Basic Information | |
---|---|
Family ID | F081468 |
Family Type | Metagenome |
Number of Sequences | 114 |
Average Sequence Length | 49 residues |
Representative Sequence | MDRLDDEDIGIIWARHYPKRAERASSMSLCVTLTMIIKQRAKS |
Number of Associated Samples | 96 |
Number of Associated Scaffolds | 114 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | No |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 78.07 % |
% of genes near scaffold ends (potentially truncated) | 90.35 % |
% of genes from short scaffolds (< 2000 bps) | 92.11 % |
Associated GOLD sequencing projects | 86 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.41 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (57.018 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere (14.035 % of family members) |
Environment Ontology (ENVO) | Unclassified (47.368 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (71.053 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 47.89% β-sheet: 0.00% Coil/Unstructured: 52.11% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.41 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 114 Family Scaffolds |
---|---|---|
PF00072 | Response_reg | 76.32 |
PF13091 | PLDc_2 | 0.88 |
PF00011 | HSP20 | 0.88 |
COG ID | Name | Functional Category | % Frequency in 114 Family Scaffolds |
---|---|---|---|
COG0071 | Small heat shock protein IbpA, HSP20 family | Posttranslational modification, protein turnover, chaperones [O] | 0.88 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 57.02 % |
Unclassified | root | N/A | 42.98 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
2209111006|2214584693 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rickettsiales → unclassified Rickettsiales → Rickettsiales bacterium | 524 | Open in IMG/M |
3300000559|F14TC_100206733 | Not Available | 1267 | Open in IMG/M |
3300001431|F14TB_104877905 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 751 | Open in IMG/M |
3300002899|JGIcombinedJ43975_10036507 | Not Available | 810 | Open in IMG/M |
3300004114|Ga0062593_100633906 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1027 | Open in IMG/M |
3300004157|Ga0062590_100416189 | Not Available | 1109 | Open in IMG/M |
3300004463|Ga0063356_104328962 | Not Available | 611 | Open in IMG/M |
3300004480|Ga0062592_100015670 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 3262 | Open in IMG/M |
3300005171|Ga0066677_10038282 | Not Available | 2338 | Open in IMG/M |
3300005277|Ga0065716_1009505 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 671 | Open in IMG/M |
3300005295|Ga0065707_10858739 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → Limnohabitans | 579 | Open in IMG/M |
3300005329|Ga0070683_101668147 | Not Available | 613 | Open in IMG/M |
3300005347|Ga0070668_102134340 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Alteromonadales → Colwelliaceae | 517 | Open in IMG/M |
3300005353|Ga0070669_100257739 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1391 | Open in IMG/M |
3300005355|Ga0070671_101281019 | Not Available | 646 | Open in IMG/M |
3300005440|Ga0070705_101202116 | Not Available | 625 | Open in IMG/M |
3300005450|Ga0066682_10821474 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 560 | Open in IMG/M |
3300005455|Ga0070663_100282783 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1322 | Open in IMG/M |
3300005456|Ga0070678_101946861 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Aminicenantes → unclassified Aminicenantes → Candidatus Aminicenantes bacterium ADurb.Bin147 | 555 | Open in IMG/M |
3300005457|Ga0070662_100067868 | All Organisms → cellular organisms → Bacteria | 2620 | Open in IMG/M |
3300005457|Ga0070662_101386357 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 605 | Open in IMG/M |
3300005459|Ga0068867_102108686 | Not Available | 534 | Open in IMG/M |
3300005543|Ga0070672_100517365 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1034 | Open in IMG/M |
3300005557|Ga0066704_10490951 | Not Available | 809 | Open in IMG/M |
3300005563|Ga0068855_101712750 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 641 | Open in IMG/M |
3300005563|Ga0068855_101774540 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 627 | Open in IMG/M |
3300005586|Ga0066691_10831437 | Not Available | 544 | Open in IMG/M |
3300005615|Ga0070702_101402773 | Not Available | 571 | Open in IMG/M |
3300005764|Ga0066903_103026938 | Not Available | 910 | Open in IMG/M |
3300005764|Ga0066903_103893947 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 801 | Open in IMG/M |
3300005843|Ga0068860_100836502 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 935 | Open in IMG/M |
3300006049|Ga0075417_10248092 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 853 | Open in IMG/M |
3300006237|Ga0097621_101643615 | Not Available | 611 | Open in IMG/M |
3300006854|Ga0075425_100533613 | Not Available | 1351 | Open in IMG/M |
3300006854|Ga0075425_100857280 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1039 | Open in IMG/M |
3300006871|Ga0075434_100203726 | Not Available | 1999 | Open in IMG/M |
3300006871|Ga0075434_100521479 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1208 | Open in IMG/M |
3300006904|Ga0075424_101447870 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 729 | Open in IMG/M |
3300006904|Ga0075424_101526975 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 709 | Open in IMG/M |
3300006914|Ga0075436_100543227 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 853 | Open in IMG/M |
3300007076|Ga0075435_101694885 | Not Available | 555 | Open in IMG/M |
3300009094|Ga0111539_10236497 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 2127 | Open in IMG/M |
3300009094|Ga0111539_13281478 | Not Available | 521 | Open in IMG/M |
3300009147|Ga0114129_12423937 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 628 | Open in IMG/M |
3300009148|Ga0105243_11428128 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 713 | Open in IMG/M |
3300009162|Ga0075423_10578639 | Not Available | 1183 | Open in IMG/M |
3300009162|Ga0075423_12202644 | Not Available | 599 | Open in IMG/M |
3300009176|Ga0105242_11286160 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 754 | Open in IMG/M |
3300009553|Ga0105249_10682604 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1086 | Open in IMG/M |
3300009553|Ga0105249_10807534 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1002 | Open in IMG/M |
3300009553|Ga0105249_10919072 | Not Available | 942 | Open in IMG/M |
3300010373|Ga0134128_12624143 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 555 | Open in IMG/M |
3300010396|Ga0134126_10462395 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1467 | Open in IMG/M |
3300010399|Ga0134127_11780914 | Not Available | 692 | Open in IMG/M |
3300012198|Ga0137364_10508093 | Not Available | 906 | Open in IMG/M |
3300012200|Ga0137382_10331409 | Not Available | 1066 | Open in IMG/M |
3300012202|Ga0137363_10741562 | All Organisms → cellular organisms → Bacteria | 832 | Open in IMG/M |
3300012210|Ga0137378_10423143 | Not Available | 1235 | Open in IMG/M |
3300012349|Ga0137387_10731969 | Not Available | 715 | Open in IMG/M |
3300012359|Ga0137385_10408226 | Not Available | 1157 | Open in IMG/M |
3300012490|Ga0157322_1001797 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1126 | Open in IMG/M |
3300012685|Ga0137397_10844540 | Not Available | 679 | Open in IMG/M |
3300012897|Ga0157285_10313030 | Not Available | 538 | Open in IMG/M |
3300012930|Ga0137407_12067266 | Not Available | 544 | Open in IMG/M |
3300012985|Ga0164308_11416455 | All Organisms → cellular organisms → Bacteria | 635 | Open in IMG/M |
3300013296|Ga0157374_10498232 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1222 | Open in IMG/M |
3300013297|Ga0157378_11017224 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 863 | Open in IMG/M |
3300013297|Ga0157378_13313499 | Not Available | 500 | Open in IMG/M |
3300013306|Ga0163162_11165830 | Not Available | 874 | Open in IMG/M |
3300013307|Ga0157372_10466586 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1472 | Open in IMG/M |
3300014325|Ga0163163_11926521 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 651 | Open in IMG/M |
3300015261|Ga0182006_1298302 | Not Available | 529 | Open in IMG/M |
3300015262|Ga0182007_10332580 | Not Available | 566 | Open in IMG/M |
3300015264|Ga0137403_11375315 | Not Available | 553 | Open in IMG/M |
3300015371|Ga0132258_10618706 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 2720 | Open in IMG/M |
3300015371|Ga0132258_10719124 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 2515 | Open in IMG/M |
3300015371|Ga0132258_11575867 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1658 | Open in IMG/M |
3300015371|Ga0132258_13709459 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1042 | Open in IMG/M |
3300015372|Ga0132256_102171741 | All Organisms → cellular organisms → Bacteria | 660 | Open in IMG/M |
3300015373|Ga0132257_100472056 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1535 | Open in IMG/M |
3300015374|Ga0132255_100036607 | All Organisms → cellular organisms → Bacteria | 6276 | Open in IMG/M |
3300015374|Ga0132255_101594504 | Not Available | 989 | Open in IMG/M |
3300015374|Ga0132255_101927302 | Not Available | 899 | Open in IMG/M |
3300015374|Ga0132255_101958958 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 891 | Open in IMG/M |
3300016319|Ga0182033_10512320 | Not Available | 1032 | Open in IMG/M |
3300016341|Ga0182035_10558512 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 985 | Open in IMG/M |
3300016422|Ga0182039_11036190 | Not Available | 737 | Open in IMG/M |
3300017792|Ga0163161_10270200 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1330 | Open in IMG/M |
3300017792|Ga0163161_10411869 | Not Available | 1086 | Open in IMG/M |
3300018482|Ga0066669_11739417 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 574 | Open in IMG/M |
3300019361|Ga0173482_10791402 | Not Available | 502 | Open in IMG/M |
3300019879|Ga0193723_1029136 | Not Available | 1667 | Open in IMG/M |
3300019882|Ga0193713_1055341 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1137 | Open in IMG/M |
3300020002|Ga0193730_1156845 | Not Available | 597 | Open in IMG/M |
3300020004|Ga0193755_1080729 | Not Available | 1043 | Open in IMG/M |
3300020015|Ga0193734_1067760 | Not Available | 633 | Open in IMG/M |
3300025903|Ga0207680_11285541 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 520 | Open in IMG/M |
3300025917|Ga0207660_10410601 | Not Available | 1091 | Open in IMG/M |
3300025919|Ga0207657_10078616 | All Organisms → cellular organisms → Bacteria | 2777 | Open in IMG/M |
3300025923|Ga0207681_11247457 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 624 | Open in IMG/M |
3300025935|Ga0207709_11840449 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 504 | Open in IMG/M |
3300025940|Ga0207691_10187414 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1806 | Open in IMG/M |
3300025960|Ga0207651_10225310 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1518 | Open in IMG/M |
3300025972|Ga0207668_10795781 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 837 | Open in IMG/M |
3300026041|Ga0207639_10160412 | All Organisms → cellular organisms → Bacteria | 1894 | Open in IMG/M |
3300027873|Ga0209814_10073603 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1437 | Open in IMG/M |
3300027907|Ga0207428_10811125 | Not Available | 664 | Open in IMG/M |
3300028381|Ga0268264_12634923 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 507 | Open in IMG/M |
3300031538|Ga0310888_10515228 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 717 | Open in IMG/M |
3300031716|Ga0310813_10171160 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1762 | Open in IMG/M |
3300033289|Ga0310914_11885281 | Not Available | 502 | Open in IMG/M |
3300033475|Ga0310811_10221868 | Not Available | 2277 | Open in IMG/M |
3300034115|Ga0364945_0112640 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 802 | Open in IMG/M |
3300034150|Ga0364933_066390 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 899 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 14.04% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 9.65% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 8.77% |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 7.89% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 6.14% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 3.51% |
Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 2.63% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 2.63% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 2.63% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 2.63% |
Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 2.63% |
Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 2.63% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 2.63% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 2.63% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 2.63% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 2.63% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 1.75% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 1.75% |
Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 1.75% |
Sediment | Environmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment | 1.75% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 1.75% |
Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 1.75% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 1.75% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.88% |
Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.88% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 0.88% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 0.88% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 0.88% |
Arabidopsis Thaliana Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere | 0.88% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 0.88% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Rhizosphere | 0.88% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Soil → Unclassified → Miscanthus Rhizosphere | 0.88% |
Miscanthus Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere | 0.88% |
Switchgrass Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere | 0.88% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.88% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 0.88% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
2209111006 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 | Host-Associated | Open in IMG/M |
3300000559 | Amended soil microbial communities from Kansas Great Prairies, USA - control no BrdU total DNA F1.4 TC clc assemly | Environmental | Open in IMG/M |
3300001431 | Amended soil microbial communities from Kansas Great Prairies, USA - BrdU F1.4TB clc assemly | Environmental | Open in IMG/M |
3300002899 | Soil microbial communities from Manhattan, Kansas, USA - Combined assembly of Kansas soil 100-500um Nextera (ASSEMBLY_DATE=20140607) | Environmental | Open in IMG/M |
3300004114 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5 | Environmental | Open in IMG/M |
3300004157 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - - Combined assembly of AARS Block 2 | Environmental | Open in IMG/M |
3300004463 | Combined assembly of Arabidopsis thaliana microbial communities | Host-Associated | Open in IMG/M |
3300004480 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 4 | Environmental | Open in IMG/M |
3300005171 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_126 | Environmental | Open in IMG/M |
3300005277 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 | Host-Associated | Open in IMG/M |
3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 | Environmental | Open in IMG/M |
3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Environmental | Open in IMG/M |
3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Host-Associated | Open in IMG/M |
3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Host-Associated | Open in IMG/M |
3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Host-Associated | Open in IMG/M |
3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Environmental | Open in IMG/M |
3300005450 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_131 | Environmental | Open in IMG/M |
3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Host-Associated | Open in IMG/M |
3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Host-Associated | Open in IMG/M |
3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Host-Associated | Open in IMG/M |
3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Host-Associated | Open in IMG/M |
3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Host-Associated | Open in IMG/M |
3300005557 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_153 | Environmental | Open in IMG/M |
3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Host-Associated | Open in IMG/M |
3300005586 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_140 | Environmental | Open in IMG/M |
3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Environmental | Open in IMG/M |
3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Host-Associated | Open in IMG/M |
3300006049 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1 | Host-Associated | Open in IMG/M |
3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) | Host-Associated | Open in IMG/M |
3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
3300006871 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Host-Associated | Open in IMG/M |
3300006904 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3 | Host-Associated | Open in IMG/M |
3300006914 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Host-Associated | Open in IMG/M |
3300007076 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Host-Associated | Open in IMG/M |
3300009094 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) | Host-Associated | Open in IMG/M |
3300009147 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) | Host-Associated | Open in IMG/M |
3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Host-Associated | Open in IMG/M |
3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Host-Associated | Open in IMG/M |
3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Host-Associated | Open in IMG/M |
3300010373 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4 | Environmental | Open in IMG/M |
3300010396 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2 | Environmental | Open in IMG/M |
3300010399 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3 | Environmental | Open in IMG/M |
3300012198 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaG | Environmental | Open in IMG/M |
3300012200 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaG | Environmental | Open in IMG/M |
3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
3300012210 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaG | Environmental | Open in IMG/M |
3300012349 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Sage2_R_115_16 metaG | Environmental | Open in IMG/M |
3300012359 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_80_16 metaG | Environmental | Open in IMG/M |
3300012490 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.4.old.040610 | Host-Associated | Open in IMG/M |
3300012685 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz1.16 metaG | Environmental | Open in IMG/M |
3300012897 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S074-202C-1 | Environmental | Open in IMG/M |
3300012930 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012985 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_246_MG | Environmental | Open in IMG/M |
3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Host-Associated | Open in IMG/M |
3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Host-Associated | Open in IMG/M |
3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Host-Associated | Open in IMG/M |
3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Host-Associated | Open in IMG/M |
3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Host-Associated | Open in IMG/M |
3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Host-Associated | Open in IMG/M |
3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Host-Associated | Open in IMG/M |
3300015264 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
3300016319 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H | Environmental | Open in IMG/M |
3300016341 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 | Environmental | Open in IMG/M |
3300016422 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 | Environmental | Open in IMG/M |
3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Host-Associated | Open in IMG/M |
3300018482 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118 | Environmental | Open in IMG/M |
3300019361 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S133-311R-2 (version 2) | Environmental | Open in IMG/M |
3300019879 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2m2 | Environmental | Open in IMG/M |
3300019882 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H3a2 | Environmental | Open in IMG/M |
3300020002 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1a1 | Environmental | Open in IMG/M |
3300020004 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H1a2 | Environmental | Open in IMG/M |
3300020015 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1m1 | Environmental | Open in IMG/M |
3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) | Environmental | Open in IMG/M |
3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300027873 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1 (SPAdes) | Host-Associated | Open in IMG/M |
3300027907 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) | Host-Associated | Open in IMG/M |
3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300031538 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D1 | Environmental | Open in IMG/M |
3300031716 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YN3 | Environmental | Open in IMG/M |
3300033289 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN108 | Environmental | Open in IMG/M |
3300033475 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YC | Environmental | Open in IMG/M |
3300034115 | Sediment microbial communities from East River floodplain, Colorado, United States - 29_s17 | Environmental | Open in IMG/M |
3300034150 | Sediment microbial communities from East River floodplain, Colorado, United States - 25_j17 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
2213625527 | 2209111006 | Arabidopsis Rhizosphere | MDRLDDEDIGVIWARHYPKRAERASSMSLCVTLTMIIKQRAKSADQY |
F14TC_1002067334 | 3300000559 | Soil | MDRLDDEDIGLIWARHYPKRDESESSKSLCVTLAMIIKHRAESIILPY |
F14TB_1048779051 | 3300001431 | Soil | MDRLDNEEIGIIWARHYPKRAENGSSKSLCLSLAMVIRLRARSMT |
JGIcombinedJ43975_100365071 | 3300002899 | Soil | MDRLDDEDIGIIWERHYPKRVEHASSMSLCVTLTMIIKQRAKSADQYDPAKLDQVLASANRSKRTVRDSRE* |
Ga0062593_1006339061 | 3300004114 | Soil | MDRLDNEDIGIIWERHYSNRGQSASSMSLCVTLAMIIKQRAKSLDQYTDWSDKLHHAL |
Ga0062590_1004161893 | 3300004157 | Soil | HCGSEMDRLDDEDIGIIWGRHYSKRAEDASSMSLCVTLAMIIKQRAKTLDQYSD* |
Ga0063356_1043289621 | 3300004463 | Arabidopsis Thaliana Rhizosphere | MDRLDEEDIGIIWARHYPKRTERESSMSLCVTLTMIIKQRAKSADNYDPAKLDQVL |
Ga0062592_1000156707 | 3300004480 | Soil | LQLAKSMDRLDNEDIGIIWERHYNNRGQSASSMSLCVTLAMIIKQRA |
Ga0066677_100382825 | 3300005171 | Soil | MDRLDNEDIGIIWARHYPKRAESASSMSLCLTLAMIIRLRARSMTQYS |
Ga0065716_10095051 | 3300005277 | Arabidopsis Rhizosphere | MDRLDDEDIGVIWARHYPKRAERASSMSLCVTLTMIIKQRAKSADQYDPAKLE |
Ga0065707_108587391 | 3300005295 | Switchgrass Rhizosphere | MDRLDDEDIGVIWARHYPKRAEHESSMSLCVTLTMIIKQRAKSADQYDRAKLDQVLA |
Ga0070683_1016681471 | 3300005329 | Corn Rhizosphere | MDRLDEEDIGIIWARHYPKRTERESSMSLCVTLTMIIKQR |
Ga0070668_1021343401 | 3300005347 | Switchgrass Rhizosphere | MDRLDDEDIGIIWARHYPKRAERASSMSLCVTLTMIIKQRAKS |
Ga0070669_1002577395 | 3300005353 | Switchgrass Rhizosphere | MDRLDEEDIGIIWARHYPKRTERESSMSLCVTLTMIIKQRAKSADQY |
Ga0070671_1012810192 | 3300005355 | Switchgrass Rhizosphere | MDRLDDEDIGIIWGRHYPKRAEDASSMSLCVTLAMIIKQRAKTLDQYSDWPA |
Ga0070705_1012021161 | 3300005440 | Corn, Switchgrass And Miscanthus Rhizosphere | MDRLDDEDIGIIWGRHYSKRAEDASSMSLCVTLAMIIKQRAKTLDQYSDWPA |
Ga0066682_108214741 | 3300005450 | Soil | MDRLDNEDIGILWARHYPKRAENGSSKSLCLSLAMVIRLR |
Ga0070663_1002827831 | 3300005455 | Corn Rhizosphere | MDHRDDEDIGVIWARHYPKRAEHASSMSLCVTLAMIVKQSR* |
Ga0070678_1019468612 | 3300005456 | Miscanthus Rhizosphere | MDHLDDEDIGIIWARHYPKRAEHASSMSLCVTLAMIVKQRAKSVDQYSDWPAKLEHALATAN |
Ga0070662_1000678687 | 3300005457 | Corn Rhizosphere | MDRLDDEDIGVIWARHYPKRAERASSMSLCVTLTMIIKQRAKS |
Ga0070662_1013863572 | 3300005457 | Corn Rhizosphere | MDHLDYEDIGIIWARHYPKRAEHASSMSLCVTLAMIVKQRAKSVDQYSDWP |
Ga0068867_1021086861 | 3300005459 | Miscanthus Rhizosphere | MDRLDNEDIGMIWARHFPKRAESGSSRSLCLSLAMVLGCEPDP* |
Ga0070672_1005173653 | 3300005543 | Miscanthus Rhizosphere | MDHRDDEDIGVIWARHYPKRAEHASSMSLCVTLAMIVKQ |
Ga0066704_104909511 | 3300005557 | Soil | MDRLENEEIGMIWARHYPKRAESASSLSLCVTLALILKQRAKSVVHHKAWSD |
Ga0068855_1017127502 | 3300005563 | Corn Rhizosphere | MDRLDNEDIGIIWERHYPKRVEHASSMSLCVTLTMIIKQRAKSADQYDPAKL |
Ga0068855_1017745401 | 3300005563 | Corn Rhizosphere | MDHLDDEDIGIIWARHYPKRAEHASSMSLCVTLAMIVKQR |
Ga0066691_108314371 | 3300005586 | Soil | MDRLENEDIGIIWARHYPKRAERASSMSLCLTLAMIIRLRARSMTQYSDWRDKL |
Ga0070702_1014027732 | 3300005615 | Corn, Switchgrass And Miscanthus Rhizosphere | MDRLDDEDIGIIWGRHYPKRAEDASSMSLCVTLAMIIKQRAKTLDQYSDW |
Ga0066903_1030269383 | 3300005764 | Tropical Forest Soil | MDRLDDEDIGIIWGRHYPKRAEHASSMSLCVTLAMIVKQRAKSLDQYNDWPAKLEHA |
Ga0066903_1038939472 | 3300005764 | Tropical Forest Soil | MDRLDDEDIGIIWGRHYPKRAEHASSTSLCVTLAMIIKQRAKSLDQYNDWPAKLEHALAAAHV |
Ga0068860_1008365022 | 3300005843 | Switchgrass Rhizosphere | MDHLDDEDIGIIWARHYPKRAEHASSMSLCVTLAMIVKQRAKSVDQYSDWPVKLEHALATANI |
Ga0075417_102480921 | 3300006049 | Populus Rhizosphere | MDRLDNEEIGILWARHYPKRAENGSSKSLCLSLAMVIRLR |
Ga0097621_1016436151 | 3300006237 | Miscanthus Rhizosphere | MDRLDDEDIGIIWGRHYPKRAEDASSMSLCVTLAMIIKQRAK |
Ga0075425_1005336133 | 3300006854 | Populus Rhizosphere | MDRLDDEDIGIIWGRHYPKRAEDASSMSLCVTLAMIIKQRAKTLDQYSDWPAK |
Ga0075425_1008572803 | 3300006854 | Populus Rhizosphere | MDRLDNEDIGIIWERHYSNRGQSASSMSLCVTLAMIIKQRAKSVDQYTDWSDKLHHAL |
Ga0075434_1002037265 | 3300006871 | Populus Rhizosphere | MHCGSEMDRLDDEDIGIIWGRHYSKRAEDASSMSLCVTLAMIIKQRAKTLDQYSDWPAK |
Ga0075434_1005214792 | 3300006871 | Populus Rhizosphere | MDRLDNEDIGMIWARHFPKRAESGSSRSLCLSLAMVLRLRARSMTHQSDWSDKLE* |
Ga0075424_1014478702 | 3300006904 | Populus Rhizosphere | MDRLDNEEIGIIWSRHYPKRAENGSSKSLCLSLAMVIRLRARSMTQQSDWSDKLEHILAD |
Ga0075424_1015269751 | 3300006904 | Populus Rhizosphere | MDRLDNEDIGMIWARHFPKRAESGSSRSLCLSLAMVLRLRARSMTHQSDWSDKLE |
Ga0075436_1005432271 | 3300006914 | Populus Rhizosphere | MDHLDYEDIGIIWARHYPKRAEHASSMSLCVTLAMIVKQR |
Ga0075435_1016948851 | 3300007076 | Populus Rhizosphere | MDHRDDEDIGVIWARHYPKRAEHASSMSLCVTLAMIVKQRAKSVDQYSDWPAKLE |
Ga0111539_102364974 | 3300009094 | Populus Rhizosphere | MDRLDNEDIGIIWERHYSNRRQSASSMSLCVTLAMIIKQRAKSVDQYPDWSD |
Ga0111539_132814781 | 3300009094 | Populus Rhizosphere | MDRLDDEDIGIIWARHYPKRAERASSMSLCVTLTMIIKQRAKSADPYDEWPAKLDHALNMAH |
Ga0114129_124239372 | 3300009147 | Populus Rhizosphere | MDRLDDEDIGIIWERHYPKRVENASSMSLCVTLTLIIKQRAK |
Ga0105243_114281281 | 3300009148 | Miscanthus Rhizosphere | MDHRDDEDIGVIWARHYPKRAEHASSMSLCVTLAMIVKQRAKSVDQYSDWP |
Ga0075423_105786392 | 3300009162 | Populus Rhizosphere | MDRLDDEDIGVIWARHYPKRTERESSMSLCVTLTMIIKQRAKSADQYD |
Ga0075423_122026441 | 3300009162 | Populus Rhizosphere | MDRLDDEDIGIIWGRHYSKRAEHASSMSLCVTLAMIIKQ |
Ga0105242_112861602 | 3300009176 | Miscanthus Rhizosphere | MDHLDDEDIGIIWARHYPKRAEHASSMSLCVTLAMIVK |
Ga0105249_106826042 | 3300009553 | Switchgrass Rhizosphere | MDHLDYEDIGIIWARHYPKRAEHASSMSLCVTLAMIVKQSR* |
Ga0105249_108075342 | 3300009553 | Switchgrass Rhizosphere | MDRLDNEEIGIIWARHYPKRAENGSSKSLCLSLAMVIRL |
Ga0105249_109190721 | 3300009553 | Switchgrass Rhizosphere | MDRLDNEEIGIIWARHYPKRAESGSSRSLCLSLAMVLRLR |
Ga0134128_126241431 | 3300010373 | Terrestrial Soil | MDRLDNEDIGMIWARHFPKRTESGSSRSLCLSLAMVLRLRARSMTHQSDWS |
Ga0134126_104623951 | 3300010396 | Terrestrial Soil | MDHLDDEDSGIIWARHYPKRAEHASSMSLCVTLAMIVKQRGKSV |
Ga0134127_117809142 | 3300010399 | Terrestrial Soil | MDRLDEEDIGIIWARHYPKRTERESSMSLCVTLTMIIKQRAKSADNYDPA |
Ga0137364_105080932 | 3300012198 | Vadose Zone Soil | MDRLENEEIGMIWARHYPKRAESASSLSLCVTLALILKQRAKSVVHHKAWSDKLRHVLSAAR |
Ga0137382_103314091 | 3300012200 | Vadose Zone Soil | MDRLENEDVGMIWARHYPKRAERASSMSLCLTLAMIIRLRARSMTQYSDW |
Ga0137363_107415621 | 3300012202 | Vadose Zone Soil | MDRLQNEDIGIIWARHYPKRAESASSMSLCVTLAMI |
Ga0137378_104231432 | 3300012210 | Vadose Zone Soil | MDRLENEEIGMIWARHYPKRAESASSLSLCVTLALILKQRAKSVVHHKAWS |
Ga0137387_107319691 | 3300012349 | Vadose Zone Soil | MDRLENEDVGMIWARHYLKRAERASSMSLCLTLAMIIRLRARSMTQYSDWRDKLQHVL |
Ga0137385_104082261 | 3300012359 | Vadose Zone Soil | MDRLENEEIGMIWARHYPKRAESASSLSLCVTLALILKQRAKSVV |
Ga0157322_10017971 | 3300012490 | Arabidopsis Rhizosphere | MDRLDNEEIGIIWARHYPKRAENGSSKSLCLSLAMVIRLRARSMTQQSDW |
Ga0137397_108445402 | 3300012685 | Vadose Zone Soil | MDRLDNEGIGMIWARHFPKRAENGSSKSLCLSLAMVIR |
Ga0157285_103130302 | 3300012897 | Soil | MDRLDDEDIGIIWERHYPKRTERESSMSLCVTLTMIIKQRAKSADNYNPAKLDQVLA |
Ga0137407_120672661 | 3300012930 | Vadose Zone Soil | MDRLDNEDIGLSWARHYPKRSESQSSKSLCVTLAMIIKQRAES |
Ga0164308_114164551 | 3300012985 | Soil | MDRLDDEDIGITWARHYPKCAERASSMSLCVTLTMIIK* |
Ga0157374_104982323 | 3300013296 | Miscanthus Rhizosphere | MDRLDDEDIGIIWARHYPKRAERASSMSLCVTLTMIIKQRAKSADPYDEWP |
Ga0157378_110172242 | 3300013297 | Miscanthus Rhizosphere | MDRLDNEDIGIIWERHYPKRVEHASSMSLCVTLTMIIKQRAKSADQYDPA |
Ga0157378_133134991 | 3300013297 | Miscanthus Rhizosphere | DHRDDEDIGVIWARHYPKRAEHASSMSLCVTLAMIVKQSR* |
Ga0163162_111658302 | 3300013306 | Switchgrass Rhizosphere | MDRLDNEEIGIIWARHYPKRAESGSSRSLCLSLAIVLRL |
Ga0157372_104665861 | 3300013307 | Corn Rhizosphere | MDHLDDEDIGIIWARHYPKRAEHASSMSLCVTLAMIVKQRAKS |
Ga0163163_119265211 | 3300014325 | Switchgrass Rhizosphere | MDRLDNEDIGIIWERHYPKRVEHASSMSLCVTLTMIIKQRAKSADQYDAAKLGQ |
Ga0182006_12983021 | 3300015261 | Rhizosphere | MDRLDDEDIGIIWERHDPKRVEHASSMSLCVTLTMIIKQRAKSADQYDP |
Ga0182007_103325801 | 3300015262 | Rhizosphere | MDRLDDEDIGIIWERHYPKRVEHASSMSLCVTLTMIIMDRAKSAV* |
Ga0137403_113753151 | 3300015264 | Vadose Zone Soil | MDRLDNEEIGIIWARHYPKRAENGSSKSLCLSLAMVIRLRARSMTQQSDWSDK |
Ga0132258_106187062 | 3300015371 | Arabidopsis Rhizosphere | MDRLDDADIGIIWERHYPKRAESGSSMSLCITLTMIIKQRTKLVNQYEAWSLN* |
Ga0132258_107191245 | 3300015371 | Arabidopsis Rhizosphere | MDRLDDEDIGFIWARHYSKRAGQASSMSLCITLAMIIKQRAKSLHQYNGWVSKLE |
Ga0132258_115758673 | 3300015371 | Arabidopsis Rhizosphere | MDRLDDEDIGIIWARHYPKRAEQASSMSLCVTLTMIIKQRAKSADQYDPAKLE |
Ga0132258_137094594 | 3300015371 | Arabidopsis Rhizosphere | MDRLDDEDIGVIWARHYPKRAERASSMSLCVTLTMII |
Ga0132256_1021717412 | 3300015372 | Arabidopsis Rhizosphere | MDRLDDEDIGFIWARHYPKRAEQASTMSLCVTLAMIIKQRAK |
Ga0132257_1004720561 | 3300015373 | Arabidopsis Rhizosphere | MDRLDDEDIGFIWARHYSKRAGQVSSMSLCITLAMIIKQRAKSLHQYN |
Ga0132255_1000366075 | 3300015374 | Arabidopsis Rhizosphere | MDRLDDEDIGIIWARHYPKRTERQSSMSLCVTHTMIIKQRAKSADQYDPVN* |
Ga0132255_1015945042 | 3300015374 | Arabidopsis Rhizosphere | MDRLDDEDIGVIWARHYPKRTERESSMSLCVTLTMIIKQRAKSADQYDPAKLDQVLA |
Ga0132255_1019273021 | 3300015374 | Arabidopsis Rhizosphere | MDRLDNEEIGIIWARHYPKRAESGSSRSLCLSLAIVLRLRARSMTHQSDWSDKLEQILAD |
Ga0132255_1019589581 | 3300015374 | Arabidopsis Rhizosphere | MDRLDDEDIGIIWARHYPKRAERASSMSLCVTLTMIIKQRAKSADQYDPAKLEHA |
Ga0182033_105123203 | 3300016319 | Soil | MDRLDDEDIGIIWGRHYPKRAEHSSSTSLCVTLAMIIKQRAKSLDQYNDWPAKLE |
Ga0182035_105585121 | 3300016341 | Soil | MDRLDDEDIGIIWGRHYPKRAEHASSTSLCVTLAMIIKQRAKSLDQYNDWPAKLEHALA |
Ga0182039_110361902 | 3300016422 | Soil | MDRLDDEDIGIIWGRHYPKRAERASSTSLCVTLAMISKQRAKSRDQYNDWPAKLEHALAD |
Ga0163161_102702002 | 3300017792 | Switchgrass Rhizosphere | MDHLDDEDIGIIWARHYPKRAEHASSMSLCVTLAMIVKQSR |
Ga0163161_104118692 | 3300017792 | Switchgrass Rhizosphere | MDRLDNEEIGIIWARHYPKRAESGSSRSLCLSLAIVLRLRARSMTHQSDWSDKLE |
Ga0066669_117394172 | 3300018482 | Grasslands Soil | MDRLDNEDIGILWARHYPKRAENGSSKSLCLSLAMV |
Ga0173482_107914022 | 3300019361 | Soil | MDRLDEEDIGIIWARHYPKRTERESSMSLCVTLTMIIKQRAKSADNYDPAKLDQVLASA |
Ga0193723_10291361 | 3300019879 | Soil | MDRLDNEDIGMIWARHYPKRAERASSMSLCLTLAMIIRLRARSMTQY |
Ga0193713_10553411 | 3300019882 | Soil | MDRLDNEGIGMIWARHFPKRAKNGSSKSLCVSLAIVIRL |
Ga0193730_11568451 | 3300020002 | Soil | MDRLENEEIGMIWARHYPKRAESASSMSLCVTLAMIIKQRAKSVLEYNACSDKLRHVL |
Ga0193755_10807291 | 3300020004 | Soil | MDRLENEEIGMIWARHYPKRAESASSLSLCVTLALILKQRAKSVVH |
Ga0193734_10677601 | 3300020015 | Soil | MDRLDNEDIGMIWARHYPKRAERASSMSLCLTLAMIIRLRARSMTQYSDWRDKLQHVL |
Ga0207680_112855412 | 3300025903 | Switchgrass Rhizosphere | MDRLDNEDIGIIWERHYSNRGQSASSMSLCVTLAMIIKQRAKSVDQYTDWSDKLHHALA |
Ga0207660_104106013 | 3300025917 | Corn Rhizosphere | MDRLDEEDIGIIWARHYPKRTERESSMSLCVTLTMIIKQRAKSADNYDPAKLD |
Ga0207657_100786167 | 3300025919 | Corn Rhizosphere | MDRLDDEDIGIIWERHYPKRTERESSMSLCVTLTMIIK |
Ga0207681_112474571 | 3300025923 | Switchgrass Rhizosphere | MDHLDDEDIGIIWARHYPKRAEHASSMSLCVTLAMIVKQRAKSVDQYSDWPVKLEHALAT |
Ga0207709_118404492 | 3300025935 | Miscanthus Rhizosphere | MDRLDNEDIGMIWARHYPKRAESGSSRSLCLSLAIVLRLRARSMTHQSDWSDKL |
Ga0207691_101874144 | 3300025940 | Miscanthus Rhizosphere | MDHRDDEDIGVIWARHYPKRAEHASSMSLCVTLAMIVKQSR |
Ga0207651_102253104 | 3300025960 | Switchgrass Rhizosphere | MDRLDNEDIGIIWERHYPKRVEHASSRSLCVTLTMIIKQRAKLADQYDP |
Ga0207668_107957811 | 3300025972 | Switchgrass Rhizosphere | MDRLDNEEIGIIWARHYPKRAENGSSKSLCLSLAMVIR |
Ga0207639_101604124 | 3300026041 | Corn Rhizosphere | MDHRDDEDIGVIWARHYPKRAEHASSMSLCVTLAMIVKQRAKSVDQYSDWPVKLEHALATAN |
Ga0209814_100736033 | 3300027873 | Populus Rhizosphere | MDRLDNEDIGLIWARHYPKRDESQSSKSLCVTLAMIIKH |
Ga0207428_108111252 | 3300027907 | Populus Rhizosphere | HRDDEDIGVIWARHYPKRAEHASSMSLCVTLAMIVKQSR |
Ga0268264_126349232 | 3300028381 | Switchgrass Rhizosphere | MDRLDNEDIGIIWERHYNNRGQSASSMSLCVTLAMIIKQRAKSVDQYTDWSDKLHHALA |
Ga0310888_105152282 | 3300031538 | Soil | MDRLDNEEIGIIWARHYPKRAENGSSKSLCLSLAMVIRLRARSMTQQSDWSNKLEHIL |
Ga0310813_101711602 | 3300031716 | Soil | MDRLDNEDIGIIWERHYNNRGQSASSMSLCVTLAMIIKQRAKSVDQYTDWSDKLHHALAA |
Ga0310914_118852811 | 3300033289 | Soil | MDRLDDEDIGIIWARHYPKRAERTSSMSLCVTLAMIIKQRAKSIDQYND |
Ga0310811_102218681 | 3300033475 | Soil | MDRLDEEDIGIIWARHYPKRTERESSMSLCVTLTMII |
Ga0364945_0112640_1_129 | 3300034115 | Sediment | MDRLDNEEIGIIWARHYPKRAENGSSKSLCLSLAMVIRLRARS |
Ga0364933_066390_773_898 | 3300034150 | Sediment | MDRLDNEEIGIIWARHYPKRAENGSSKSLCLSLAMVIRLRAR |
⦗Top⦘ |