NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome Family F081468

Metagenome Family F081468

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F081468
Family Type Metagenome
Number of Sequences 114
Average Sequence Length 49 residues
Representative Sequence MDRLDDEDIGIIWARHYPKRAERASSMSLCVTLTMIIKQRAKS
Number of Associated Samples 96
Number of Associated Scaffolds 114

Quality Assessment
Transcriptomic Evidence No
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 78.07 %
% of genes near scaffold ends (potentially truncated) 90.35 %
% of genes from short scaffolds (< 2000 bps) 92.11 %
Associated GOLD sequencing projects 86
AlphaFold2 3D model prediction Yes
3D model pTM-score0.41

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (57.018 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere
(14.035 % of family members)
Environment Ontology (ENVO) Unclassified
(47.368 % of family members)
Earth Microbiome Project Ontology (EMPO) Host-associated → Plant → Plant rhizosphere
(71.053 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 47.89%    β-sheet: 0.00%    Coil/Unstructured: 52.11%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.41
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 114 Family Scaffolds
PF00072Response_reg 76.32
PF13091PLDc_2 0.88
PF00011HSP20 0.88

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 114 Family Scaffolds
COG0071Small heat shock protein IbpA, HSP20 familyPosttranslational modification, protein turnover, chaperones [O] 0.88


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms57.02 %
UnclassifiedrootN/A42.98 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2209111006|2214584693All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rickettsiales → unclassified Rickettsiales → Rickettsiales bacterium524Open in IMG/M
3300000559|F14TC_100206733Not Available1267Open in IMG/M
3300001431|F14TB_104877905All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium751Open in IMG/M
3300002899|JGIcombinedJ43975_10036507Not Available810Open in IMG/M
3300004114|Ga0062593_100633906All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1027Open in IMG/M
3300004157|Ga0062590_100416189Not Available1109Open in IMG/M
3300004463|Ga0063356_104328962Not Available611Open in IMG/M
3300004480|Ga0062592_100015670All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium3262Open in IMG/M
3300005171|Ga0066677_10038282Not Available2338Open in IMG/M
3300005277|Ga0065716_1009505All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium671Open in IMG/M
3300005295|Ga0065707_10858739All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → Limnohabitans579Open in IMG/M
3300005329|Ga0070683_101668147Not Available613Open in IMG/M
3300005347|Ga0070668_102134340All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Alteromonadales → Colwelliaceae517Open in IMG/M
3300005353|Ga0070669_100257739All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1391Open in IMG/M
3300005355|Ga0070671_101281019Not Available646Open in IMG/M
3300005440|Ga0070705_101202116Not Available625Open in IMG/M
3300005450|Ga0066682_10821474All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium560Open in IMG/M
3300005455|Ga0070663_100282783All Organisms → cellular organisms → Bacteria → Proteobacteria1322Open in IMG/M
3300005456|Ga0070678_101946861All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Aminicenantes → unclassified Aminicenantes → Candidatus Aminicenantes bacterium ADurb.Bin147555Open in IMG/M
3300005457|Ga0070662_100067868All Organisms → cellular organisms → Bacteria2620Open in IMG/M
3300005457|Ga0070662_101386357All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium605Open in IMG/M
3300005459|Ga0068867_102108686Not Available534Open in IMG/M
3300005543|Ga0070672_100517365All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1034Open in IMG/M
3300005557|Ga0066704_10490951Not Available809Open in IMG/M
3300005563|Ga0068855_101712750All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium641Open in IMG/M
3300005563|Ga0068855_101774540All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium627Open in IMG/M
3300005586|Ga0066691_10831437Not Available544Open in IMG/M
3300005615|Ga0070702_101402773Not Available571Open in IMG/M
3300005764|Ga0066903_103026938Not Available910Open in IMG/M
3300005764|Ga0066903_103893947All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria801Open in IMG/M
3300005843|Ga0068860_100836502All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium935Open in IMG/M
3300006049|Ga0075417_10248092All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium853Open in IMG/M
3300006237|Ga0097621_101643615Not Available611Open in IMG/M
3300006854|Ga0075425_100533613Not Available1351Open in IMG/M
3300006854|Ga0075425_100857280All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1039Open in IMG/M
3300006871|Ga0075434_100203726Not Available1999Open in IMG/M
3300006871|Ga0075434_100521479All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1208Open in IMG/M
3300006904|Ga0075424_101447870All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium729Open in IMG/M
3300006904|Ga0075424_101526975All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium709Open in IMG/M
3300006914|Ga0075436_100543227All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium853Open in IMG/M
3300007076|Ga0075435_101694885Not Available555Open in IMG/M
3300009094|Ga0111539_10236497All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium2127Open in IMG/M
3300009094|Ga0111539_13281478Not Available521Open in IMG/M
3300009147|Ga0114129_12423937All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium628Open in IMG/M
3300009148|Ga0105243_11428128All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium713Open in IMG/M
3300009162|Ga0075423_10578639Not Available1183Open in IMG/M
3300009162|Ga0075423_12202644Not Available599Open in IMG/M
3300009176|Ga0105242_11286160All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium754Open in IMG/M
3300009553|Ga0105249_10682604All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1086Open in IMG/M
3300009553|Ga0105249_10807534All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1002Open in IMG/M
3300009553|Ga0105249_10919072Not Available942Open in IMG/M
3300010373|Ga0134128_12624143All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium555Open in IMG/M
3300010396|Ga0134126_10462395All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1467Open in IMG/M
3300010399|Ga0134127_11780914Not Available692Open in IMG/M
3300012198|Ga0137364_10508093Not Available906Open in IMG/M
3300012200|Ga0137382_10331409Not Available1066Open in IMG/M
3300012202|Ga0137363_10741562All Organisms → cellular organisms → Bacteria832Open in IMG/M
3300012210|Ga0137378_10423143Not Available1235Open in IMG/M
3300012349|Ga0137387_10731969Not Available715Open in IMG/M
3300012359|Ga0137385_10408226Not Available1157Open in IMG/M
3300012490|Ga0157322_1001797All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1126Open in IMG/M
3300012685|Ga0137397_10844540Not Available679Open in IMG/M
3300012897|Ga0157285_10313030Not Available538Open in IMG/M
3300012930|Ga0137407_12067266Not Available544Open in IMG/M
3300012985|Ga0164308_11416455All Organisms → cellular organisms → Bacteria635Open in IMG/M
3300013296|Ga0157374_10498232All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1222Open in IMG/M
3300013297|Ga0157378_11017224All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium863Open in IMG/M
3300013297|Ga0157378_13313499Not Available500Open in IMG/M
3300013306|Ga0163162_11165830Not Available874Open in IMG/M
3300013307|Ga0157372_10466586All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1472Open in IMG/M
3300014325|Ga0163163_11926521All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium651Open in IMG/M
3300015261|Ga0182006_1298302Not Available529Open in IMG/M
3300015262|Ga0182007_10332580Not Available566Open in IMG/M
3300015264|Ga0137403_11375315Not Available553Open in IMG/M
3300015371|Ga0132258_10618706All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium2720Open in IMG/M
3300015371|Ga0132258_10719124All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium2515Open in IMG/M
3300015371|Ga0132258_11575867All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1658Open in IMG/M
3300015371|Ga0132258_13709459All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1042Open in IMG/M
3300015372|Ga0132256_102171741All Organisms → cellular organisms → Bacteria660Open in IMG/M
3300015373|Ga0132257_100472056All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1535Open in IMG/M
3300015374|Ga0132255_100036607All Organisms → cellular organisms → Bacteria6276Open in IMG/M
3300015374|Ga0132255_101594504Not Available989Open in IMG/M
3300015374|Ga0132255_101927302Not Available899Open in IMG/M
3300015374|Ga0132255_101958958All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium891Open in IMG/M
3300016319|Ga0182033_10512320Not Available1032Open in IMG/M
3300016341|Ga0182035_10558512All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium985Open in IMG/M
3300016422|Ga0182039_11036190Not Available737Open in IMG/M
3300017792|Ga0163161_10270200All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1330Open in IMG/M
3300017792|Ga0163161_10411869Not Available1086Open in IMG/M
3300018482|Ga0066669_11739417All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium574Open in IMG/M
3300019361|Ga0173482_10791402Not Available502Open in IMG/M
3300019879|Ga0193723_1029136Not Available1667Open in IMG/M
3300019882|Ga0193713_1055341All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1137Open in IMG/M
3300020002|Ga0193730_1156845Not Available597Open in IMG/M
3300020004|Ga0193755_1080729Not Available1043Open in IMG/M
3300020015|Ga0193734_1067760Not Available633Open in IMG/M
3300025903|Ga0207680_11285541All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium520Open in IMG/M
3300025917|Ga0207660_10410601Not Available1091Open in IMG/M
3300025919|Ga0207657_10078616All Organisms → cellular organisms → Bacteria2777Open in IMG/M
3300025923|Ga0207681_11247457All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium624Open in IMG/M
3300025935|Ga0207709_11840449All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium504Open in IMG/M
3300025940|Ga0207691_10187414All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1806Open in IMG/M
3300025960|Ga0207651_10225310All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1518Open in IMG/M
3300025972|Ga0207668_10795781All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium837Open in IMG/M
3300026041|Ga0207639_10160412All Organisms → cellular organisms → Bacteria1894Open in IMG/M
3300027873|Ga0209814_10073603All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1437Open in IMG/M
3300027907|Ga0207428_10811125Not Available664Open in IMG/M
3300028381|Ga0268264_12634923All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium507Open in IMG/M
3300031538|Ga0310888_10515228All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium717Open in IMG/M
3300031716|Ga0310813_10171160All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1762Open in IMG/M
3300033289|Ga0310914_11885281Not Available502Open in IMG/M
3300033475|Ga0310811_10221868Not Available2277Open in IMG/M
3300034115|Ga0364945_0112640All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium802Open in IMG/M
3300034150|Ga0364933_066390All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium899Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere14.04%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere9.65%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil8.77%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil7.89%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere6.14%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere3.51%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil2.63%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil2.63%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil2.63%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil2.63%
SoilEnvironmental → Terrestrial → Soil → Loam → Grasslands → Soil2.63%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere2.63%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere2.63%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere2.63%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere2.63%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere2.63%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil1.75%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere1.75%
Corn RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere1.75%
SedimentEnvironmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment1.75%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere1.75%
RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere1.75%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere1.75%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil0.88%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Switchgrass Rhizosphere0.88%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil0.88%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil0.88%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil0.88%
Arabidopsis Thaliana RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere0.88%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere0.88%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Rhizosphere0.88%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Soil → Unclassified → Miscanthus Rhizosphere0.88%
Miscanthus RhizosphereHost-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere0.88%
Switchgrass RhizosphereHost-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere0.88%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere0.88%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere0.88%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
2209111006Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0Host-AssociatedOpen in IMG/M
3300000559Amended soil microbial communities from Kansas Great Prairies, USA - control no BrdU total DNA F1.4 TC clc assemlyEnvironmentalOpen in IMG/M
3300001431Amended soil microbial communities from Kansas Great Prairies, USA - BrdU F1.4TB clc assemlyEnvironmentalOpen in IMG/M
3300002899Soil microbial communities from Manhattan, Kansas, USA - Combined assembly of Kansas soil 100-500um Nextera (ASSEMBLY_DATE=20140607)EnvironmentalOpen in IMG/M
3300004114Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5EnvironmentalOpen in IMG/M
3300004157Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - - Combined assembly of AARS Block 2EnvironmentalOpen in IMG/M
3300004463Combined assembly of Arabidopsis thaliana microbial communitiesHost-AssociatedOpen in IMG/M
3300004480Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 4EnvironmentalOpen in IMG/M
3300005171Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_126EnvironmentalOpen in IMG/M
3300005277Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0Host-AssociatedOpen in IMG/M
3300005295Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3EnvironmentalOpen in IMG/M
3300005329Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaGEnvironmentalOpen in IMG/M
3300005347Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaGHost-AssociatedOpen in IMG/M
3300005353Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaGHost-AssociatedOpen in IMG/M
3300005355Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaGHost-AssociatedOpen in IMG/M
3300005440Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaGEnvironmentalOpen in IMG/M
3300005450Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_131EnvironmentalOpen in IMG/M
3300005455Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaGHost-AssociatedOpen in IMG/M
3300005456Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaGHost-AssociatedOpen in IMG/M
3300005457Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaGHost-AssociatedOpen in IMG/M
3300005459Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2Host-AssociatedOpen in IMG/M
3300005543Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaGHost-AssociatedOpen in IMG/M
3300005557Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_153EnvironmentalOpen in IMG/M
3300005563Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2Host-AssociatedOpen in IMG/M
3300005586Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_140EnvironmentalOpen in IMG/M
3300005615Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaGEnvironmentalOpen in IMG/M
3300005764Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)EnvironmentalOpen in IMG/M
3300005843Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2Host-AssociatedOpen in IMG/M
3300006049Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1Host-AssociatedOpen in IMG/M
3300006237Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2)Host-AssociatedOpen in IMG/M
3300006854Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4Host-AssociatedOpen in IMG/M
3300006871Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3Host-AssociatedOpen in IMG/M
3300006904Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3Host-AssociatedOpen in IMG/M
3300006914Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5Host-AssociatedOpen in IMG/M
3300007076Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4Host-AssociatedOpen in IMG/M
3300009094Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2)Host-AssociatedOpen in IMG/M
3300009147Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2)Host-AssociatedOpen in IMG/M
3300009148Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaGHost-AssociatedOpen in IMG/M
3300009162Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2Host-AssociatedOpen in IMG/M
3300009176Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaGHost-AssociatedOpen in IMG/M
3300009553Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaGHost-AssociatedOpen in IMG/M
3300010373Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4EnvironmentalOpen in IMG/M
3300010396Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2EnvironmentalOpen in IMG/M
3300010399Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3EnvironmentalOpen in IMG/M
3300012198Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaGEnvironmentalOpen in IMG/M
3300012200Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaGEnvironmentalOpen in IMG/M
3300012202Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaGEnvironmentalOpen in IMG/M
3300012210Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaGEnvironmentalOpen in IMG/M
3300012349Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Sage2_R_115_16 metaGEnvironmentalOpen in IMG/M
3300012359Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_80_16 metaGEnvironmentalOpen in IMG/M
3300012490Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.4.old.040610Host-AssociatedOpen in IMG/M
3300012685Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz1.16 metaGEnvironmentalOpen in IMG/M
3300012897Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S074-202C-1EnvironmentalOpen in IMG/M
3300012930Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012985Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_246_MGEnvironmentalOpen in IMG/M
3300013296Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaGHost-AssociatedOpen in IMG/M
3300013297Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaGHost-AssociatedOpen in IMG/M
3300013306Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaGHost-AssociatedOpen in IMG/M
3300013307Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaGHost-AssociatedOpen in IMG/M
3300014325Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaGHost-AssociatedOpen in IMG/M
3300015261Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaGHost-AssociatedOpen in IMG/M
3300015262Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaGHost-AssociatedOpen in IMG/M
3300015264Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300015371Combined assembly of cpr5 and col0 rhizosphere and soilHost-AssociatedOpen in IMG/M
3300015372Soil combined assemblyHost-AssociatedOpen in IMG/M
3300015373Combined assembly of cpr5 rhizosphereHost-AssociatedOpen in IMG/M
3300015374Col-0 rhizosphere combined assemblyHost-AssociatedOpen in IMG/M
3300016319Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00HEnvironmentalOpen in IMG/M
3300016341Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170EnvironmentalOpen in IMG/M
3300016422Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111EnvironmentalOpen in IMG/M
3300017792Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaGHost-AssociatedOpen in IMG/M
3300018482Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118EnvironmentalOpen in IMG/M
3300019361Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S133-311R-2 (version 2)EnvironmentalOpen in IMG/M
3300019879Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2m2EnvironmentalOpen in IMG/M
3300019882Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H3a2EnvironmentalOpen in IMG/M
3300020002Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1a1EnvironmentalOpen in IMG/M
3300020004Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H1a2EnvironmentalOpen in IMG/M
3300020015Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1m1EnvironmentalOpen in IMG/M
3300025903Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025917Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025919Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025923Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025935Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025940Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025960Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025972Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026041Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300027873Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1 (SPAdes)Host-AssociatedOpen in IMG/M
3300027907Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes)Host-AssociatedOpen in IMG/M
3300028381Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300031538Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D1EnvironmentalOpen in IMG/M
3300031716Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YN3EnvironmentalOpen in IMG/M
3300033289Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN108EnvironmentalOpen in IMG/M
3300033475Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YCEnvironmentalOpen in IMG/M
3300034115Sediment microbial communities from East River floodplain, Colorado, United States - 29_s17EnvironmentalOpen in IMG/M
3300034150Sediment microbial communities from East River floodplain, Colorado, United States - 25_j17EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
22136255272209111006Arabidopsis RhizosphereMDRLDDEDIGVIWARHYPKRAERASSMSLCVTLTMIIKQRAKSADQY
F14TC_10020673343300000559SoilMDRLDDEDIGLIWARHYPKRDESESSKSLCVTLAMIIKHRAESIILPY
F14TB_10487790513300001431SoilMDRLDNEEIGIIWARHYPKRAENGSSKSLCLSLAMVIRLRARSMT
JGIcombinedJ43975_1003650713300002899SoilMDRLDDEDIGIIWERHYPKRVEHASSMSLCVTLTMIIKQRAKSADQYDPAKLDQVLASANRSKRTVRDSRE*
Ga0062593_10063390613300004114SoilMDRLDNEDIGIIWERHYSNRGQSASSMSLCVTLAMIIKQRAKSLDQYTDWSDKLHHAL
Ga0062590_10041618933300004157SoilHCGSEMDRLDDEDIGIIWGRHYSKRAEDASSMSLCVTLAMIIKQRAKTLDQYSD*
Ga0063356_10432896213300004463Arabidopsis Thaliana RhizosphereMDRLDEEDIGIIWARHYPKRTERESSMSLCVTLTMIIKQRAKSADNYDPAKLDQVL
Ga0062592_10001567073300004480SoilLQLAKSMDRLDNEDIGIIWERHYNNRGQSASSMSLCVTLAMIIKQRA
Ga0066677_1003828253300005171SoilMDRLDNEDIGIIWARHYPKRAESASSMSLCLTLAMIIRLRARSMTQYS
Ga0065716_100950513300005277Arabidopsis RhizosphereMDRLDDEDIGVIWARHYPKRAERASSMSLCVTLTMIIKQRAKSADQYDPAKLE
Ga0065707_1085873913300005295Switchgrass RhizosphereMDRLDDEDIGVIWARHYPKRAEHESSMSLCVTLTMIIKQRAKSADQYDRAKLDQVLA
Ga0070683_10166814713300005329Corn RhizosphereMDRLDEEDIGIIWARHYPKRTERESSMSLCVTLTMIIKQR
Ga0070668_10213434013300005347Switchgrass RhizosphereMDRLDDEDIGIIWARHYPKRAERASSMSLCVTLTMIIKQRAKS
Ga0070669_10025773953300005353Switchgrass RhizosphereMDRLDEEDIGIIWARHYPKRTERESSMSLCVTLTMIIKQRAKSADQY
Ga0070671_10128101923300005355Switchgrass RhizosphereMDRLDDEDIGIIWGRHYPKRAEDASSMSLCVTLAMIIKQRAKTLDQYSDWPA
Ga0070705_10120211613300005440Corn, Switchgrass And Miscanthus RhizosphereMDRLDDEDIGIIWGRHYSKRAEDASSMSLCVTLAMIIKQRAKTLDQYSDWPA
Ga0066682_1082147413300005450SoilMDRLDNEDIGILWARHYPKRAENGSSKSLCLSLAMVIRLR
Ga0070663_10028278313300005455Corn RhizosphereMDHRDDEDIGVIWARHYPKRAEHASSMSLCVTLAMIVKQSR*
Ga0070678_10194686123300005456Miscanthus RhizosphereMDHLDDEDIGIIWARHYPKRAEHASSMSLCVTLAMIVKQRAKSVDQYSDWPAKLEHALATAN
Ga0070662_10006786873300005457Corn RhizosphereMDRLDDEDIGVIWARHYPKRAERASSMSLCVTLTMIIKQRAKS
Ga0070662_10138635723300005457Corn RhizosphereMDHLDYEDIGIIWARHYPKRAEHASSMSLCVTLAMIVKQRAKSVDQYSDWP
Ga0068867_10210868613300005459Miscanthus RhizosphereMDRLDNEDIGMIWARHFPKRAESGSSRSLCLSLAMVLGCEPDP*
Ga0070672_10051736533300005543Miscanthus RhizosphereMDHRDDEDIGVIWARHYPKRAEHASSMSLCVTLAMIVKQ
Ga0066704_1049095113300005557SoilMDRLENEEIGMIWARHYPKRAESASSLSLCVTLALILKQRAKSVVHHKAWSD
Ga0068855_10171275023300005563Corn RhizosphereMDRLDNEDIGIIWERHYPKRVEHASSMSLCVTLTMIIKQRAKSADQYDPAKL
Ga0068855_10177454013300005563Corn RhizosphereMDHLDDEDIGIIWARHYPKRAEHASSMSLCVTLAMIVKQR
Ga0066691_1083143713300005586SoilMDRLENEDIGIIWARHYPKRAERASSMSLCLTLAMIIRLRARSMTQYSDWRDKL
Ga0070702_10140277323300005615Corn, Switchgrass And Miscanthus RhizosphereMDRLDDEDIGIIWGRHYPKRAEDASSMSLCVTLAMIIKQRAKTLDQYSDW
Ga0066903_10302693833300005764Tropical Forest SoilMDRLDDEDIGIIWGRHYPKRAEHASSMSLCVTLAMIVKQRAKSLDQYNDWPAKLEHA
Ga0066903_10389394723300005764Tropical Forest SoilMDRLDDEDIGIIWGRHYPKRAEHASSTSLCVTLAMIIKQRAKSLDQYNDWPAKLEHALAAAHV
Ga0068860_10083650223300005843Switchgrass RhizosphereMDHLDDEDIGIIWARHYPKRAEHASSMSLCVTLAMIVKQRAKSVDQYSDWPVKLEHALATANI
Ga0075417_1024809213300006049Populus RhizosphereMDRLDNEEIGILWARHYPKRAENGSSKSLCLSLAMVIRLR
Ga0097621_10164361513300006237Miscanthus RhizosphereMDRLDDEDIGIIWGRHYPKRAEDASSMSLCVTLAMIIKQRAK
Ga0075425_10053361333300006854Populus RhizosphereMDRLDDEDIGIIWGRHYPKRAEDASSMSLCVTLAMIIKQRAKTLDQYSDWPAK
Ga0075425_10085728033300006854Populus RhizosphereMDRLDNEDIGIIWERHYSNRGQSASSMSLCVTLAMIIKQRAKSVDQYTDWSDKLHHAL
Ga0075434_10020372653300006871Populus RhizosphereMHCGSEMDRLDDEDIGIIWGRHYSKRAEDASSMSLCVTLAMIIKQRAKTLDQYSDWPAK
Ga0075434_10052147923300006871Populus RhizosphereMDRLDNEDIGMIWARHFPKRAESGSSRSLCLSLAMVLRLRARSMTHQSDWSDKLE*
Ga0075424_10144787023300006904Populus RhizosphereMDRLDNEEIGIIWSRHYPKRAENGSSKSLCLSLAMVIRLRARSMTQQSDWSDKLEHILAD
Ga0075424_10152697513300006904Populus RhizosphereMDRLDNEDIGMIWARHFPKRAESGSSRSLCLSLAMVLRLRARSMTHQSDWSDKLE
Ga0075436_10054322713300006914Populus RhizosphereMDHLDYEDIGIIWARHYPKRAEHASSMSLCVTLAMIVKQR
Ga0075435_10169488513300007076Populus RhizosphereMDHRDDEDIGVIWARHYPKRAEHASSMSLCVTLAMIVKQRAKSVDQYSDWPAKLE
Ga0111539_1023649743300009094Populus RhizosphereMDRLDNEDIGIIWERHYSNRRQSASSMSLCVTLAMIIKQRAKSVDQYPDWSD
Ga0111539_1328147813300009094Populus RhizosphereMDRLDDEDIGIIWARHYPKRAERASSMSLCVTLTMIIKQRAKSADPYDEWPAKLDHALNMAH
Ga0114129_1242393723300009147Populus RhizosphereMDRLDDEDIGIIWERHYPKRVENASSMSLCVTLTLIIKQRAK
Ga0105243_1142812813300009148Miscanthus RhizosphereMDHRDDEDIGVIWARHYPKRAEHASSMSLCVTLAMIVKQRAKSVDQYSDWP
Ga0075423_1057863923300009162Populus RhizosphereMDRLDDEDIGVIWARHYPKRTERESSMSLCVTLTMIIKQRAKSADQYD
Ga0075423_1220264413300009162Populus RhizosphereMDRLDDEDIGIIWGRHYSKRAEHASSMSLCVTLAMIIKQ
Ga0105242_1128616023300009176Miscanthus RhizosphereMDHLDDEDIGIIWARHYPKRAEHASSMSLCVTLAMIVK
Ga0105249_1068260423300009553Switchgrass RhizosphereMDHLDYEDIGIIWARHYPKRAEHASSMSLCVTLAMIVKQSR*
Ga0105249_1080753423300009553Switchgrass RhizosphereMDRLDNEEIGIIWARHYPKRAENGSSKSLCLSLAMVIRL
Ga0105249_1091907213300009553Switchgrass RhizosphereMDRLDNEEIGIIWARHYPKRAESGSSRSLCLSLAMVLRLR
Ga0134128_1262414313300010373Terrestrial SoilMDRLDNEDIGMIWARHFPKRTESGSSRSLCLSLAMVLRLRARSMTHQSDWS
Ga0134126_1046239513300010396Terrestrial SoilMDHLDDEDSGIIWARHYPKRAEHASSMSLCVTLAMIVKQRGKSV
Ga0134127_1178091423300010399Terrestrial SoilMDRLDEEDIGIIWARHYPKRTERESSMSLCVTLTMIIKQRAKSADNYDPA
Ga0137364_1050809323300012198Vadose Zone SoilMDRLENEEIGMIWARHYPKRAESASSLSLCVTLALILKQRAKSVVHHKAWSDKLRHVLSAAR
Ga0137382_1033140913300012200Vadose Zone SoilMDRLENEDVGMIWARHYPKRAERASSMSLCLTLAMIIRLRARSMTQYSDW
Ga0137363_1074156213300012202Vadose Zone SoilMDRLQNEDIGIIWARHYPKRAESASSMSLCVTLAMI
Ga0137378_1042314323300012210Vadose Zone SoilMDRLENEEIGMIWARHYPKRAESASSLSLCVTLALILKQRAKSVVHHKAWS
Ga0137387_1073196913300012349Vadose Zone SoilMDRLENEDVGMIWARHYLKRAERASSMSLCLTLAMIIRLRARSMTQYSDWRDKLQHVL
Ga0137385_1040822613300012359Vadose Zone SoilMDRLENEEIGMIWARHYPKRAESASSLSLCVTLALILKQRAKSVV
Ga0157322_100179713300012490Arabidopsis RhizosphereMDRLDNEEIGIIWARHYPKRAENGSSKSLCLSLAMVIRLRARSMTQQSDW
Ga0137397_1084454023300012685Vadose Zone SoilMDRLDNEGIGMIWARHFPKRAENGSSKSLCLSLAMVIR
Ga0157285_1031303023300012897SoilMDRLDDEDIGIIWERHYPKRTERESSMSLCVTLTMIIKQRAKSADNYNPAKLDQVLA
Ga0137407_1206726613300012930Vadose Zone SoilMDRLDNEDIGLSWARHYPKRSESQSSKSLCVTLAMIIKQRAES
Ga0164308_1141645513300012985SoilMDRLDDEDIGITWARHYPKCAERASSMSLCVTLTMIIK*
Ga0157374_1049823233300013296Miscanthus RhizosphereMDRLDDEDIGIIWARHYPKRAERASSMSLCVTLTMIIKQRAKSADPYDEWP
Ga0157378_1101722423300013297Miscanthus RhizosphereMDRLDNEDIGIIWERHYPKRVEHASSMSLCVTLTMIIKQRAKSADQYDPA
Ga0157378_1331349913300013297Miscanthus RhizosphereDHRDDEDIGVIWARHYPKRAEHASSMSLCVTLAMIVKQSR*
Ga0163162_1116583023300013306Switchgrass RhizosphereMDRLDNEEIGIIWARHYPKRAESGSSRSLCLSLAIVLRL
Ga0157372_1046658613300013307Corn RhizosphereMDHLDDEDIGIIWARHYPKRAEHASSMSLCVTLAMIVKQRAKS
Ga0163163_1192652113300014325Switchgrass RhizosphereMDRLDNEDIGIIWERHYPKRVEHASSMSLCVTLTMIIKQRAKSADQYDAAKLGQ
Ga0182006_129830213300015261RhizosphereMDRLDDEDIGIIWERHDPKRVEHASSMSLCVTLTMIIKQRAKSADQYDP
Ga0182007_1033258013300015262RhizosphereMDRLDDEDIGIIWERHYPKRVEHASSMSLCVTLTMIIMDRAKSAV*
Ga0137403_1137531513300015264Vadose Zone SoilMDRLDNEEIGIIWARHYPKRAENGSSKSLCLSLAMVIRLRARSMTQQSDWSDK
Ga0132258_1061870623300015371Arabidopsis RhizosphereMDRLDDADIGIIWERHYPKRAESGSSMSLCITLTMIIKQRTKLVNQYEAWSLN*
Ga0132258_1071912453300015371Arabidopsis RhizosphereMDRLDDEDIGFIWARHYSKRAGQASSMSLCITLAMIIKQRAKSLHQYNGWVSKLE
Ga0132258_1157586733300015371Arabidopsis RhizosphereMDRLDDEDIGIIWARHYPKRAEQASSMSLCVTLTMIIKQRAKSADQYDPAKLE
Ga0132258_1370945943300015371Arabidopsis RhizosphereMDRLDDEDIGVIWARHYPKRAERASSMSLCVTLTMII
Ga0132256_10217174123300015372Arabidopsis RhizosphereMDRLDDEDIGFIWARHYPKRAEQASTMSLCVTLAMIIKQRAK
Ga0132257_10047205613300015373Arabidopsis RhizosphereMDRLDDEDIGFIWARHYSKRAGQVSSMSLCITLAMIIKQRAKSLHQYN
Ga0132255_10003660753300015374Arabidopsis RhizosphereMDRLDDEDIGIIWARHYPKRTERQSSMSLCVTHTMIIKQRAKSADQYDPVN*
Ga0132255_10159450423300015374Arabidopsis RhizosphereMDRLDDEDIGVIWARHYPKRTERESSMSLCVTLTMIIKQRAKSADQYDPAKLDQVLA
Ga0132255_10192730213300015374Arabidopsis RhizosphereMDRLDNEEIGIIWARHYPKRAESGSSRSLCLSLAIVLRLRARSMTHQSDWSDKLEQILAD
Ga0132255_10195895813300015374Arabidopsis RhizosphereMDRLDDEDIGIIWARHYPKRAERASSMSLCVTLTMIIKQRAKSADQYDPAKLEHA
Ga0182033_1051232033300016319SoilMDRLDDEDIGIIWGRHYPKRAEHSSSTSLCVTLAMIIKQRAKSLDQYNDWPAKLE
Ga0182035_1055851213300016341SoilMDRLDDEDIGIIWGRHYPKRAEHASSTSLCVTLAMIIKQRAKSLDQYNDWPAKLEHALA
Ga0182039_1103619023300016422SoilMDRLDDEDIGIIWGRHYPKRAERASSTSLCVTLAMISKQRAKSRDQYNDWPAKLEHALAD
Ga0163161_1027020023300017792Switchgrass RhizosphereMDHLDDEDIGIIWARHYPKRAEHASSMSLCVTLAMIVKQSR
Ga0163161_1041186923300017792Switchgrass RhizosphereMDRLDNEEIGIIWARHYPKRAESGSSRSLCLSLAIVLRLRARSMTHQSDWSDKLE
Ga0066669_1173941723300018482Grasslands SoilMDRLDNEDIGILWARHYPKRAENGSSKSLCLSLAMV
Ga0173482_1079140223300019361SoilMDRLDEEDIGIIWARHYPKRTERESSMSLCVTLTMIIKQRAKSADNYDPAKLDQVLASA
Ga0193723_102913613300019879SoilMDRLDNEDIGMIWARHYPKRAERASSMSLCLTLAMIIRLRARSMTQY
Ga0193713_105534113300019882SoilMDRLDNEGIGMIWARHFPKRAKNGSSKSLCVSLAIVIRL
Ga0193730_115684513300020002SoilMDRLENEEIGMIWARHYPKRAESASSMSLCVTLAMIIKQRAKSVLEYNACSDKLRHVL
Ga0193755_108072913300020004SoilMDRLENEEIGMIWARHYPKRAESASSLSLCVTLALILKQRAKSVVH
Ga0193734_106776013300020015SoilMDRLDNEDIGMIWARHYPKRAERASSMSLCLTLAMIIRLRARSMTQYSDWRDKLQHVL
Ga0207680_1128554123300025903Switchgrass RhizosphereMDRLDNEDIGIIWERHYSNRGQSASSMSLCVTLAMIIKQRAKSVDQYTDWSDKLHHALA
Ga0207660_1041060133300025917Corn RhizosphereMDRLDEEDIGIIWARHYPKRTERESSMSLCVTLTMIIKQRAKSADNYDPAKLD
Ga0207657_1007861673300025919Corn RhizosphereMDRLDDEDIGIIWERHYPKRTERESSMSLCVTLTMIIK
Ga0207681_1124745713300025923Switchgrass RhizosphereMDHLDDEDIGIIWARHYPKRAEHASSMSLCVTLAMIVKQRAKSVDQYSDWPVKLEHALAT
Ga0207709_1184044923300025935Miscanthus RhizosphereMDRLDNEDIGMIWARHYPKRAESGSSRSLCLSLAIVLRLRARSMTHQSDWSDKL
Ga0207691_1018741443300025940Miscanthus RhizosphereMDHRDDEDIGVIWARHYPKRAEHASSMSLCVTLAMIVKQSR
Ga0207651_1022531043300025960Switchgrass RhizosphereMDRLDNEDIGIIWERHYPKRVEHASSRSLCVTLTMIIKQRAKLADQYDP
Ga0207668_1079578113300025972Switchgrass RhizosphereMDRLDNEEIGIIWARHYPKRAENGSSKSLCLSLAMVIR
Ga0207639_1016041243300026041Corn RhizosphereMDHRDDEDIGVIWARHYPKRAEHASSMSLCVTLAMIVKQRAKSVDQYSDWPVKLEHALATAN
Ga0209814_1007360333300027873Populus RhizosphereMDRLDNEDIGLIWARHYPKRDESQSSKSLCVTLAMIIKH
Ga0207428_1081112523300027907Populus RhizosphereHRDDEDIGVIWARHYPKRAEHASSMSLCVTLAMIVKQSR
Ga0268264_1263492323300028381Switchgrass RhizosphereMDRLDNEDIGIIWERHYNNRGQSASSMSLCVTLAMIIKQRAKSVDQYTDWSDKLHHALA
Ga0310888_1051522823300031538SoilMDRLDNEEIGIIWARHYPKRAENGSSKSLCLSLAMVIRLRARSMTQQSDWSNKLEHIL
Ga0310813_1017116023300031716SoilMDRLDNEDIGIIWERHYNNRGQSASSMSLCVTLAMIIKQRAKSVDQYTDWSDKLHHALAA
Ga0310914_1188528113300033289SoilMDRLDDEDIGIIWARHYPKRAERTSSMSLCVTLAMIIKQRAKSIDQYND
Ga0310811_1022186813300033475SoilMDRLDEEDIGIIWARHYPKRTERESSMSLCVTLTMII
Ga0364945_0112640_1_1293300034115SedimentMDRLDNEEIGIIWARHYPKRAENGSSKSLCLSLAMVIRLRARS
Ga0364933_066390_773_8983300034150SedimentMDRLDNEEIGIIWARHYPKRAENGSSKSLCLSLAMVIRLRAR


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.