Metagenome / Metatranscriptome Family F081390

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences

Select file to download:
Download

Overview

Basic Information
Family ID	F081390
Family Type	Metagenome / Metatranscriptome
Number of Sequences	114
Average Sequence Length	41 residues
Representative Sequence	MRRDQRLMPPFRAQRCEMLRDALKRQTVKRVGRAVVDVPTQH
Number of Associated Samples	56
Number of Associated Scaffolds	114

Quality Assessment
Transcriptomic Evidence	Yes
Most common taxonomic group	Unclassified
% of genes with valid RBS motifs	0.00 %
% of genes near scaffold ends (potentially truncated)	14.91 %
% of genes from short scaffolds (< 2000 bps)	79.82 %
Associated GOLD sequencing projects	51
AlphaFold2 3D model prediction	Yes
3D model pTM-score	0.34

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.

Hidden Markov Model


Click on a Sequence Logo column to get its information.
Powered by Skylign

Most Common Taxonomy
Group	Unclassified (71.930 % of family members)
NCBI Taxonomy ID	N/A
Taxonomy	N/A

Most Common Ecosystem
GOLD Ecosystem	Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Unclassified → Hot Spring Phototrophic Mat (69.298 % of family members)
Environment Ontology (ENVO)	Unclassified (99.123 % of family members)
Earth Microbiome Project Ontology (EMPO)	Unclassified (69.298 % of family members)

Multiple Sequence Alignments

Full Alignment
Alignment of all the sequences in the family.

Powered by MSAViewer

Seed Alignment
Alignment of a non-redundant set of sequences, used to build the family's HMM profile.

Powered by MSAViewer

AlphaFold2 Input Alignment
Refined alignment used as input for AlphaFold2.

Powered by MSAViewer

Select alignment to view:

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification:	Globular	Signal Peptide:	No	Secondary Structure distribution:	α-helix: 30.00% β-sheet: 11.43% Coil/Unstructured: 58.57%
Feature Viewer

Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer


Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100	pTM-score: 0.34
Secondary Structure: α-helix β-sheet Coil Turn	pTM-score: 0.34
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

Gene Neighborhood

Neighboring Pfam domains

Pfam ID	Name	% Frequency in 114 Family Scaffolds
PF10145	PhageMin_Tail	38.60
PF02086	MethyltransfD12	1.75
PF05135	Phage_connect_1	1.75
PF04233	Phage_Mu_F	0.88
PF05065	Phage_capsid	0.88

COG ID	Name	Functional Category	% Frequency in 114 Family Scaffolds
COG0338	DNA-adenine methylase	Replication, recombination and repair [L]	1.75
COG3392	Adenine-specific DNA methylase	Replication, recombination and repair [L]	1.75
COG4653	Predicted phage phi-C31 gp36 major capsid-like protein	Mobilome: prophages, transposons [X]	0.88

NCBI Taxonomy

Select NCBI taxonomy Level:

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	71.93 %
All Organisms	root	All Organisms	28.07 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	71.93 %
cellular organisms	root	All Organisms → cellular organisms	27.19 %
Viruses	superkingdom	All Organisms → Viruses	0.88 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	71.93 %
Bacteria	superkingdom	All Organisms → cellular organisms → Bacteria	27.19 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	0.88 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	71.93 %
Terrabacteria group	clade	All Organisms → cellular organisms → Bacteria → Terrabacteria group	25.44 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	0.88 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	71.93 %
Chloroflexi	phylum	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi	25.44 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	0.88 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	71.93 %
Candidatus Thermofonsia	class	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Candidatus Thermofonsia	21.93 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	0.88 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	71.93 %
Candidatus Thermofonsia Clade 3	clade	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Candidatus Thermofonsia → Candidatus Thermofonsia Clade 3	21.93 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	0.88 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	71.93 %
Candidatus Thermofonsia Clade 3 bacterium	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Candidatus Thermofonsia → Candidatus Thermofonsia Clade 3 → Candidatus Thermofonsia Clade 3 bacterium	21.93 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	0.88 %

Visualization

Powered by ApexCharts

Associated Scaffolds

Scaffold	Taxonomy	Length	IMG/M Link
3300003688\|Ga0061020_1098361	Not Available	591	Open in IMG/M
3300005241\|Ga0068642_180668	Not Available	654	Open in IMG/M
3300005242\|Ga0068639_175219	Not Available	545	Open in IMG/M
3300005245\|Ga0068640_101168	Not Available	1238	Open in IMG/M
3300005247\|Ga0068637_1107916	Not Available	1429	Open in IMG/M
3300005249\|Ga0068645_1147388	Not Available	532	Open in IMG/M
3300005251\|Ga0068634_1195538	Not Available	525	Open in IMG/M
3300005452\|Ga0068706_1030614	Not Available	1096	Open in IMG/M
3300005452\|Ga0068706_1056508	Not Available	710	Open in IMG/M
3300005452\|Ga0068706_1082357	Not Available	563	Open in IMG/M
3300005453\|Ga0068705_10173160	Not Available	527	Open in IMG/M
3300005638\|Ga0068669_1257861	Not Available	603	Open in IMG/M
3300005638\|Ga0068669_1289661	Not Available	585	Open in IMG/M
3300006363\|Ga0068659_1055918	Not Available	2545	Open in IMG/M
3300006380\|Ga0068664_1002832	Not Available	684	Open in IMG/M
3300010179\|Ga0124936_1067625	Not Available	1330	Open in IMG/M
3300010183\|Ga0124919_1140195	Not Available	648	Open in IMG/M
3300010189\|Ga0124915_1008961	Not Available	573	Open in IMG/M
3300010189\|Ga0124915_1093900	Not Available	655	Open in IMG/M
3300010193\|Ga0124924_1044807	Not Available	582	Open in IMG/M
3300010194\|Ga0124921_1107540	Not Available	630	Open in IMG/M
3300010195\|Ga0124911_1228301	Not Available	515	Open in IMG/M
3300010196\|Ga0124923_1024205	Not Available	1085	Open in IMG/M
3300010197\|Ga0124922_1014884	Not Available	629	Open in IMG/M
3300010254\|Ga0124938_1168291	Not Available	1355	Open in IMG/M
3300010255\|Ga0124910_1062760	Not Available	1272	Open in IMG/M
3300010256\|Ga0124939_1126620	Not Available	629	Open in IMG/M
3300010272\|Ga0124912_1345649	Not Available	525	Open in IMG/M
3300026237\|Ga0209750_1047455	Not Available	798	Open in IMG/M
3300026509\|Ga0209809_1032218	Not Available	1841	Open in IMG/M
3300026509\|Ga0209809_1037649	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Candidatus Thermofonsia → Candidatus Thermofonsia Clade 3 → Candidatus Thermofonsia Clade 3 bacterium	1623	Open in IMG/M
3300026509\|Ga0209809_1058441	Not Available	1136	Open in IMG/M
3300026509\|Ga0209809_1073521	Not Available	947	Open in IMG/M
3300026509\|Ga0209809_1109020	Not Available	688	Open in IMG/M
3300027279\|Ga0209691_1020192	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Candidatus Thermofonsia → Candidatus Thermofonsia Clade 3 → Candidatus Thermofonsia Clade 3 bacterium	1655	Open in IMG/M
3300031245\|Ga0308395_1013821	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Candidatus Thermofonsia → Candidatus Thermofonsia Clade 3 → Candidatus Thermofonsia Clade 3 bacterium	2970	Open in IMG/M
3300031245\|Ga0308395_1024312	Not Available	1917	Open in IMG/M
3300031245\|Ga0308395_1026883	All Organisms → Viruses → Predicted Viral	1773	Open in IMG/M
3300031245\|Ga0308395_1034691	Not Available	1453	Open in IMG/M
3300031245\|Ga0308395_1036221	Not Available	1405	Open in IMG/M
3300031245\|Ga0308395_1054915	Not Available	1025	Open in IMG/M
3300031245\|Ga0308395_1112666	Not Available	612	Open in IMG/M
3300031508\|Ga0308394_1073830	Not Available	735	Open in IMG/M
3300031509\|Ga0308399_1033093	Not Available	1219	Open in IMG/M
3300031509\|Ga0308399_1038469	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Candidatus Thermofonsia → Candidatus Thermofonsia Clade 3 → Candidatus Thermofonsia Clade 3 bacterium	1102	Open in IMG/M
3300031509\|Ga0308399_1057320	Not Available	841	Open in IMG/M
3300031512\|Ga0308397_1001997	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi	10662	Open in IMG/M
3300031512\|Ga0308397_1007084	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Candidatus Thermofonsia → Candidatus Thermofonsia Clade 3 → Candidatus Thermofonsia Clade 3 bacterium	4150	Open in IMG/M
3300031512\|Ga0308397_1052693	Not Available	985	Open in IMG/M
3300031512\|Ga0308397_1081131	Not Available	722	Open in IMG/M
3300031513\|Ga0308412_1051524	Not Available	1417	Open in IMG/M
3300031513\|Ga0308412_1066971	Not Available	1168	Open in IMG/M
3300031513\|Ga0308412_1097463	Not Available	888	Open in IMG/M
3300031514\|Ga0308390_1004210	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi	7619	Open in IMG/M
3300031514\|Ga0308390_1083214	Not Available	717	Open in IMG/M
3300031515\|Ga0308396_1024269	Not Available	1581	Open in IMG/M
3300031515\|Ga0308396_1027716	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Candidatus Thermofonsia → Candidatus Thermofonsia Clade 3 → Candidatus Thermofonsia Clade 3 bacterium	1438	Open in IMG/M
3300031515\|Ga0308396_1075074	Not Available	708	Open in IMG/M
3300031515\|Ga0308396_1125007	Not Available	501	Open in IMG/M
3300031516\|Ga0308398_1008588	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Candidatus Thermofonsia → Candidatus Thermofonsia Clade 3 → Candidatus Thermofonsia Clade 3 bacterium	3696	Open in IMG/M
3300031516\|Ga0308398_1012812	Not Available	2767	Open in IMG/M
3300031516\|Ga0308398_1123664	Not Available	546	Open in IMG/M
3300031518\|Ga0308389_1124601	Not Available	554	Open in IMG/M
3300031568\|Ga0308393_1062435	Not Available	843	Open in IMG/M
3300031767\|Ga0308401_1031241	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Candidatus Thermofonsia → Candidatus Thermofonsia Clade 3 → Candidatus Thermofonsia Clade 3 bacterium	1138	Open in IMG/M
3300031767\|Ga0308401_1114134	Not Available	512	Open in IMG/M
3300031776\|Ga0308415_1001526	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Candidatus Thermofonsia → Candidatus Thermofonsia Clade 3 → Candidatus Thermofonsia Clade 3 bacterium	9856	Open in IMG/M
3300031776\|Ga0308415_1026729	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Candidatus Thermofonsia → Candidatus Thermofonsia Clade 3 → Candidatus Thermofonsia Clade 3 bacterium	1591	Open in IMG/M
3300031776\|Ga0308415_1089426	Not Available	638	Open in IMG/M
3300031783\|Ga0308418_1001624	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi	11647	Open in IMG/M
3300031783\|Ga0308418_1019585	Not Available	2067	Open in IMG/M
3300031783\|Ga0308418_1051974	Not Available	998	Open in IMG/M
3300031812\|Ga0308411_10003195	Not Available	10970	Open in IMG/M
3300031812\|Ga0308411_10006216	All Organisms → cellular organisms → Bacteria	7680	Open in IMG/M
3300031812\|Ga0308411_10013685	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Candidatus Thermofonsia → Candidatus Thermofonsia Clade 3 → Candidatus Thermofonsia Clade 3 bacterium	4805	Open in IMG/M
3300031812\|Ga0308411_10066855	Not Available	1519	Open in IMG/M
3300031812\|Ga0308411_10090517	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Candidatus Thermofonsia → Candidatus Thermofonsia Clade 3 → Candidatus Thermofonsia Clade 3 bacterium	1202	Open in IMG/M
3300031812\|Ga0308411_10133300	Not Available	901	Open in IMG/M
3300031812\|Ga0308411_10283077	Not Available	536	Open in IMG/M
3300031812\|Ga0308411_10308205	Not Available	507	Open in IMG/M
3300031830\|Ga0308409_1009532	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Candidatus Thermofonsia → Candidatus Thermofonsia Clade 3 → Candidatus Thermofonsia Clade 3 bacterium	3154	Open in IMG/M
3300031830\|Ga0308409_1024864	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Candidatus Thermofonsia → Candidatus Thermofonsia Clade 3 → Candidatus Thermofonsia Clade 3 bacterium	1674	Open in IMG/M
3300031830\|Ga0308409_1050031	Not Available	1039	Open in IMG/M
3300031830\|Ga0308409_1089000	Not Available	698	Open in IMG/M
3300031865\|Ga0308408_1010920	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Candidatus Thermofonsia → Candidatus Thermofonsia Clade 3 → Candidatus Thermofonsia Clade 3 bacterium	2816	Open in IMG/M
3300031865\|Ga0308408_1017933	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Candidatus Thermofonsia → Candidatus Thermofonsia Clade 3 → Candidatus Thermofonsia Clade 3 bacterium	2024	Open in IMG/M
3300031865\|Ga0308408_1066608	Not Available	845	Open in IMG/M
3300031875\|Ga0308405_1001221	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Candidatus Thermofonsia → Candidatus Thermofonsia Clade 3 → Candidatus Thermofonsia Clade 3 bacterium	13172	Open in IMG/M
3300031878\|Ga0308404_1006450	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Candidatus Thermofonsia → Candidatus Thermofonsia Clade 3 → Candidatus Thermofonsia Clade 3 bacterium	2967	Open in IMG/M
3300031948\|Ga0308406_1028159	Not Available	1388	Open in IMG/M
3300031948\|Ga0308406_1043875	Not Available	1033	Open in IMG/M
3300031948\|Ga0308406_1074160	Not Available	722	Open in IMG/M
3300031950\|Ga0308417_1008848	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Candidatus Thermofonsia → Candidatus Thermofonsia Clade 3 → Candidatus Thermofonsia Clade 3 bacterium	5746	Open in IMG/M
3300031950\|Ga0308417_1010856	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Candidatus Thermofonsia → Candidatus Thermofonsia Clade 3 → Candidatus Thermofonsia Clade 3 bacterium	5058	Open in IMG/M
3300031950\|Ga0308417_1083749	Not Available	1178	Open in IMG/M
3300031950\|Ga0308417_1199040	Not Available	627	Open in IMG/M
3300031950\|Ga0308417_1253769	Not Available	529	Open in IMG/M
3300031966\|Ga0308420_1077966	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Candidatus Thermofonsia → Candidatus Thermofonsia Clade 3 → Candidatus Thermofonsia Clade 3 bacterium	1115	Open in IMG/M
3300031966\|Ga0308420_1085973	Not Available	1040	Open in IMG/M
3300031966\|Ga0308420_1201546	Not Available	569	Open in IMG/M
3300031980\|Ga0308403_1019842	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Candidatus Thermofonsia → Candidatus Thermofonsia Clade 3 → Candidatus Thermofonsia Clade 3 bacterium	1567	Open in IMG/M
3300031980\|Ga0308403_1057331	Not Available	797	Open in IMG/M
3300031980\|Ga0308403_1059027	Not Available	782	Open in IMG/M
3300032033\|Ga0308402_1013321	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Candidatus Thermofonsia → Candidatus Thermofonsia Clade 3 → Candidatus Thermofonsia Clade 3 bacterium	1892	Open in IMG/M
3300032034\|Ga0308407_1068087	Not Available	769	Open in IMG/M
3300032034\|Ga0308407_1103322	Not Available	579	Open in IMG/M
3300032045\|Ga0308400_1000772	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Candidatus Thermofonsia → Candidatus Thermofonsia Clade 3 → Candidatus Thermofonsia Clade 3 bacterium	11269	Open in IMG/M
3300032058\|Ga0308419_1065228	Not Available	1179	Open in IMG/M
3300032058\|Ga0308419_1082995	Not Available	968	Open in IMG/M
3300032356\|Ga0308414_1001122	All Organisms → cellular organisms → Bacteria	17438	Open in IMG/M
3300032356\|Ga0308414_1047725	Not Available	1824	Open in IMG/M
3300033886\|Ga0308413_002489	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi	9372	Open in IMG/M
3300033886\|Ga0308413_088258	Not Available	793	Open in IMG/M
3300034649\|Ga0372972_008304	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Candidatus Thermofonsia → Candidatus Thermofonsia Clade 3 → Candidatus Thermofonsia Clade 3 bacterium	1962	Open in IMG/M

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:

Habitat	Taxonomy	Distribution
Environmental	Environmental	100.00%

Habitat	Taxonomy	Distribution
Aquatic	Environmental → Aquatic	100.00%

Habitat	Taxonomy	Distribution
Thermal Springs	Environmental → Aquatic → Thermal Springs	100.00%

Habitat	Taxonomy	Distribution
Hot (42-90C)	Environmental → Aquatic → Thermal Springs → Hot (42-90C)	100.00%

Habitat	Taxonomy	Distribution
Unclassified	Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Unclassified	100.00%

Habitat	Taxonomy	Distribution
Hot Spring Phototrophic Mat	Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Unclassified → Hot Spring Phototrophic Mat	69.30%
Anoxygenic And Chlorotrophic Microbial Mat	Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Unclassified → Anoxygenic And Chlorotrophic Microbial Mat	21.93%
Anoxygenic And Chlorotrophic	Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Unclassified → Anoxygenic And Chlorotrophic	8.77%

Visualization

Powered by ApexCharts

Associated Samples

Taxon OID	Sample Name	Habitat Type	IMG/M Link
3300003688	Coassembly of YNP Bryant MS undermat 2012 and YNP Bryant MS upper layer 2012	Environmental	Open in IMG/M
3300005241	Anoxygenic and chlorotrophic microbial mat microbial communities from Yellowstone National Park, USA - YNP MS_0800_T MetaT (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300005242	Anoxygenic and chlorotrophic microbial mat microbial communities from Yellowstone National Park, USA - YNP MS_0300_T MetaT (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300005245	Anoxygenic and chlorotrophic microbial mat microbial communities from Yellowstone National Park, USA - YNP MS_0600_T MetaT (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300005247	Anoxygenic and chlorotrophic microbial mat microbial communities from Yellowstone National Park, USA - YNP MS_2000_T MetaT (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300005249	Anoxygenic and chlorotrophic microbial mat microbial communities from Yellowstone National Park, USA - YNP MS_1200_T MetaT (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300005251	Anoxygenic and chlorotrophic microbial mat microbial communities from Yellowstone National Park, USA - YNP MS_1700_T MetaT (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300005452	Anoxygenic and chlorotrophic microbial mat microbial communities from Yellowstone National Park, USA - YNP MS-B MetaG	Environmental	Open in IMG/M
3300005453	Anoxygenic and chlorotrophic microbial mat microbial communities from Yellowstone National Park, USA - YNP MS-T MetaG	Environmental	Open in IMG/M
3300005638	Anoxygenic and chlorotrophic microbial mat microbial communities from Yellowstone National Park, USA - YNP MS_1700(2)_B MetaT (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300006363	Anoxygenic and chlorotrophic microbial mat microbial communities from Yellowstone National Park, USA - YNP MS_0600_B MetaT (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300006380	Anoxygenic and chlorotrophic microbial mat microbial communities from Yellowstone National Park, USA - YNP MS_1200_B MetaT (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300010179	Anoxygenic and chlorotrophic microbial mat microbial communities from Yellowstone National Park, USA - YNP MS_0900_B MetaT (Metagenome Metatranscriptome) (version 2)	Environmental	Open in IMG/M
3300010183	Anoxygenic and chlorotrophic microbial mat microbial communities from Yellowstone National Park, USA - YNP MS_0700_T MetaT (Metagenome Metatranscriptome) (version 2)	Environmental	Open in IMG/M
3300010189	Anoxygenic and chlorotrophic microbial mat microbial communities from Yellowstone National Park, USA - YNP MS_2000_T MetaT (Metagenome Metatranscriptome) (version 2)	Environmental	Open in IMG/M
3300010193	Anoxygenic and chlorotrophic microbial mat microbial communities from Yellowstone National Park, USA - YNP MS_1300(2)_T MetaT (Metagenome Metatranscriptome) (version 2)	Environmental	Open in IMG/M
3300010194	Anoxygenic and chlorotrophic microbial mat microbial communities from Yellowstone National Park, USA - YNP MS_0900_T MetaT (Metagenome Metatranscriptome) (version 2)	Environmental	Open in IMG/M
3300010195	Anoxygenic and chlorotrophic microbial mat microbial communities from Yellowstone National Park, USA - YNP MS_1500_T MetaT (Metagenome Metatranscriptome) (version 2)	Environmental	Open in IMG/M
3300010196	Anoxygenic and chlorotrophic microbial mat microbial communities from Yellowstone National Park, USA - YNP MS_1200_T MetaT (Metagenome Metatranscriptome) (version 2)	Environmental	Open in IMG/M
3300010197	Anoxygenic and chlorotrophic microbial mat microbial communities from Yellowstone National Park, USA - YNP MS_1000_T MetaT (Metagenome Metatranscriptome) (version 2)	Environmental	Open in IMG/M
3300010254	Anoxygenic and chlorotrophic microbial mat microbial communities from Yellowstone National Park, USA - YNP MS_1400(2)_B MetaT (Metagenome Metatranscriptome) (version 2)	Environmental	Open in IMG/M
3300010255	Anoxygenic and chlorotrophic microbial mat microbial communities from Yellowstone National Park, USA - YNP MS_1300_T MetaT (Metagenome Metatranscriptome) (version 2)	Environmental	Open in IMG/M
3300010256	Anoxygenic and chlorotrophic microbial mat microbial communities from Yellowstone National Park, USA - YNP MS_1500(2)_B MetaT (Metagenome Metatranscriptome) (version 2)	Environmental	Open in IMG/M
3300010272	Anoxygenic and chlorotrophic microbial mat microbial communities from Yellowstone National Park, USA - YNP MS_1700_T MetaT (Metagenome Metatranscriptome) (version 2)	Environmental	Open in IMG/M
3300026237	Anoxygenic and chlorotrophic microbial mat microbial communities from Yellowstone National Park, USA - YNP Bryant MS upper layer 2012 (SPAdes)	Environmental	Open in IMG/M
3300026509	Anoxygenic and chlorotrophic microbial mat microbial communities from Yellowstone National Park, USA - YNP MS-T MetaG (SPAdes)	Environmental	Open in IMG/M
3300027279	Anoxygenic and chlorotrophic microbial mat microbial communities from Yellowstone National Park, USA - YNP MS-B MetaG (SPAdes)	Environmental	Open in IMG/M
3300031245	Hot spring phototrophic mat microbial communities from Mushroom Spring, Yellowstone National Park, Wyoming, United States - 20050930_P4	Environmental	Open in IMG/M
3300031508	Hot spring phototrophic mat microbial communities from Mushroom Spring, Yellowstone National Park, Wyoming, United States - 20050701_me2	Environmental	Open in IMG/M
3300031509	Hot spring phototrophic mat microbial communities from Octopus Spring, Yellowstone National Park, Wyoming, United States - 20060914_OS12-60	Environmental	Open in IMG/M
3300031512	Hot spring phototrophic mat microbial communities from Mushroom Spring, Yellowstone National Park, Wyoming, United States - 20051001_T8	Environmental	Open in IMG/M
3300031513	Hot spring phototrophic mat microbial communities from Octopus Spring, Yellowstone National Park, Wyoming, United States - 20070728_OST1-BottomLayer	Environmental	Open in IMG/M
3300031514	Hot spring phototrophic mat microbial communities from Mushroom Spring, Yellowstone National Park, Wyoming, United States - 20040719_149	Environmental	Open in IMG/M
3300031515	Hot spring phototrophic mat microbial communities from Mushroom Spring, Yellowstone National Park, Wyoming, United States - 20050930_Pe2	Environmental	Open in IMG/M
3300031516	Hot spring phototrophic mat microbial communities from Mushroom Spring, Yellowstone National Park, Wyoming, United States - 20051001_T9	Environmental	Open in IMG/M
3300031518	Hot spring phototrophic mat microbial communities from Mushroom Spring, Yellowstone National Park, Wyoming, United States - 20040719_148	Environmental	Open in IMG/M
3300031568	Hot spring phototrophic mat microbial communities from Mushroom Spring, Yellowstone National Park, Wyoming, United States - 20050630_ee2	Environmental	Open in IMG/M
3300031767	Hot spring phototrophic mat microbial communities from Octopus Spring, Yellowstone National Park, Wyoming, United States - 20060913_OS-M1	Environmental	Open in IMG/M
3300031776	Hot spring phototrophic mat microbial communities from Octopus Spring, Yellowstone National Park, Wyoming, United States - 20090730_OS55	Environmental	Open in IMG/M
3300031783	Hot spring phototrophic mat microbial communities from Mushroom Spring, Yellowstone National Park, Wyoming, United States - 20090729_R4cd	Environmental	Open in IMG/M
3300031812	Hot spring phototrophic mat microbial communities from Octopus Spring, Yellowstone National Park, Wyoming, United States - 20070728_OST2-BottomLayer	Environmental	Open in IMG/M
3300031830	Hot spring phototrophic mat microbial communities from Mushroom Spring, Yellowstone National Park, Wyoming, United States - 20060912_MSe4	Environmental	Open in IMG/M
3300031865	Hot spring phototrophic mat microbial communities from Mushroom Spring, Yellowstone National Park, Wyoming, United States - 20060912_MSe3	Environmental	Open in IMG/M
3300031875	Hot spring phototrophic mat microbial communities from Mushroom Spring, Yellowstone National Park, Wyoming, United States - 20060912_MS13	Environmental	Open in IMG/M
3300031878	Hot spring phototrophic mat microbial communities from Octopus Spring, Yellowstone National Park, Wyoming, United States - 20060914_OS-M4	Environmental	Open in IMG/M
3300031948	Hot spring phototrophic mat microbial communities from Mushroom Spring, Yellowstone National Park, Wyoming, United States - 20060911_MSe1	Environmental	Open in IMG/M
3300031950	Hot spring phototrophic mat microbial communities from Octopus Spring, Yellowstone National Park, Wyoming, United States - 20090730_OS65	Environmental	Open in IMG/M
3300031966	Hot spring phototrophic mat microbial communities from Mushroom Spring, Yellowstone National Park, Wyoming, United States - 20090730_MS55	Environmental	Open in IMG/M
3300031980	Hot spring phototrophic mat microbial communities from Octopus Spring, Yellowstone National Park, Wyoming, United States - 20060914_OS-M3	Environmental	Open in IMG/M
3300032033	Hot spring phototrophic mat microbial communities from Octopus Spring, Yellowstone National Park, Wyoming, United States - 20060913_OS-M2	Environmental	Open in IMG/M
3300032034	Hot spring phototrophic mat microbial communities from Mushroom Spring, Yellowstone National Park, Wyoming, United States - 20060911_MSe2	Environmental	Open in IMG/M
3300032045	Hot spring phototrophic mat microbial communities from Octopus Spring, Yellowstone National Park, Wyoming, United States - 20060914_OS12-65	Environmental	Open in IMG/M
3300032058	Hot spring phototrophic mat microbial communities from Mushroom Spring, Yellowstone National Park, Wyoming, United States - 20090730_MS50	Environmental	Open in IMG/M
3300032356	Hot spring phototrophic mat microbial communities from Octopus Spring, Yellowstone National Park, Wyoming, United States - 20090730_OS50	Environmental	Open in IMG/M
3300033886	Hot spring phototrophic mat microbial communities from Octopus Spring, Yellowstone National Park, Wyoming, United States - 20090729_t10cd	Environmental	Open in IMG/M
3300034649	Metatranscriptome of hot spring phototrophic mat microbial communities from Mushroom Spring, Yellowstone National Park, Wyoming, United States - 20050701_1400_MSt11 (Metagenome Metatranscriptome)	Environmental	Open in IMG/M

Geographical Distribution

Zoom:	Powered by OpenStreetMap

Family Sequences

Protein ID	Sample Taxon ID	Habitat	Sequence
Ga0061020_10983611	3300003688	Anoxygenic And Chlorotrophic Microbial Mat	MRRDQRLMSPFRAQRREVLRHALKRQTVKRVGRAVVNVPAQH*
Ga0068642_1806682	3300005241	Anoxygenic And Chlorotrophic Microbial Mat	MRRDQRLMPPLRAQRREVLRHALKRQSVKRVGRAVVNVPTQH*
Ga0068639_1752191	3300005242	Anoxygenic And Chlorotrophic Microbial Mat	SLMRRDQRLMPPFRAQRCEMLRDALKRQTVKRVGRAVVNVPTQH*
Ga0068640_1011683	3300005245	Anoxygenic And Chlorotrophic Microbial Mat	LMLRRNRLIPPFRAQRRKMLRDAPERLTVKRVRRAVVDVPT*
Ga0068637_11079161	3300005247	Anoxygenic And Chlorotrophic Microbial Mat	MRRDQRLMPPFRAQRCEMLRDALKRQTVKRVGRAVVDVPAQH*
Ga0068645_11473882	3300005249	Anoxygenic And Chlorotrophic Microbial Mat	MCSDQLLMPPLRAQRREMLRHALKRQSVKRVRRAVVDVPT*
Ga0068634_11955381	3300005251	Anoxygenic And Chlorotrophic Microbial Mat	MRRDQRLMPPFRAQRREVLRHALKRQTVKRVGRAVVNVPAQH*
Ga0068706_10306142	3300005452	Anoxygenic And Chlorotrophic	MRRDQRLVPPLRAQRRKMLRDAPERLTIKRVGRAVVNVPTQH*
Ga0068706_10565082	3300005452	Anoxygenic And Chlorotrophic	MRCDQRLMPPLCAQRCEMLRDALKRQTVKRVGRAVVNVPAQH*
Ga0068706_10823572	3300005452	Anoxygenic And Chlorotrophic	MGSDQLLMPPLCAQRREMLRHALKRQSVKRVGRAVVDVPT*
Ga0068705_101731602	3300005453	Anoxygenic And Chlorotrophic	MGSDQLLMPPLCAQRREMLRHALKRQSVKRVGRAVVDVPA*
Ga0068669_12578611	3300005638	Anoxygenic And Chlorotrophic Microbial Mat	MRRDQRLMPPFRAQRREMLRNAPERLTVKRVGRAVVN
Ga0068669_12896612	3300005638	Anoxygenic And Chlorotrophic Microbial Mat	LMCSDQLLMPPLRAQRCKVLRHAPERLPVKRVGRAVVNVPTQH*
Ga0068659_10559186	3300006363	Anoxygenic And Chlorotrophic Microbial Mat	MRCNQRLMPPFRAQRCEMLRDALKRQTVKRVGRAVVNVPTQH*
Ga0068664_10028322	3300006380	Anoxygenic And Chlorotrophic Microbial Mat	MLRRNRLIPPFRAQRRKMLRDAPERLTVKRVRRAVVDVPT*
Ga0124936_10676254	3300010179	Anoxygenic And Chlorotrophic Microbial Mat	MRRDQRLMPPFRAQRREMLRNAPERLTVKRVGRAVVNVPTQH*
Ga0124919_11401952	3300010183	Anoxygenic And Chlorotrophic Microbial Mat	MLRRNRLIPPFRAQRRKMLRHALKRQSVKRVRRAVVDVPT*
Ga0124915_10089611	3300010189	Anoxygenic And Chlorotrophic Microbial Mat	MRRDQRLMPPFRAQRREVLRHALKRQTVKRVGRAVVDVPAQH*
Ga0124915_10939002	3300010189	Anoxygenic And Chlorotrophic Microbial Mat	MRRDQRLMPPFRAQRCEMLRDALKRQTVKRVGRAVVNVPTQH*
Ga0124924_10448071	3300010193	Anoxygenic And Chlorotrophic Microbial Mat	MRCNQRLMPPLCAQRREVLRDALQRQTVKRVGRAVVNVPTQH*
Ga0124921_11075402	3300010194	Anoxygenic And Chlorotrophic Microbial Mat	MRRDQRLMPPFRAQRCEMLRDALKRQTVKRVGRAMVDVPTQH*
Ga0124911_12283012	3300010195	Anoxygenic And Chlorotrophic Microbial Mat	MRCNQRLMPPFRAQRCEMLRDALKRQTVKRVGRAVVDVPTQH*
Ga0124923_10242053	3300010196	Anoxygenic And Chlorotrophic Microbial Mat	MCSDQLLMPPLRAQRCKVLRDALQRQTVKRVGRAVVNVPTQH*
Ga0124922_10148841	3300010197	Anoxygenic And Chlorotrophic Microbial Mat	MRCDQRLMPPLCAQRCEMLRDALKRQTVKRVGRAV
Ga0124938_11682914	3300010254	Anoxygenic And Chlorotrophic Microbial Mat	MLRRNRLIPPFRAQRCKVLRDALQRQTVKRVGRAVVNVPTQH*
Ga0124910_10627603	3300010255	Anoxygenic And Chlorotrophic Microbial Mat	MRCDQRLMPPFRAQRREMLRHAPERLTVKRVGRAVVNVPTQH*
Ga0124939_11266201	3300010256	Anoxygenic And Chlorotrophic Microbial Mat	SLLSLMLRRNRLIPPFRAQRCKVLRDALQRQTVKRVGRAVVNVPTQH*
Ga0124912_13456491	3300010272	Anoxygenic And Chlorotrophic Microbial Mat	MRRDQRLMPPFRAQRREVLRHALKRQTVKRVGRAVVNVPTQH*
Ga0209750_10474552	3300026237	Anoxygenic And Chlorotrophic Microbial Mat	MLRRNRLIPPFRAQRREMLRHAPERLPVKRVGRAVVDVPT
Ga0209809_10322182	3300026509	Anoxygenic And Chlorotrophic	MLRRNRLIPPFRAQRRKMLRDAPERLTVKRVRRAVVDVPT
Ga0209809_10376492	3300026509	Anoxygenic And Chlorotrophic	MRCDQRLVPPLRAQRRKMLRDAPERLTIKRVGRAVVNVPTQH
Ga0209809_10584412	3300026509	Anoxygenic And Chlorotrophic	MCSDQLLMPPLRAQRCKVLRDALQRQTVKRVGRAVVNVPTQH
Ga0209809_10735212	3300026509	Anoxygenic And Chlorotrophic	MLRRNRLIPPFRAQRRKMLRHALKRQSVKRVRRAVVDVPT
Ga0209809_11090202	3300026509	Anoxygenic And Chlorotrophic	MRCDQRLMPPLCAQRCEMLRDALKRQTVKRVGRAVVNVPAQH
Ga0209691_10201923	3300027279	Anoxygenic And Chlorotrophic	MRRDQRLVPPLRAQRRKMLRDAPERLTIKRVGRAVVNVPTQH
Ga0308395_10138213	3300031245	Hot Spring Phototrophic Mat	MRRDQRLMPPFRAQRCEMLRDALKRQTVKRVGRAVVDVPTQH
Ga0308395_10243122	3300031245	Hot Spring Phototrophic Mat	MLRRNRLIPPFRAQRREMLRHALKRQSVKRVGRAVVNVPTQH
Ga0308395_10268834	3300031245	Hot Spring Phototrophic Mat	MRRDQRLMPPFRAQRREMLRDALKRQTVKRVGRAVVNVPAQH
Ga0308395_10346913	3300031245	Hot Spring Phototrophic Mat	MRRDQRLMPPFRAQRREVLRHALKRQTVKRVGRAVVNVPAQH
Ga0308395_10362212	3300031245	Hot Spring Phototrophic Mat	MCSDYLLMPPLSAQRREVLRHAPERLSVKRVGRAVVDVPT
Ga0308395_10549152	3300031245	Hot Spring Phototrophic Mat	MRRDQRLMPPFRAQRREVLRHALKRQTVKRVGRAVVNVPTQH
Ga0308395_11126662	3300031245	Hot Spring Phototrophic Mat	MRCDQRLMPPLCAQRCEMLRDALKRQTVKRVGRAMVDVPTQH
Ga0308394_10738302	3300031508	Hot Spring Phototrophic Mat	MRRDQRLMPPFRAQRCEMLRDALKRQTVKRVGRAVVNVPTQH
Ga0308399_10330932	3300031509	Hot Spring Phototrophic Mat	MRCDQRLMPPFRTQRREVLRDALKRQTVKRVRRAVIDVPT
Ga0308399_10384692	3300031509	Hot Spring Phototrophic Mat	MRRDQRLVPPLRAQRRKMLRYALKRQTVKRVRRAVVDVPTQHQF
Ga0308399_10573201	3300031509	Hot Spring Phototrophic Mat	MRCDQRLMPPLCAQRRKVLRDALQRQTVKRVGRAVVDVPT
Ga0308397_10019974	3300031512	Hot Spring Phototrophic Mat	MRRDQRLMPPFRAQRCEMLRDALKRQTVKRVGRAMVDVPTQH
Ga0308397_10070842	3300031512	Hot Spring Phototrophic Mat	MRCDQRLMPPFRAQRCEMLRDALKRQTVKRVGRAVVNVPAQH
Ga0308397_10526932	3300031512	Hot Spring Phototrophic Mat	MCCNQRLMPPFRAQRCEMLRDALKRQTVKRVGRAVVNVPTQH
Ga0308397_10811311	3300031512	Hot Spring Phototrophic Mat	HHSSTFSLMRRDQRLMPPFRAQRCEMLRDALKRQTVKRVGRAVVDVPTQH
Ga0308412_10515242	3300031513	Hot Spring Phototrophic Mat	MRRDQRLMPPFRAQRREVLRHALKRQTVKRVGRAVVDVPTQH
Ga0308412_10669711	3300031513	Hot Spring Phototrophic Mat	SDYLLMPPLCAQRRKVLRYALKRLPVKRVGRAVIDIST
Ga0308412_10974632	3300031513	Hot Spring Phototrophic Mat	MRRDQRLMPPLCAQRCEMLRDALKRQTVKRVGRAVVNVPTQH
Ga0308390_10042102	3300031514	Hot Spring Phototrophic Mat	MRRDQRLVPPLRAQRRKMLRDAPERLTVKRVRRAVVDVPT
Ga0308390_10832142	3300031514	Hot Spring Phototrophic Mat	MRCDQRLMPPFRAQRREVLRDALKRQTVKRVGRAVVDVPTQH
Ga0308396_10242693	3300031515	Hot Spring Phototrophic Mat	MGSDQLLMPPLCAQRREMLRHALKRQSVKRVGRAVVDVPA
Ga0308396_10277162	3300031515	Hot Spring Phototrophic Mat	MPPLCAQRREVLRHALKRQSVKRVGRAVVDVPTQH
Ga0308396_10750742	3300031515	Hot Spring Phototrophic Mat	MRRDQRLMPPFRAQRRKMLRDALKRQTVKRVGRAVVDVPTQH
Ga0308396_11250071	3300031515	Hot Spring Phototrophic Mat	MRCNQRLMPPFRAQRREMLRDALKRQTVKRVGRAVVNVPTQH
Ga0308398_10085885	3300031516	Hot Spring Phototrophic Mat	MRCNQRLMPPFRAQRCEMLSDALKRQTVKRVGRAMVDVPTQH
Ga0308398_10128125	3300031516	Hot Spring Phototrophic Mat	MRCNQRLMPPFRAQRREMLRNALKRQTVKRVGRAVVNVPTQH
Ga0308398_11236642	3300031516	Hot Spring Phototrophic Mat	MRCDQRLMPPLCAQRREMLRNALKRQTVKRVGRAMVDVPTQH
Ga0308389_11246012	3300031518	Hot Spring Phototrophic Mat	MRCDQRLMPPLCAQRCEMLRDALKRQTVKRVGRAVVNVPTQH
Ga0308393_10624352	3300031568	Hot Spring Phototrophic Mat	MRCDQRLMPPFRAQRREMLRNAPERLTVKRVGRAVVNVPTQH
Ga0308401_10312412	3300031767	Hot Spring Phototrophic Mat	MPPLRAQRRKMLRDAPERLTIKRVGRAVVDVPTQHQFG
Ga0308401_11141342	3300031767	Hot Spring Phototrophic Mat	MRCDQRLVPPLRAQRRKMLRYAPERLTIKRVGRAVVDVPT
Ga0308415_10015265	3300031776	Hot Spring Phototrophic Mat	MRCDQRLMPPLCAQRREMPRNALERLTIKRVGRAVVDVPT
Ga0308415_10267292	3300031776	Hot Spring Phototrophic Mat	MRCDQRLMPPFRAQRRKVPRNALERLSVKRVRRAAVDVPTQH
Ga0308415_10894262	3300031776	Hot Spring Phototrophic Mat	MRCDQRLMPPLCAQRRKMPRHALERLSVKRVRRAAVDVPTQH
Ga0308418_10016245	3300031783	Hot Spring Phototrophic Mat	MRRNQRLMPPFRAQRCEMLRDALKRQTVKRVGRAMVDVPTQH
Ga0308418_10195854	3300031783	Hot Spring Phototrophic Mat	MPPLCAQRREVLRDALQRQTVKRVGRAVVNVPTQH
Ga0308418_10519742	3300031783	Hot Spring Phototrophic Mat	MRCNQRLMPPFRAQRREMLRNAPERLTVKRVGRAVVNVPAQH
Ga0308411_1000319511	3300031812	Hot Spring Phototrophic Mat	MCSDYLLMPPFRAQRRKVLRDALQRQTVKRVGRAVVDVSAQH
Ga0308411_100062164	3300031812	Hot Spring Phototrophic Mat	MRCDQRLVPPLRAQRREVLRHALERQTVKRVGRAVIDVSAQH
Ga0308411_100136853	3300031812	Hot Spring Phototrophic Mat	MRRDQRLMPPFRAQRCEMLRDALKRQTIKRVGRAMVDVPTQH
Ga0308411_100668552	3300031812	Hot Spring Phototrophic Mat	MRCDQRLMPPLCAQRCEMLRDAPERLTVKRVGRAVVDVPT
Ga0308411_100905172	3300031812	Hot Spring Phototrophic Mat	MRCDQRLMPPLCAQRCEMLRDALKRQTVKRVGRAVVNIPAQH
Ga0308411_101333003	3300031812	Hot Spring Phototrophic Mat	MRRDQRLMPPLCAQRCEMLRDALKRQTVKRVGRAMVDVPTQH
Ga0308411_102830772	3300031812	Hot Spring Phototrophic Mat	MRCDQRLMPPFRAQRCEMLRDAMKRQTVKRVGRAVVNVPAQH
Ga0308411_103082052	3300031812	Hot Spring Phototrophic Mat	MRCDQRLMPPLCAQRREVLRHAPERLTIKRVGRAVVNVPTQH
Ga0308409_10095322	3300031830	Hot Spring Phototrophic Mat	MCSDYLLVPPLRAQRREVLRDALERQTVKRVGRAVIDVPAQH
Ga0308409_10248642	3300031830	Hot Spring Phototrophic Mat	MRCDQRLMPPLCAQRREMLRHAPERLPVKRVGRAVVNVPTQH
Ga0308409_10500312	3300031830	Hot Spring Phototrophic Mat	MRCDQRLMPPLCAQRCEMLRDALKRQSVKRVGRAVVDVPT
Ga0308409_10890002	3300031830	Hot Spring Phototrophic Mat	MRRDQRLMPPFRAQRCEMLRDALKRQTVKRVGRAVVDVPAQH
Ga0308408_10109202	3300031865	Hot Spring Phototrophic Mat	MRRDQRLVPPLRAQRCEVLRHAPERLTVKRVRRAVVDVPT
Ga0308408_10179332	3300031865	Hot Spring Phototrophic Mat	MRCNQRLMPPFRAQRREMLRNAPERLTVKRVGRAVVNVPTQH
Ga0308408_10666082	3300031865	Hot Spring Phototrophic Mat	MRCNQRLMPPFRAQRCEMLRDALKRQTVKSVGRAVVDVPTQH
Ga0308405_10012213	3300031875	Hot Spring Phototrophic Mat	MRCDQRLMPPFRAQRREMLRNAPERLTVKRVGRAVVNVPAQH
Ga0308404_10064503	3300031878	Hot Spring Phototrophic Mat	MRCDQRLMPPLCAQRCEMLHDALKRQTVKRVGRAVVDVPAQH
Ga0308406_10281592	3300031948	Hot Spring Phototrophic Mat	MLRRNRLIPPFRAQRGEMLRHALKRQSVKRVGRAVVDVPTQH
Ga0308406_10438752	3300031948	Hot Spring Phototrophic Mat	MRCDQRLVPPLRAQRRKMLRDAPERLTIKRVGRAVVDVPA
Ga0308406_10741601	3300031948	Hot Spring Phototrophic Mat	MRRDQRLMPPFRAQRREVLRHSLKRQTVKRVGRAVVNVPAQH
Ga0308417_10088481	3300031950	Hot Spring Phototrophic Mat	MLRYNRLMPPLRAQRREVLCDALKRQSVKRVGWAVVDV
Ga0308417_10108566	3300031950	Hot Spring Phototrophic Mat	MRRDQRLMPPFRAQRREMLRHALQRQTIKRVGRAVIDIST
Ga0308417_10837492	3300031950	Hot Spring Phototrophic Mat	MRRDQRLMPPLRAQRCKVLRDALQRQTVKRVGRTVVNVPT
Ga0308417_11990401	3300031950	Hot Spring Phototrophic Mat	LLMPPLCAQRRKVLRDALQRQTVKRVRRAVVDVPT
Ga0308417_12537692	3300031950	Hot Spring Phototrophic Mat	MRCNNRLMPPFRAQRCEMLRYALERLPVKRVRRTVVDVPAQH
Ga0308420_10779662	3300031966	Hot Spring Phototrophic Mat	MRRDQRLVPPFRAQRCEMLRDALKRQTVKRVGRAVVDVPTQH
Ga0308420_10859732	3300031966	Hot Spring Phototrophic Mat	MRRDQRLMPPFRAQRREMLRNAPERLTVKRVGRAVVNVPTQH
Ga0308420_12015461	3300031966	Hot Spring Phototrophic Mat	MCSDYLLMPPLSAQRREVLRHALKRQSVKRVGRAVVDVSAQ
Ga0308403_10198422	3300031980	Hot Spring Phototrophic Mat	MRRDQRLMPPLRAQRRKMLRDAPERLTIKRVGRAVVDVPT
Ga0308403_10573312	3300031980	Hot Spring Phototrophic Mat	MRCDQRLMPPLCAQRCEVLRDAPERLTIKRIGRAVVDV
Ga0308403_10590273	3300031980	Hot Spring Phototrophic Mat	MRRDQRLVPPLRAQRRKMLRDALQRQTVKRVRRAVVNVPTQH
Ga0308402_10133212	3300032033	Hot Spring Phototrophic Mat	LTFPLMRCDQRLMPPFRAQRREVLRYALKRQTVKRVRRAVVDVPT
Ga0308407_10680872	3300032034	Hot Spring Phototrophic Mat	MRCDQRLIPPLCAQRCEMLRDALKRQTVKRVGRAVVNVPAQH
Ga0308407_11033221	3300032034	Hot Spring Phototrophic Mat	MLRRNRLIPPFRAQRCEMLRHAPERLPVKRVRRAVV
Ga0308400_100077212	3300032045	Hot Spring Phototrophic Mat	MRCDQRLMPPLCAQRCEVLRHALKRQTVKRVGRAVINVPTQH
Ga0308419_10652282	3300032058	Hot Spring Phototrophic Mat	MCSDYLLMPPLSAQRREVLRHALQRQTVKRVRRAVVDVPA
Ga0308419_10829951	3300032058	Hot Spring Phototrophic Mat	MPPLCAQRREVLRDALQRQTVKRVGRAVVDVPTQH
Ga0308414_100112213	3300032356	Hot Spring Phototrophic Mat	MRCDQRLMPPLCAQRCEMLRDALKRQTVKRVGRAVVDIPAQH
Ga0308414_10477252	3300032356	Hot Spring Phototrophic Mat	MGSDQLLMPPLCAQRRKVLRDALQRQTVKRVRRAVVDVPT
Ga0308413_002489_9256_9372	3300033886	Hot Spring Phototrophic Mat	MRRDQRLIPPLCAQRSKVLRHAPKRLTVKYVGRAVVDVS
Ga0308413_088258_688_792	3300033886	Hot Spring Phototrophic Mat	MRRDQRLMPPLRAQRRKMLRDAPERLTIKRVGRAV
Ga0372972_008304_1324_1452	3300034649	Hot Spring Phototrophic Mat	MRRDQRLMPPFRAQRCEMLRHALKRQTVKRVGRAVVDVPTQH

Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

Metagenome / Metatranscriptome Family F081390

Overview

Multiple Sequence Alignments

Structure & Topology

Predicted Secondary Structure and Topology

Predicted 3D Structure

Low Quality Model:

Gene Neighborhood

Neighboring Pfam domains

Neighboring Clusters of Orthologous Genes (COGs)

Phylogeny

NCBI Taxonomy

Associated Scaffolds

Environmental Properties

Associated Habitat Types

Associated Samples

Family Sequences