQNDYHHGVGY*
B570J40625_10139741423300002835FreshwaterVIIPKSTIFASRLGMTNKYAYDYACEDEFFEREMTLLDAKLLSLPLPENLRHKEAPTDELLPPHWNDVRFNYFPENIDRRCFIHDNLAIFYNMEHDYLHGVGF*
JGI26079J46598_102282233300003216MarineMVMRRSSCVVPKSTLFASRLGMTNKYAYDYACEDEFFEREMTLLDAKTTSLPLPTDFKHVEAPTDEIQPPHWNDVRFNFFPQNLDRRCYVHDNLAIFYDMQNDYHHGVGY*
JGI26083J51738_1012119713300003621MarineIKSLKLKMSQRLALSMVMRRSSCVVPKSTLFASRLGMTNKYAYDYACEDEFFEREMTLLDAKTTSLPLPTDFKHVEAPTDEIQPPHWNDVRFNFFPQNLDRRCYVHDNLAIFYDMQNDYHHGVGY*
JGI26087J52781_101984323300003909MarineLKMSQRLALSMVMRRSSCVVPKSTLFASRLGMTNKYAYDYACEDEFFEREMTLLDAKTTSLPLPTDFKHVEAPTDEIQPPHWNDVRFNFFPQNLDRRCYVHDNLAIFYDMQNDYHHGVGY
Ga0007829_1008942113300004095FreshwaterMTNKYAYDYACEDEFFEREMTLLDAKLLSLPLPDNIRHKDAPTDELQPPHWNDVRFNYFPENIDRRCYIHDNLAIFYNMEHDYLHGVGF*
Ga0066831_1001308923300005516MarineMFNSIVPKSTIYATRLGMTNKYAYDYACEDEFFEREMTFLEARLMHLPIPDDFKHKELPIDEIYPPHWNDVRFNFHPENIDRRAFIHDNLVIFYNM*
Ga0070742_1017509023300005942EstuarineSCVVPKSTLFASRLGMTNKYAYDYACEDEFFEREMTLLDAKTTSLPLPTDFKHVEAPTDEIQPPHWNDVRFNFFPQNLDRRCYVHDNLAIFYDMQNDYHHGVGY*
Ga0075466_107743223300006029AqueousMAFRRNNLIVPKATIFASRLGMTNKYAHDYACEDEYFEREMTMLDAKLQTLPLPTTFKHKELPINEIYPPHWNDVRFNFLPQNLDRRCFIHDNMAIFYNMHNDYYHGVGY*
Ga0007816_108539023300006115FreshwaterAYDYACEDEFFEREMTLLDAKLLSLPLPDNIRHKDAPTDELQPPHWNDVRFNYFPENIDRRCYIHDNLAIFYNMEHDYLHGVGF*
Ga0075493_139112423300006396AqueousKRQLINMAFRRNNLIVPKATIFASRLGMTNKYAHDYACEDEYFEREMTMLDAKLQTLPLPTTFKHKELPINEIYPPHWNDVRFNFLPQNLDRRCFIHDNMAIFYNMHNDYYHGVGY*
Ga0099654_1060705923300006415LakeMSNKYAYDYACEDEFFEREMTLLDAKLLSLPLPENFRHKEAPTDEIYPPHWNDVRFNYFPENIDRRCFIHDNLPIFYNMEHDYLHGVGY*
Ga0075467_1032095113300006803AqueousMSQRLALSMVMRRTSCVVPKSTLFASRLGMTNKYAYDYACEDEFFEREMTLLDAKTTSLPLPTDFKHVDAPTDEIQPPHWNDVRFNFFPQNLDRRCYVHDNLAIFYDMQNDYHHGVGY*
Ga0102880_113966323300007550EstuarineMSQRLALSMVMRRSSCVVPKSTLFASRLGMTNKYAYDYACEDEFFEREMTLLDAKTTSLPLPTDFKHVEAPTDEIQPPHWNDVRFNFFPQNLDRRCYVHDNLAIFYDMQNDYHHGVGY*
Ga0105748_1054822923300007992Estuary WaterCVVPKSTLFASRLGMTNKYAYDYACEDEFFEREMTLLDAKTTSLPLPTDFKHVEAPTDEIQPPHWNDVRFNFFPQNLDRRCYVHDNLAIFYDMQNDYHHGVGY*
Ga0114344_123001513300008111Freshwater, PlanktonYDYACEDEFFEREMTLLDAKLLSLPLPENLRHKEAPTDELLPPHWNDVRFNYFPENIDRRCFIHDNLAIFYNMEHDYLHGVGF*
Ga0114346_132718813300008113Freshwater, PlanktonRLGMTNKYAYDYACEDEFFEREMTLLDAKLLSLPLPENLRHKEAPTDELLPPHWNDVRFNYFPENIDRRCFIHDNLAIFYNMEHDYLHGVGF*
Ga0114351_125312113300008117Freshwater, PlanktonMTNKYAYDYACEDEFFEREMTLLDAKLLSLPLPENLRHKEAPTDELLPPHWNDVRFNYFPENIDRRCFIHDNLAIFYNMEHDYLHGVGF*
Ga0114355_120192913300008120Freshwater, PlanktonMTLLDAKLLSLPLPENLRHKEAPTDELLPPHWNDVRFNYFPENIDRRCFIHDNLAIFYNMEHDYLHGVGF*
Ga0102911_104417333300009049EstuarineMTNKYAYDYACEDEFFEREMTLLDAKTTSLPLPTDFKHVEAPTDEIQPPHWNDVRFNFFPQNLDRRCYVHDNLAIFYDMQNDYHHGVGY*
Ga0115566_1010101823300009071Pelagic MarineMVLGRRATCVVPKSTLFSSRLGMTNKYAHDYACEDEFFEREMTMLDAKITTLPLPTDFRHKEAPTDEIQPPHWNDVRFNFFPENLDRRCYIHDNLAIFYDMQNDYHHGVGY*
Ga0115566_1011015633300009071Pelagic MarineMSQRLALSMVMRRSSCVVPKSTLFASRLGMTNKYAYDYACEDEFFEREMTLLDAKTTSLPLPTDFKHVDAPTDEIQPPHWNDVRFNFFPQNLDRRCYVHDNLAIFYDMQNDYHHGVGY*
Ga0102815_1035366813300009080EstuarineKSLKLKMSQRLALSMVMRRSSCVVPKSTLFASRLGMTNKYAYDYACEDEFFEREMTLLDAKTTSLPLPTDFKHVEAPTDEIQPPHWNDVRFNFFPQNLDRRCYVHDNLAIFYDMQNDYHHGVGY*
Ga0114962_1031451823300009151Freshwater LakeMSNKYAYDYACEDEFFEREMTLLDAKLMSLPLPENFRHKEAPVDELLPPHWNDVRFNYFPENIDRRCFIHDNLPIFYNMEHDYLHGVGF*
Ga0114995_1026746933300009172MarineMGARSIRNSCITPRATIYAARIGMTNKYAFDYACEDEYHEREMTLADAKTMTLPLPDNFRHKSLPMDDYYPPHWNDVRFNHRQQNFDRRMFLHDNMAISYNM*
Ga0103872_102111923300009263Surface Ocean WaterMILNNSCVVSKTSIYATRLGMSNKYKFDYACEDEFFEREMTSLDAKLMHLPIPDNYRHKSLPMDEYMPPHWNDVRFNFLPQNIDRRCYIHDNLAILYNM*
Ga0103872_102208813300009263Surface Ocean WaterVLRRNSCVVPRSTLYASRLGMSNKYAYDYACEDEFFEREMTMLDAKITKLPLPLDFKHVEAPTDEIQPPHWNDVRFNFLPQNLDRRCYVHDNLAIFYDMQNDYHHGVGY*
Ga0103872_103836613300009263Surface Ocean WaterNKYAYDYACEDEFFEREMTMLDAKITKLPLGEDFRHVEAPTDEIQPPHWNDVRFNFLPQNLDRRCYVHDNLAIFYDMQNDYMHGVGF*
Ga0103873_107094823300009265Surface Ocean WaterASRLGMTNKYAYYYACEDEFFEREMTMLDAKITKLPLGEDFRHVEAPTDEIQPPHWNDVRFNFLPQNLDRRCYVHDNLAIFYDMQNDYMHGVGF*
Ga0103873_107484713300009265Surface Ocean WaterMTSLDAKLMHLPIPDNYRHKSLPMDEYMPPHWNDVRFNFLPQNIDRRCYIHDNLAILYNMQDDYMHGVGF*
Ga0115553_105787923300009445Pelagic MarineMTNKYAYDYACEDEFFEREMTLLDAKTTSLPLPTDFKHVDAPTDEIQPPHWNDVRFNFFPQNLDRRCYVHDNLAIFYDMQNDYHHGVGY*
Ga0115553_117445523300009445Pelagic MarineMVMGRRATCVVPKATLFSSRLGMTNKYAYDYACEDEFFEREMTLLDARTTHLPLPVDFKHVEAPTDEIQPPHWNDVRFNFLPQNLDRRCYIHDNLAIFYDM*
Ga0115567_1025338823300009508Pelagic MarineMVMGRRATCVVPKATLFSSRLGMTNKYAYDYACEDEFFEREMTMLDARTTHLPLPVDFKHVEAPTDEIQPPHWNDVRFNFLPQNLDRRCYIHDNLAIFYDM*
Ga0115004_1030605623300009526MarineMGARSIRNSCITPRATIYAARIGMTNKYAFDYACEDEYHEREMTLADAKTLTLPLPDNFRHKSLPMDDYYPPHWNDVRFNHRQQNFDRRMFLHDNMAISYNM*
Ga0115103_135642423300009599MarineSVVVPRATIYASRLGMTNKYANDYACEDEYFEREMTLLDSKLTHLPLGDDYRHKELPVDEYQPSHWNDVRFNYLPQNMDRRMFLHDGRSILYNMHEDYHHGVGY*
Ga0115103_145730113300009599MarineINMSKRLALNMVLRSRASPVVPKSMIYASRLGMSNKYAHDYACEDEYFEREMTLLDAKLLPLPLPDDYRHKELPIDEIYPPHWNDVRFNFLPQNLDRRAYIHDNLMNQYDM*
Ga0115103_161748513300009599MarineQRLALNMVLRRNSIIVPRSTLYASRLGMSNKYAYDYACEDEFFEREMTLLDAKITKLPLPLDFKHVEAPTDEIQPPHWNDVRFNFLPQNLDRRCYVHDNLAIFYDMQNDYHHGVGY*
Ga0115102_1019625613300009606MarineLAVQAAFGPGRRAIGINMLVPNKTAFFASRLGMTNKYAHDYACEDEYFEREMTLLDAKLMHLPIPTHHKHKAAPVDDMQPPHWNDVRFNYFPQNLDRRCYIHDNLAIFYNMQDDYMHGVGF*
Ga0115102_1044405113300009606MarineMSMVLGRRATCIVPKATIFSARLGMTNKYAYDYACEDEFFEREMTLLDARTTQLPLPDDFRHKEAPTDEIQPPHWNDVRFNFLPQNLDRRCYIHDNMAIFYDMQNDYHHGVGY*
Ga0115102_1066049213300009606MarineSRLAMQMVLGKGRISCIVPKSTIFATRLGMTNKYAHDYACEDEFFEREMTMLDAKITKLPLGEDFRHVEAPTDEIQPPHWNDVRFNFLPQNIDRRCYVHDNLAIFYDMQNDYMHGVGF*
Ga0129324_1015210713300010368Freshwater To Marine Saline GradientVVPRAAIYASRLGMTNKYANDYACEDEYFEREMTLLDSKLMHLPLPDDYHHKELPVDEYQPSHWNDVRFNYLPQNFDRRMFLHDGRTILYNMHEDYHHGVGY*
Ga0129347_117891733300012504AqueousVKMNHPSRIAMQMVLGRRATCVVPKATLFSSRLGMTNKYAHDYACEDEFFEREMTLLDARTTHLPLPEDFRHKELPTDEIQPPHWNDVRFNFLPQNLDRRCYIHDNLAIFYDMQNDYHHGVGY*
Ga0129344_138402913300012520AqueousSNSCIVSKTSIYATRLGMSNKYKFDYACEDEFFEREMTSLDAKLMHLPIPDNYRHKSLPMDEYMPPHWNDVRFNFLPQNIDRRCYIHDNLAILYNMQDDYMHGVGF*
Ga0129326_142036813300012522AqueousHPSRIALQMVLGRRATCVVPKSTLFSSRLGMTNKYAHDYACEDEFFEREMTMLDAKITTLPLPTDFRHKEAPTDEIQPPHWNDVRFNFFPENLDRRCYIHDNLAIFYDMQNDYHHGVGY*
Ga0129350_124630113300012523AqueousRIAMQMVLGRRATCVVPKATLFSSRLGMTNKYAHDYACEDEFFEREMTLLDARTTHLPLPEDFRHKELPTDEIQPPHWNDVRFNFLPQNLDRRCYIHDNLAIFYDMQNDYHHGVGY*
Ga0129331_120763623300012524AqueousATCVVPKSTLFSSRLGMTNKYAHDYACEDEFFEREMTMLDAKITTLPLPTDFRHKEAPTDEIQPPHWNDVRFNFFPENLDRRCYIHDNLAIFYDMQNDYHHGVGY*
Ga0129352_1008050523300012528AqueousMSNKYKFDYACEDEFFEREMTSLDAKLMHLPIPDNYRHKSLPMDEYMPPHWNDVRFNFLPQNIDRRCYIHDNLAILYNMQDDYMHGVGF*
Ga0129340_127287213300012963AqueousNHPSRIAMQMVLGRRATCVVPKATLFSSRLGMTNKYAHDYACEDEFFEREMTLLDARTTHLPLPEDFRHKELPTDEIQPPHWNDVRFNFLPQNLDRRCYIHDNLAIFYDMQNDYHHGVGY
Ga0129340_132627023300012963AqueousTALQRVLGGRSMILSNSCIVSKTSIYATRLGMSNKYKFDYACEDEFFEREMTSLDAKLMHLPIPDNYRHKSLPMDEYMPPHWNDVRFNFLPQNIDRRCYIHDNLAILYNMQDDYMHGVGF
Ga0129346_124579013300012965AqueousQMVLGRRATCVVPKATLFSSRLGMTNKYAHDYACEDEFFEREMTLLDARTTHLPLPEDFRHKELPTDEIQPPHWNDVRFNFLPQNLDRRCYIHDNLAIFYDMQNDYHHGVGY*
Ga0129346_125779223300012965AqueousALQRVLGGRSMILSNSCIVSKTSIYATRLGMSNKYKFDYACEDEFFEREMTSLDAKLMHLPIPDNYRHKSLPMDEYMPPHWNDVRFNFLPQNIDRRCYIHDNLAILYNMQDDYMHGVGF*
Ga0129332_147959223300012969AqueousVKMSHPSRIALQMVLGRRATCVVPKSTLFSSRLGMTNKYAHDYACEDEFFEREMTMLDAKITTLPLPTDFRHKEAPTDEIQPPHWNDVRFNFFPENLDRRCYIHDNLAIFYDMQNDYHHGVGY*
Ga0182088_127864323300016703Salt MarshVVPKSTLFASRLGMTNKYAYDYACEDEFFEREMTLLDAKITHLPLPTDFKHVEAPTDEIQPPHWNDVRFNFFPQNLDRRCYVHDNLAIFYDMQNDYHHGVGY
Ga0182045_120259413300016726Salt MarshLGMTNKYAHDYACEDEYFEREMTMLDAKLQTLPLPTTFKHKELPINEIYPPHWNDVRFNFLPQNLDRRCFIHDNMAIFYNMHNDYYHGVGY
Ga0182051_130139413300016727Salt MarshIVPKATIFASRLGMTNKYAYDYACEDEYFEREMTMLDAKLQTLPLPTTFKHKELPINEIYPPHWNDVRFNFLPQNLDRRCFIHDNMAIFYNMHNDYYHGVGY
Ga0182056_124573413300016729Salt MarshRNSCVVPKSTLFASRLGMTNKYAYDYACEDEFFEREMTLLDAKITHLPLPTDFKHVEAPTDEIQPPHWNDVRFNFFPQNLDRRCYVHDNLAIFYDMQNDYHHGVGY
Ga0182047_142273723300016737Salt MarshYAYDYACEDEYFEREMTMLDAKLQTLPLPTTFKHKELPINEIYPPHWNDVRFNFLPQNLDRRCFIHDNMAIFYNMHNDYYHGVGY
Ga0181424_1046903723300017786SeawaterGRRATCVVPKSTLFSSRLGMTNKYAYDYACEDEFFEREMTMLDARSTHLPLPEDWRHKELPTDEIQPPHWNDVRFNFLPQNLDRRCYIHDNLAIFYDMQNDYHHGVGY
Ga0181607_1029135013300017950Salt MarshMSQRLALSMVMRRNSCVVPKSTLFASRLGMTNKYAYDYACEDEFFEREMTLLDAKITHLPLPTDFKHVEAPTDEIQPPHWNDVRFNFFPQNLDRRCYVHDNLAIFYDMQNDYHHGVGY
Ga0181560_1020256723300018413Salt MarshMSKRQLINMAFRRNNLIVPKATIFASRLGMTNKYAHDYACEDEYFEREMTMLDAKLQTLPLPTTFKHKELPINEIYPPHWNDVRFNFLPQNLDRRCFIHDNMAIFYNMHNDYYHGVGY
Ga0181563_1027711523300018420Salt MarshMAFRRNNLIVPKATIFASRLGMTNKYAHDYACEDEYFEREMTMLDAKLQTLPLPTTFKHKELPINEIYPPHWNDVRFNFLPQNLDRRCFIHDNMAIFYNMHNDYYHGVGY
Ga0192969_103799813300018649MarineSRLGMSNKYANDYACEDEFFEREMTLLEAKETHLPLSDNFKHKSLPMDEYMPPHWNDVRFNFIPENIDRRCYIHDNLAIFYDMKNDYMHGVGF
Ga0192967_105239133300018730MarineEMTLLEAKETHLPLSDNFKHKSLPMDEYMPPHWNDVRFNFIPENIDRRCYIHDNLAIFYDMKNDYMHGVGF
Ga0192894_1023437113300018968MarineRLGMTNRYAYDYACEDEYYEKEMTMLEAKVFHLPLPETHKHKEYPLHDLYAPHWNDVRFNFLPQNLDRRNFSHDNLPIFYNMHMDYHHGIGY
Ga0192968_1008111113300018981MarineMFLSSSGLAPKSTIFASRLGMSNKYANDYACEDEFFEREMTLLEAKETHLPLSDNFKHKSLPMDEYMPPHWNDVRFNFIPENIDRRCYIHDNLAIFYDMKNDYMHGVGF
Ga0192947_1012790233300018982MarineSLYSSRLGMTNKYAYDYACEDEFFEREMTLLDAKMMSLPLPDDFKHKELPMNEIFPPHINDVRFNFLPQNIDRRCFIHDNMAIFYDLNKDYHHGVGYIDEDMDYELPDPYSDMH
Ga0192982_1011589513300019021MarineMFLSCSGLAPKSTIFASRLGMSNKYANDYACEDEFFEREMTLLEAKETHLPLSDNFKHKSLPMDEYMPPHWNDVRFNFIPENIDRRCYIHDNLAIFYDMKNDYMHGVGF
Ga0192951_1018486123300019022MarineCSGLAPKSTIFASRLGMSNKYANDYACEDEFFEREMTLLEAKETHLPLSDNFRHKSLPMDEYMPPHWNDVRFNFIPENIDRRCYIHDNLAIFYNMKDDYMHGVGF
Ga0192998_1019958733300019043MarineDYACEDEFFEREMTLLDAKLMHFPVETRHKSLPMDEFQPPHWNDVRFNYLPEKIDRRCYIHDNLAVYYNMQTDYMHGVGF
Ga0192966_1014023013300019050MarineMSHPSRIAMQMVLGRRATCIVPKSTLFSTRLGMTNKYAHDYACEDEFFEREMTLLDARTMSLPLSEDFRHAEAPTDEIQPPHWNDVRFNFLPQNLDRRCYIHDNLAIFYDMQNDYHHGVG
Ga0192826_1023491223300019051MarineFEREMTLLEAKETHLPLSDNFRHKSLPMDEYMPPHWNDVRFNFIPENIDRRCYIHDNLAIYYNMKDDYMHGVGF
Ga0182097_106432223300019261Salt MarshALSMVMRRNSCVVPKSTLFASRLGMTNKYAYDYACEDEFFEREMTLLDAKITHLPLPTDFKHVEAPTDEIQPPHWNDVRFNFFPQNLDRRCYVHDNLAIFYDMQNDYHHGVGY
Ga0182066_130546123300019262Salt MarshQRLALSMVMRRNSCVVPKSTLFASRLGMTNKYAYDYACEDEFFEREMTLLDAKITHLPLPTDFKHVEAPTDEIQPPHWNDVRFNFFPQNLDRRCYVHDNLAIFYDMQNDYHHGVGY
Ga0182059_128898923300019272Salt MarshLALSMVMRRNSCVVPKSTLFASRLGMTNKYAYDYACEDEFFEREMTLLDAKITHLPLPTDFKHVEAPTDEIQPPHWNDVRFNFFPQNLDRRCYVHDNLAIFYDMQNDYHHGVGY
Ga0182067_144900813300019276Salt MarshLGMTNKYAYDYACEDEFFEREMTLHNAKITHLPLPTDFKHVEAPTDEIQPPHWNDVRFNFFPQNLDRRCYVHDNLAIFYDMQNDYHHGVGF
Ga0182086_109853323300020013Salt MarshGMTNKYAYDYACEDEFFEREMTLLDAKITHLPLPTDFKHVEAPTDEIQPPHWNDVRFNFFPQNLDRRCYVHDNLAIFYDMQNDYHHGVGY
Ga0210307_107729413300021336EstuarineMSQRLALSMVMRRSSCVVPKSTLFASRLGMTNKYAYDYACEDEFFEREMTLLDAKTTSLPLPTDFKHVEAPTDEIQPPHWNDVRFNFFPQNLDRRCYVHDNLAIFYDMQNDYHHGVGY
Ga0206692_158744913300021350SeawaterMVMKRTNGMVNPSMLVGCVAPKNAIFASRLGMSNKYAYDYACEDEYFEREMTLLDAKTAHLPIPVAMKHKSLPMDEVMPPHWNDVRFNFIPQNLDRRMFRPDTLPIFYDMHMDYHHGVGY
Ga0206689_1058632213300021359SeawaterNKSGVAPKALYRASRIGMTNKYAHDYACEDEYFEREMTLMDSKLQSLPLPTTWKHKELPMDDIMPLHWNDVRFNFLPQNIDRRMFLHDNLAILYDMHNDYYHGVGY
Ga0213861_1013114513300021378SeawaterMSQRLALSMVMRRSSCVVPKSTLFASRLGMTNKYAYDYACEDEFFEREMTLLDAKTTSLPLPTDFKHVDAPTDEIQPPHWNDVRFNFFPQNLDRRCYVHDNLAIFYDMQNDYHHGVGY
Ga0213861_1036647813300021378SeawaterMSHPSRIALQMVLGRRATCVVPKSTLFSSRLGMTNKYAHDYACEDEFFEREMTMLDAKITTLPLPTDFRHKEAPTDEIQPPHWNDVRFNFFPENLDRRCYIHDNLAIFYDMQNDYHH
Ga0063086_102294613300021902MarineMVMKRTNGMVNPTMLVGCVAPKNAIFASRLGMSNKYAYDYACEDEYFEREMTLLDAKTAHLPIPVAMKHKSLPMDEVMPPHWNDVRFNFIPQNLDRRMFRPDTLPIFYDMHMDYHHGVGY
Ga0063086_106019313300021902MarineGMSNRYAYDYACQDEYFEREMTLLDAKTSHLPIPETVKHKSLPMDEVMPPHWNDVRFNFIPQNLDRRMFLHDTLPIFYDMHADYHHGVGY
Ga0222713_1032830523300021962Estuarine WaterMSKSLLLNMAFRRNNNIVVPKATFFAARLGMTNKYAYDYACEDEFFEREMTMLDAKLQTLPLPTTFKHKELPINEIYPAHWNDVRFNYLPQNLDRRAF
Ga0255777_1029144813300023175Salt MarshMSQRLALSMVMRRNSCVVPKSTLFASRLGMTNKYAYDYACEDEFFEREMTLLDAKITSLPLPTDFKHVEAPTDEIQPPHWNDVRFNFFPQNLDRRCYVHDNLAIFY
Ga0208866_100465823300025340FreshwaterMTNKYAYDYACEDEFFEREMTLLDAKLLSLPLPDNIRHKDAPTDELQPPHWNDVRFNYFPENIDRRCYIHDNLAIFYNMEHDYLHGVGF
Ga0208739_104781713300025426FreshwaterYAYDYACEDEFFEREMTLLDAKLLSLPLPDNIRHKDAPTDELQPPHWNDVRFNYFPENIDRRCYIHDNLAIFYNMEHDYLHGVGF
Ga0209654_104102623300025608MarineMVMRRSSCVVPKSTLFASRLGMTNKYAYDYACEDEFFEREMTLLDAKTTSLPLPTDFKHVEAPTDEIQPPHWNDVRFNFFPQNLDRRCYVHDNLAIFYDMQNDYHHGVGY
Ga0209771_104160923300025701MarineVPKSTLFASRLGMTNKYAYDYACEDEFFEREMTLLDAKTTSLPLPTDFKHVEAPTDEIQPPHWNDVRFNFFPQNLDRRCYVHDNLAIFYDMQNDYHHGVGY
Ga0209308_1015525413300025869Pelagic MarineMSHPSRIALQMVLGRRATCVVPKSTLFSSRLGMTNKYAHDYACEDEFFEREMTMLDAKITTLPLPTDFRHKEAPTDEIQPPHWNDVRFNFFPENLDRRCYIHDNLAIFYDMQNDYHHGVG
Ga0209308_1019444823300025869Pelagic MarineMSHPSRIAMQMVMGRRATCVVPKATLFSSRLGMTNKYAYDYACEDEFFEREMTMLDARTTHLPLPVDFKHVEAPTDEIQPPHWNDVRFNFLPQNLDRRCYIHDNLAIFYDM
Ga0209425_1025368023300025897Pelagic MarineMSHPSRIAMQMVMGRRATCVVPKATLFSSRLGMTNKYAYDYACEDEFFEREMTLLDARTTHLPLPVDFKHVEAPTDEIQPPHWNDVRFNFLPQNLDRRCYIHDNLAIFYDM
Ga0208275_101140623300026182MarineMFNSIVPKSTIYATRLGMTNKYAYDYACEDEFFEREMTFLEARLMHLPIPDDFKHKELPIDEIYPPHWNDVRFNFHPENIDRRAFIHDNLVIFYNM
Ga0209617_1016355913300027720Freshwater And SedimentMSNKYAYDYACEDEFFEREMTLLDAKLMSLPLPENFRHKEAPVDELLPPHWNDVRFNYFPENIDRRCFIHDNLPIFYNMEHDYLHGVGF
Ga0209192_1014794913300027752MarineMGARSIRNSCITPRATIYAARIGMTNKYAFDYACEDEYHEREMTLADAKTMTLPLPDNFRHKSLPMDDYYPPHWNDVRFNHRQQNFDRRMFLHDNMAISYNM
(restricted) Ga0255057_1038106013300027997SeawaterMSQRLALSMVLRRNSCVVPKATLFASRLGMTNKYAYDYACEDEFFEREMTMLDAKVTTLPLPTDFKHVDAPTDEIQPPHWNDVRFNFLPQNLDRRCYVHDNLAIFYDMQNDYHHGVGY
Ga0247582_112608113300028109SeawaterNKYKFDYACEDEYFEREMTLMDAKDVMLPLPETWRHKTLPMHEYFPPHWNDVRFNYIPENIDRRMFLHDDLAVYYNMQHDYIHSVGC
Ga0256411_126685213300028134SeawaterMVMKRTNGMVNPSLFNGCVAPKNAIFASRLGMSNKYAHDYACEDEYFEREMTLLDAKTAHLPIPTSYKHKSLPMDEVMPPHWNDVRFNFIPQNLDRRMFLHDTLPIFYDMH
Ga0307398_1064398113300030699MarinePSRIAMQMVLGRRATCIVPKSTLFSTRLGMTNKYAHDYACEDEFFEREMTLLDARTMSLPLSEDFRHAEAPTDEIQPPHWNDVRFNFLPQNLDRRCYIHDNLAIFYDMQNDYHHGVGY
Ga0073978_157736513300031036MarineMGMSNKYAMDYACEDEFFEREMTMLDAKLTSLPLPTTWKHPDLPWNEIYPAHFNDVRFNFIPENLDRRAFIHDNLAIFYNMHADYYHGVGYQDEDMDYEMPDPYEGMH
Ga0307388_1035571513300031522MarineMVMKRTNGMVNPSLFNGCVAPKNAIFASRLGMSNKYAHDYACEDEYFEREMTLLDAKSAHLPIPETTRHKVLPMDEIMPPHWNDVRFNFIPQNLDRRMFLHDTLPIFYDMHMDYHHGVGY
Ga0307388_1079010633300031522MarineYANDYACEDEFFEREMTLLEAKETHLPLSDNFKHKSLPMDEYMPPHWNDVRFNFIPENIDRRCYIHDNLAIFYDMKNDYMHGVGF
Ga0307387_1043401733300031737MarineMKRTNGMVNPSLFNGCVAPKNAIFASRLGMSNKYAHDYACEDEYFEREMTLLDAKSAHLPIPETTRHKVLPMDEIMPPHWNDVRFNFIPQNLDRRMFLHDTLPIFYDMHMDYHHGVGY
Ga0307384_1054744513300031738MarineGNAFVTPNSRVFAARLGMTNKYAYDYACEDEYFEREMTLLDAKTMSLPLPVTFKHKEYPLHELYPPHWNDVRFNFKPENLDRRHFTHDNLPIFYNMQNDYHHGVGY
Ga0315907_1084509313300031758FreshwaterMTNKYAYDYACEDEFFEREMTLLDAKLLSLPLPENLRHKEAPTDELLPPHWNDVRFNYFPENIDRRCFIHDNLAIFYNMEHDYLHGVGF
Ga0314673_1030142813300032650SeawaterTRAKREGGVKMSHPSRIAMSMVLGRRATCIVPKSTMFSARLGMTNKYAFDYACEDEFFEREMTLLDARTTSLPLPDDFRHKEAPTDEIQPPHWNDVRFNFLPQNIDRRCYIHDNMAIFYDMQNDYHHGVGY
Ga0314687_1048665623300032707SeawaterVMGARSIRNSCITPRATIYAARIGMTNKYAFDYACEDEYHEREMTLADAKTMTLPLPDNFRHKSLPMDDYYPPHWNDVRFNHRQQNFDRRMFLHDNMAISYNM
Ga0314706_1054767713300032734SeawaterKMSHPSRIAMSMVLGRRATCIVPKSTMFSARLGMTNKYAFDYACEDEFFEREMTLLDARTTSLPLPDDFRHKEAPTDEIQPPHWNDVRFNFLPQNIDRRCYIHDNMAIFYDMQNDYHHGVGY
Ga0314704_1032025713300032745SeawaterMSHPSRIAMSMVLGRRATCIVPKSTMFSARLGMTNKYAFDYACEDEFFEREMTLLDARTTSLPLPDDFRHKEAPTDEIQPPHWNDVRFNFLPQNIDRRCYIHDNMAIFYDMQNDYHHGVG
Ga0314694_1025968523300032751SeawaterIAMSMVLGRRATCIVPKSTMFSARLGMTNKYAFDYACEDEFFEREMTLLDARTTSLPLPDDFRHKEAPTDEIQPPHWNDVRFNFLPQNIDRRCYIHDNMAIFYDMQNDYHHGVGY
Ga0314694_1028337333300032751SeawaterGARSIRNSCITPRATIYAARIGMTNKYAFDYACEDEYHEREMTLADAKTMTLPLPDNFRHKSLPMDDYYPPHWNDVRFNHRQQNFDRRMFLHDNMAISYNM
Ga0307390_1072289213300033572MarineMTNRWAYDYACEDEYHEKELTMLDARTIRLPLPVDFKKASPPWNEIYPVHAQNDVRFNFLPQNLDRRGFQHDNTVFFYNMHEEYHHGVGYEDEDMDFELPDPYADMH
Ga0334989_0282324_162_4313300033984FreshwaterMSNKYAYDYACEDEFFEREMTLLDAKLLSLPLPENFRHKEAPTDEIYPPHWNDVRFNYFPENIDRRCFIHDNLPIFYNMEHDYLHGIGF

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.