Basic Information | |
---|---|
Family ID | F081722 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 114 |
Average Sequence Length | 47 residues |
Representative Sequence | VNLLVLDESLDLAVVVGRIAPVRGWEPHFVGSLHELELAVQAHGRPA |
Number of Associated Samples | 105 |
Number of Associated Scaffolds | 114 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 100.00 % |
% of genes near scaffold ends (potentially truncated) | 99.12 % |
% of genes from short scaffolds (< 2000 bps) | 78.95 % |
Associated GOLD sequencing projects | 102 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.54 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (97.368 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere (13.158 % of family members) |
Environment Ontology (ENVO) | Unclassified (26.316 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (39.474 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 32.00% β-sheet: 16.00% Coil/Unstructured: 52.00% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.54 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 114 Family Scaffolds |
---|---|---|
PF00990 | GGDEF | 63.16 |
PF02954 | HTH_8 | 23.68 |
PF00072 | Response_reg | 3.51 |
PF00550 | PP-binding | 0.88 |
PF07589 | PEP-CTERM | 0.88 |
PF13378 | MR_MLE_C | 0.88 |
PF00534 | Glycos_transf_1 | 0.88 |
PF00440 | TetR_N | 0.88 |
PF02621 | VitK2_biosynth | 0.88 |
PF02522 | Antibiotic_NAT | 0.88 |
PF00528 | BPD_transp_1 | 0.88 |
PF08543 | Phos_pyr_kin | 0.88 |
COG ID | Name | Functional Category | % Frequency in 114 Family Scaffolds |
---|---|---|---|
COG0351 | Hydroxymethylpyrimidine/phosphomethylpyrimidine kinase | Coenzyme transport and metabolism [H] | 0.88 |
COG0524 | Sugar or nucleoside kinase, ribokinase family | Carbohydrate transport and metabolism [G] | 0.88 |
COG1427 | Chorismate dehydratase (menaquinone biosynthesis, futalosine pathway) | Coenzyme transport and metabolism [H] | 0.88 |
COG2240 | Pyridoxal/pyridoxine/pyridoxamine kinase | Coenzyme transport and metabolism [H] | 0.88 |
COG2746 | Aminoglycoside N3'-acetyltransferase | Defense mechanisms [V] | 0.88 |
COG2870 | ADP-heptose synthase, bifunctional sugar kinase/adenylyltransferase | Cell wall/membrane/envelope biogenesis [M] | 0.88 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 97.37 % |
Unclassified | root | N/A | 2.63 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
2088090015|GPICI_8704747 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1168 | Open in IMG/M |
2228664021|ICCgaii200_c0987174 | All Organisms → cellular organisms → Bacteria | 2630 | Open in IMG/M |
2228664021|ICCgaii200_c0987922 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1205 | Open in IMG/M |
3300000881|JGI10215J12807_1096054 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 6074 | Open in IMG/M |
3300000956|JGI10216J12902_106024269 | Not Available | 572 | Open in IMG/M |
3300001139|JGI10220J13317_10727531 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 857 | Open in IMG/M |
3300002245|JGIcombinedJ26739_100213746 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 1821 | Open in IMG/M |
3300002245|JGIcombinedJ26739_100595088 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 983 | Open in IMG/M |
3300003371|JGI26145J50221_1015092 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 712 | Open in IMG/M |
3300003505|JGIcombinedJ51221_10141958 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 968 | Open in IMG/M |
3300004463|Ga0063356_101727506 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 937 | Open in IMG/M |
3300004479|Ga0062595_100512651 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 905 | Open in IMG/M |
3300005289|Ga0065704_10195370 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1170 | Open in IMG/M |
3300005341|Ga0070691_10004764 | All Organisms → cellular organisms → Bacteria | 6173 | Open in IMG/M |
3300005345|Ga0070692_10111380 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1514 | Open in IMG/M |
3300005355|Ga0070671_100655844 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 909 | Open in IMG/M |
3300005434|Ga0070709_11286673 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 589 | Open in IMG/M |
3300005440|Ga0070705_101030245 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 670 | Open in IMG/M |
3300005445|Ga0070708_101242284 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 696 | Open in IMG/M |
3300005468|Ga0070707_100024844 | All Organisms → cellular organisms → Bacteria | 5679 | Open in IMG/M |
3300005468|Ga0070707_101160627 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 738 | Open in IMG/M |
3300005468|Ga0070707_102150597 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 525 | Open in IMG/M |
3300005536|Ga0070697_100089417 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 2544 | Open in IMG/M |
3300005536|Ga0070697_100197137 | All Organisms → cellular organisms → Bacteria | 1711 | Open in IMG/M |
3300005539|Ga0068853_100410134 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1269 | Open in IMG/M |
3300005545|Ga0070695_100023392 | All Organisms → cellular organisms → Bacteria | 3796 | Open in IMG/M |
3300005764|Ga0066903_103140043 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 894 | Open in IMG/M |
3300005875|Ga0075293_1006884 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 1217 | Open in IMG/M |
3300005875|Ga0075293_1019461 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 851 | Open in IMG/M |
3300005886|Ga0075286_1072330 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 507 | Open in IMG/M |
3300006050|Ga0075028_100195213 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 1090 | Open in IMG/M |
3300006172|Ga0075018_10095363 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 1312 | Open in IMG/M |
3300006175|Ga0070712_100523527 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 996 | Open in IMG/M |
3300006755|Ga0079222_10140964 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 1352 | Open in IMG/M |
3300009093|Ga0105240_10679487 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 1126 | Open in IMG/M |
3300009821|Ga0105064_1043327 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 859 | Open in IMG/M |
3300010362|Ga0126377_10533127 | All Organisms → cellular organisms → Bacteria | 1210 | Open in IMG/M |
3300010362|Ga0126377_10819915 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 990 | Open in IMG/M |
3300010400|Ga0134122_11577659 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 679 | Open in IMG/M |
3300011271|Ga0137393_10175726 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 1799 | Open in IMG/M |
3300012133|Ga0137329_1036769 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 627 | Open in IMG/M |
3300012203|Ga0137399_10839999 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 773 | Open in IMG/M |
3300012205|Ga0137362_10299050 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 1393 | Open in IMG/M |
3300012210|Ga0137378_10440426 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 1207 | Open in IMG/M |
3300012902|Ga0157291_10027984 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1188 | Open in IMG/M |
3300012927|Ga0137416_10426844 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 1128 | Open in IMG/M |
3300012931|Ga0153915_12281931 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 633 | Open in IMG/M |
3300012948|Ga0126375_10598930 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 841 | Open in IMG/M |
3300012958|Ga0164299_10012315 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 3242 | Open in IMG/M |
3300012961|Ga0164302_10537407 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 834 | Open in IMG/M |
3300013100|Ga0157373_10671760 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 758 | Open in IMG/M |
3300013102|Ga0157371_10174240 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1538 | Open in IMG/M |
3300014321|Ga0075353_1233531 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 506 | Open in IMG/M |
3300015372|Ga0132256_101697936 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 741 | Open in IMG/M |
3300017973|Ga0187780_10048924 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 2936 | Open in IMG/M |
3300018032|Ga0187788_10282051 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 668 | Open in IMG/M |
3300018051|Ga0184620_10160684 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 731 | Open in IMG/M |
3300018075|Ga0184632_10237098 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 799 | Open in IMG/M |
3300018078|Ga0184612_10018811 | All Organisms → cellular organisms → Bacteria | 3539 | Open in IMG/M |
3300018078|Ga0184612_10392155 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 698 | Open in IMG/M |
3300018422|Ga0190265_11133183 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 902 | Open in IMG/M |
3300018429|Ga0190272_12952808 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 526 | Open in IMG/M |
3300019879|Ga0193723_1038811 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 1419 | Open in IMG/M |
3300019881|Ga0193707_1011991 | All Organisms → cellular organisms → Bacteria | 2933 | Open in IMG/M |
3300019887|Ga0193729_1100718 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 1100 | Open in IMG/M |
3300020579|Ga0210407_10214921 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1495 | Open in IMG/M |
3300020580|Ga0210403_10756084 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 775 | Open in IMG/M |
3300020581|Ga0210399_10420443 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1114 | Open in IMG/M |
3300021080|Ga0210382_10077586 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 1355 | Open in IMG/M |
3300021088|Ga0210404_10047158 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2010 | Open in IMG/M |
3300021560|Ga0126371_12730906 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 599 | Open in IMG/M |
3300022726|Ga0242654_10196858 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 699 | Open in IMG/M |
3300023266|Ga0247789_1139862 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 503 | Open in IMG/M |
3300025885|Ga0207653_10008421 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 3211 | Open in IMG/M |
3300025885|Ga0207653_10329585 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 594 | Open in IMG/M |
3300025901|Ga0207688_10056182 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 2211 | Open in IMG/M |
3300025910|Ga0207684_10380977 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 1213 | Open in IMG/M |
3300025911|Ga0207654_10036111 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 2759 | Open in IMG/M |
3300025917|Ga0207660_11045360 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 666 | Open in IMG/M |
3300025919|Ga0207657_10000591 | All Organisms → cellular organisms → Bacteria | 38405 | Open in IMG/M |
3300025920|Ga0207649_10938091 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 679 | Open in IMG/M |
3300025981|Ga0207640_10295415 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 1279 | Open in IMG/M |
3300026001|Ga0208000_103103 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 916 | Open in IMG/M |
3300026351|Ga0257170_1007914 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 1282 | Open in IMG/M |
3300026377|Ga0257171_1004005 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 2256 | Open in IMG/M |
3300026490|Ga0257153_1015762 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 1533 | Open in IMG/M |
3300026498|Ga0257156_1000644 | All Organisms → cellular organisms → Bacteria | 6117 | Open in IMG/M |
3300026499|Ga0257181_1031906 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 829 | Open in IMG/M |
3300026514|Ga0257168_1020830 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 1353 | Open in IMG/M |
3300026551|Ga0209648_10833741 | Not Available | 504 | Open in IMG/M |
3300027471|Ga0209995_1003696 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2440 | Open in IMG/M |
3300027526|Ga0209968_1000494 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 6251 | Open in IMG/M |
3300027543|Ga0209999_1026531 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1071 | Open in IMG/M |
3300027552|Ga0209982_1017975 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1080 | Open in IMG/M |
3300027605|Ga0209329_1071472 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 749 | Open in IMG/M |
3300027717|Ga0209998_10105573 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 701 | Open in IMG/M |
3300027862|Ga0209701_10545213 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 624 | Open in IMG/M |
3300027876|Ga0209974_10000082 | All Organisms → cellular organisms → Bacteria | 26095 | Open in IMG/M |
3300027894|Ga0209068_10068498 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 1829 | Open in IMG/M |
3300028047|Ga0209526_10040394 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 3281 | Open in IMG/M |
3300028792|Ga0307504_10207631 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 697 | Open in IMG/M |
(restricted) 3300031150|Ga0255311_1130073 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 554 | Open in IMG/M |
3300031421|Ga0308194_10171039 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 684 | Open in IMG/M |
3300031720|Ga0307469_10232223 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 1468 | Open in IMG/M |
3300031740|Ga0307468_100037488 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 2394 | Open in IMG/M |
3300031820|Ga0307473_10448352 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 858 | Open in IMG/M |
3300031962|Ga0307479_10969533 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 820 | Open in IMG/M |
3300032205|Ga0307472_100943921 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 803 | Open in IMG/M |
3300032829|Ga0335070_11229333 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 687 | Open in IMG/M |
3300033433|Ga0326726_10339744 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 1415 | Open in IMG/M |
3300033501|Ga0326732_1005354 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 2492 | Open in IMG/M |
3300033513|Ga0316628_100324199 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 1926 | Open in IMG/M |
3300034090|Ga0326723_0287752 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 736 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 13.16% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 9.65% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 8.77% |
Arabidopsis Thaliana Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere | 7.02% |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 5.26% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 5.26% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 4.39% |
Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 4.39% |
Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 3.51% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 3.51% |
Rice Paddy Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil | 3.51% |
Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 2.63% |
Peat Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil | 2.63% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 1.75% |
Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 1.75% |
Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 1.75% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 1.75% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 1.75% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 1.75% |
Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 0.88% |
Freshwater Wetlands | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands | 0.88% |
Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 0.88% |
Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.88% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.88% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.88% |
Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.88% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 0.88% |
Natural And Restored Wetlands | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands | 0.88% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 0.88% |
Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 0.88% |
Groundwater Sand | Environmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand | 0.88% |
Sandy Soil | Environmental → Terrestrial → Soil → Sand → Unclassified → Sandy Soil | 0.88% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.88% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.88% |
Corn, Switchgrass And Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 0.88% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 0.88% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 0.88% |
Visualization |
---|
Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
2088090015 | Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil | Environmental | Open in IMG/M |
2228664021 | Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil | Environmental | Open in IMG/M |
3300000881 | Soil microbial communities from Great Prairies - Wisconsin Restored Prairie soil | Environmental | Open in IMG/M |
3300000956 | Soil microbial communities from Great Prairies - Kansas, Native Prairie soil | Environmental | Open in IMG/M |
3300001139 | Soil microbial communities from Great Prairies - Wisconsin, Switchgrass soil | Environmental | Open in IMG/M |
3300002245 | Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027) | Environmental | Open in IMG/M |
3300003371 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM | Host-Associated | Open in IMG/M |
3300003505 | Forest soil microbial communities from Harvard Forest LTER, USA - Combined assembly of forest soil metaG samples (ASSEMBLY_DATE=20140924) | Environmental | Open in IMG/M |
3300004463 | Combined assembly of Arabidopsis thaliana microbial communities | Host-Associated | Open in IMG/M |
3300004479 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAs | Environmental | Open in IMG/M |
3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 | Host-Associated | Open in IMG/M |
3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 | Host-Associated | Open in IMG/M |
3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Environmental | Open in IMG/M |
3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Environmental | Open in IMG/M |
3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Host-Associated | Open in IMG/M |
3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Environmental | Open in IMG/M |
3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Environmental | Open in IMG/M |
3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Environmental | Open in IMG/M |
3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Environmental | Open in IMG/M |
3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Environmental | Open in IMG/M |
3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Host-Associated | Open in IMG/M |
3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Environmental | Open in IMG/M |
3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
3300005875 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_25C_0N_101 | Environmental | Open in IMG/M |
3300005886 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_20C_0N_205 | Environmental | Open in IMG/M |
3300006050 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2014 | Environmental | Open in IMG/M |
3300006172 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2014 | Environmental | Open in IMG/M |
3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Environmental | Open in IMG/M |
3300006755 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter | Environmental | Open in IMG/M |
3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Host-Associated | Open in IMG/M |
3300009821 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S1_20_30 | Environmental | Open in IMG/M |
3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
3300010400 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2 | Environmental | Open in IMG/M |
3300011271 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaG | Environmental | Open in IMG/M |
3300012133 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT121_2 | Environmental | Open in IMG/M |
3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
3300012205 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG | Environmental | Open in IMG/M |
3300012210 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaG | Environmental | Open in IMG/M |
3300012902 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S169-409C-1 | Environmental | Open in IMG/M |
3300012927 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012931 | Freshwater wetland microbial communities from Ohio, USA - Open water 3 Core 3 Depth 3 metaG | Environmental | Open in IMG/M |
3300012948 | Tropical forest soil microbial communities from Panama - MetaG Plot_14 | Environmental | Open in IMG/M |
3300012958 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_221_MG | Environmental | Open in IMG/M |
3300012961 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_202_MG | Environmental | Open in IMG/M |
3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Host-Associated | Open in IMG/M |
3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Host-Associated | Open in IMG/M |
3300014321 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Sandmound_TuleB_D1 | Environmental | Open in IMG/M |
3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
3300017973 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_20_MG | Environmental | Open in IMG/M |
3300018032 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_BV01_MP10_20_MG | Environmental | Open in IMG/M |
3300018051 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_5_b1 | Environmental | Open in IMG/M |
3300018075 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_50_b1 | Environmental | Open in IMG/M |
3300018078 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_60_coex | Environmental | Open in IMG/M |
3300018422 | Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 124 T | Environmental | Open in IMG/M |
3300018429 | Populus adjacent soil microbial communities from riparian zone of Shoshone River, Wyoming, USA - 504 T | Environmental | Open in IMG/M |
3300019879 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2m2 | Environmental | Open in IMG/M |
3300019881 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U3c2 | Environmental | Open in IMG/M |
3300019887 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1c2 | Environmental | Open in IMG/M |
3300020579 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-M | Environmental | Open in IMG/M |
3300020580 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-M | Environmental | Open in IMG/M |
3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
3300021080 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_60_coex redo | Environmental | Open in IMG/M |
3300021088 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-M | Environmental | Open in IMG/M |
3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
3300022726 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-30-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300023266 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S220-509R-4 | Environmental | Open in IMG/M |
3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) | Host-Associated | Open in IMG/M |
3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) | Environmental | Open in IMG/M |
3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026001 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_25C_80N_104 (SPAdes) | Environmental | Open in IMG/M |
3300026351 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DW-05-B | Environmental | Open in IMG/M |
3300026377 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DW-10-B | Environmental | Open in IMG/M |
3300026490 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DW-10-A | Environmental | Open in IMG/M |
3300026498 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NI-49-A | Environmental | Open in IMG/M |
3300026499 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NR-06-B | Environmental | Open in IMG/M |
3300026514 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DL-13-B | Environmental | Open in IMG/M |
3300026551 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cm (SPAdes) | Environmental | Open in IMG/M |
3300027471 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) | Host-Associated | Open in IMG/M |
3300027526 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) | Host-Associated | Open in IMG/M |
3300027543 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) | Host-Associated | Open in IMG/M |
3300027552 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) | Host-Associated | Open in IMG/M |
3300027605 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_M3 (SPAdes) | Environmental | Open in IMG/M |
3300027717 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) | Host-Associated | Open in IMG/M |
3300027862 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG (SPAdes) | Environmental | Open in IMG/M |
3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) | Host-Associated | Open in IMG/M |
3300027894 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2012 (SPAdes) | Environmental | Open in IMG/M |
3300028047 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M1 (SPAdes) | Environmental | Open in IMG/M |
3300028792 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 19_S | Environmental | Open in IMG/M |
3300031150 (restricted) | Sandy soil microbial communities from University of British Columbia, Vancouver, Canada - EtOH4_T0_E4 | Environmental | Open in IMG/M |
3300031421 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_195 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
3300031740 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05 | Environmental | Open in IMG/M |
3300031820 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515 | Environmental | Open in IMG/M |
3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
3300032829 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.3 | Environmental | Open in IMG/M |
3300033433 | Lab enriched peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF15MN | Environmental | Open in IMG/M |
3300033501 | Lab enriched peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF12FN SIP fraction | Environmental | Open in IMG/M |
3300033513 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M2_C1_D5_C | Environmental | Open in IMG/M |
3300034090 | Peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF00N | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
Protein ID | Sample Taxon ID | Habitat | Sequence |
GPICI_02491190 | 2088090015 | Soil | VNLLVLDESLDLAMVIGRLAPARGWEPHFVGSLHELEVAVAAQGRPALTVVNL |
ICCgaii200_09871744 | 2228664021 | Soil | VNVLVLDETMELAVPIRGLAGISGWEPHFVGSLHELEVAVAAQGRPALTVV |
ICCgaii200_09879223 | 2228664021 | Soil | VNLLVLDESLDLAMVIGRLAPARGWEPHFVGSLHELE |
JGI10215J12807_10960541 | 3300000881 | Soil | MNLLVLDESLELALLIGRIAPLRGWQPHFIGSLHEMELA |
JGI10216J12902_1060242691 | 3300000956 | Soil | VNLLVLDESLEFAVLIARLAPVRGWQSHFVGSLHELELTVRAQGRPGLTVVNLQAPLTA |
JGI10220J13317_107275312 | 3300001139 | Soil | VNLLVLDESLDLAMVIGRLAPARGWEPHFVGSLHELEVAV |
JGIcombinedJ26739_1002137461 | 3300002245 | Forest Soil | VNLLVLDESLDLAMVVGRIAPVRGWEPHFVGSLHELEQAVQAHGRP |
JGIcombinedJ26739_1005950881 | 3300002245 | Forest Soil | VNLLVLDESLELAMVVGRIAPVRGWEPHFVGSLHELELAVQAHGRPALTVVNLQPPLTA |
JGI26145J50221_10150921 | 3300003371 | Arabidopsis Thaliana Rhizosphere | MNLLVLDESLELALLIGRIAPLRGWQPHFIGSLHEMELAVQAHGRPALTVVNL |
JGIcombinedJ51221_101419581 | 3300003505 | Forest Soil | VNLLVLDESLELAVNIRNLALLRGWQPRFVGSLHELELAVGAQGRPG |
Ga0063356_1017275061 | 3300004463 | Arabidopsis Thaliana Rhizosphere | VNLLVLDESLDLAMVIGRLAPARGWEPHFVGSLHELEVAVAAQ |
Ga0062595_1005126511 | 3300004479 | Soil | VNLLVLDESLELAMVVGRMAPVRGWEPHFVGSLHELELAVQAHGRPALTVVN |
Ga0065704_101953703 | 3300005289 | Switchgrass Rhizosphere | VNVLVLDESLELAGVVGRLAPLRGWQAHFLGSLLELELGIRAYGRPELVIVNLQA |
Ga0065715_107187561 | 3300005293 | Miscanthus Rhizosphere | VNVLVLDETMELAVPIRGLAGISGWEPHFVGSLHELEVAVAAQG |
Ga0070691_100047641 | 3300005341 | Corn, Switchgrass And Miscanthus Rhizosphere | VNLLVLDESLDLAMVIGRLAPARGWEPHFVGSLHELEVAVAAQGRPALTVV |
Ga0070692_101113803 | 3300005345 | Corn, Switchgrass And Miscanthus Rhizosphere | VNVLVLDESLDLAGVVGRLAPLRGWEPHFLGSLLELELGVRTYGRPGLVIVNLQAPLT |
Ga0070671_1006558441 | 3300005355 | Switchgrass Rhizosphere | VNLLVLDESLDLAMVIGRLAPARGWEPHFVGSLHELEVAVAAQG |
Ga0070709_112866731 | 3300005434 | Corn, Switchgrass And Miscanthus Rhizosphere | VNLLVLDESLELAMVVGRMAPVRGWEPHFVGSLHELELAVQAHGRPALTVVNLQP |
Ga0070705_1010302452 | 3300005440 | Corn, Switchgrass And Miscanthus Rhizosphere | VNLLVLDESLELAMVVGRMAPVRGWEPHFVGSLHELELAVQAHGR |
Ga0070708_1012422842 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | VNLLVLDESLELAVLIGRLAPLRGWQPHFVGSLHEVELAVQ |
Ga0070707_1000248448 | 3300005468 | Corn, Switchgrass And Miscanthus Rhizosphere | VNLLVLDESLDLAVVVGRIAPVRGWEPHFVGSLHELEQAVQAHGRPALTVV |
Ga0070707_1011606271 | 3300005468 | Corn, Switchgrass And Miscanthus Rhizosphere | VNLLVLDESLDLAVVVRRIAPVRGWEPHFVGSLHELEQAVQAHGRPALTVVNLQ |
Ga0070707_1021505971 | 3300005468 | Corn, Switchgrass And Miscanthus Rhizosphere | VNLLVLDESLELAVLIGRLAPLRGWQPHFVGSLHEVELAVQAHGRPALLVVNLQPPLTGW |
Ga0070697_1000894173 | 3300005536 | Corn, Switchgrass And Miscanthus Rhizosphere | VNLLVLDESLDLAVVVGRLAPVRGWEPHFVGSLHELELAVQAHGRPALT |
Ga0070697_1001971371 | 3300005536 | Corn, Switchgrass And Miscanthus Rhizosphere | VNLLVLDESLDLAMVIGRLAPARGWQPHFVGSLHELEVAVAAQGRPALTVVN |
Ga0068853_1004101343 | 3300005539 | Corn Rhizosphere | MNLLVLDESLELALLIGRIAPLNGWQPHFIGSLHEMELAV |
Ga0070695_1000233921 | 3300005545 | Corn, Switchgrass And Miscanthus Rhizosphere | MNLLVLDESLELALLIGRIAPLRGWQPHFIGSLHEMELAVQAHGRPALTVVN |
Ga0066903_1031400431 | 3300005764 | Tropical Forest Soil | MNLLVLDESLELALLIGRIAPLRGWQPHFIGSLHEMELAVQAHG |
Ga0075293_10068841 | 3300005875 | Rice Paddy Soil | MNLLVLDESLELAVMLGRLAPGRGWRPHFVGSLHELELA |
Ga0075293_10194611 | 3300005875 | Rice Paddy Soil | VNLLVLDESLDLAVVVGRLAPVRGWEPHFVGSLHELELAVQAHGRPALTVV |
Ga0075286_10723302 | 3300005886 | Rice Paddy Soil | VNLLVLDESLDLAVVVGRIAPVRGWEPHFVGSLHELELAVQAHGRPA |
Ga0075028_1001952131 | 3300006050 | Watersheds | VNLLVLDESLDLAIVVGRIAPVRGWEPHFVGSLHELEQAV |
Ga0075018_100953631 | 3300006172 | Watersheds | VNLLVLDESLDLAIVVGRIAPVRGWEPHFVGSLHELEQAVQA |
Ga0070712_1005235272 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | VNLLVLDESLELAMVVGRMAPVRGWEPHFVGSLHELELAVQ |
Ga0079222_101409643 | 3300006755 | Agricultural Soil | VNLLVLDESLDLAMVIGRLAPARGWQPHFVGSLHELEVAVAA |
Ga0105240_106794873 | 3300009093 | Corn Rhizosphere | VNLLVLDESLDLAMVIGRLAPARGWEPHFVGSLHELEVAVAA |
Ga0105064_10433271 | 3300009821 | Groundwater Sand | VNLLVLDESLELAVLIGRLAPLRGWQPHFVGSLHEVELAVQAHGRPALLV |
Ga0126377_105331271 | 3300010362 | Tropical Forest Soil | MNLLVLDESLELALSIGRSFSLRGWQPRFVGSLHELELAVQAHGRPA |
Ga0126377_108199153 | 3300010362 | Tropical Forest Soil | MNLLVLDESLELALLIGRIAPLRGWQPHFIGSLHEMELAVQAHGR |
Ga0134122_115776592 | 3300010400 | Terrestrial Soil | VNLLVLDESLDLAMVVGRIAPVRGWEPHFVGSLHELEQAVQAHGRPA |
Ga0137393_101757263 | 3300011271 | Vadose Zone Soil | VNVLVLDESLELAGVVGRLAPLRGWQPHFIGSLHELELGFRAYGRPAL |
Ga0137329_10367692 | 3300012133 | Soil | MNVLVLDESLELAGVVGRLAPLRGWQPHFLGSLLELEL |
Ga0137399_108399991 | 3300012203 | Vadose Zone Soil | VNVLVLDESLELADVVGRFTLLRGWQPHFIGSLDELELGVRA |
Ga0137362_102990501 | 3300012205 | Vadose Zone Soil | VNLLVLDESLDLAVVVGRIAPVRGWEPHFVGSLHELEQAVQAHGRPALTVVNLQPPL |
Ga0137378_104404261 | 3300012210 | Vadose Zone Soil | VNLLVLDESLDLAVVVGRIAPVRGWEPHFVGSLHELEQAVQAHGRPALTVVNL |
Ga0157291_100279843 | 3300012902 | Soil | MNLLVLDESLELALLIGRIAPLNGWQPHFIGSLHEMELAVQA |
Ga0137416_104268443 | 3300012927 | Vadose Zone Soil | VNLLVLDESLDLAMVVGRIAPVRGWEPHFVGSLHELEQAVQAHGRPALTVVNLQP |
Ga0153915_122819312 | 3300012931 | Freshwater Wetlands | VNLLVLDESLDLAVVVGRMAPVRGWEPHFVGSLHELELAVRAHG |
Ga0126375_105989301 | 3300012948 | Tropical Forest Soil | MNLLVLDESLELASLIGRIAPLRGWQPHFIGSLHEMELAVQAHG |
Ga0164299_100123151 | 3300012958 | Soil | VNLLVLDESLDLAMVIGRLAPARGWQPHFVGSLHELEVAVAAQGRPALTV |
Ga0164302_105374071 | 3300012961 | Soil | VNLLVLDESLDLAMVIGRLAPARGWQPHFVGSLHELEVAVAAQG |
Ga0157373_106717601 | 3300013100 | Corn Rhizosphere | VNVLVLDESLDLAGVVGQLAPLRGWQPHFIGSLHELELGFRAYGRPALVIVNLQAPL |
Ga0157371_101742403 | 3300013102 | Corn Rhizosphere | MNLLVLDESLELALLIGRIAPLRGWQPHFIGSLHEMELAVQAHGRPALTVVNLQAPL |
Ga0075353_12335312 | 3300014321 | Natural And Restored Wetlands | MNVLVLDESLELAGVVGRLASLRGWEPHFIGSLYELELGVRAYG |
Ga0132256_1016979362 | 3300015372 | Arabidopsis Rhizosphere | VNLLVLDESLDLAVVVGRIAPVRGWEPHFVGSLHELEQAV |
Ga0187780_100489244 | 3300017973 | Tropical Peatland | VNLLVLDESLELAVNLRNLALLRGWQPHFVGSLHELEVAVAAQGRPGLVVVNL |
Ga0187788_102820511 | 3300018032 | Tropical Peatland | MNLLVLDESLDLALLIGRLAPVCGWQPHFVGSLHELELAVQAHGRPAL |
Ga0184620_101606841 | 3300018051 | Groundwater Sediment | VNVLVLDESLELADVVGRFTLLRGWQPHFIGSLDELELGVRAYG |
Ga0184632_102370981 | 3300018075 | Groundwater Sediment | VNVLVLDESLELAGVVGRLASLRGWQPHFLGSLLELELGVRTYGRPAL |
Ga0184612_100188111 | 3300018078 | Groundwater Sediment | MNVLVLDESLELAGVVGRLASLRGWQPHFLGSLLELELGVRTYGRPAL |
Ga0184612_103921551 | 3300018078 | Groundwater Sediment | MNVLVLDESLELAGVVGQLAPLRGWQPHFLGSLLELELGVRTYGRP |
Ga0190265_111331832 | 3300018422 | Soil | LNLLVLDESLELALLLGRRAPVRGWEPHFIGSLHEL |
Ga0190272_129528082 | 3300018429 | Soil | VNVLVLDESLELADVVGRFTLLRGWQPHFIGSLDELELG |
Ga0193723_10388113 | 3300019879 | Soil | VNVLVLDESLELADVVGRFTLLRGWQPHFIGSLDELELGV |
Ga0193707_10119914 | 3300019881 | Soil | VNVLVLDESLELADVVGRFTLLRGWQPHFIGSLDELELGVR |
Ga0193729_11007183 | 3300019887 | Soil | VNLLVLDESLDLAMVVGRIAPVRGWEPHFVGSLHELEQAVQAHGRPALTVVNLQPPL |
Ga0210407_102149211 | 3300020579 | Soil | VNLLVLDESLELAVNIRNLALLRGWQPHFVGSLHELELAVGAQGRPGLVVVNLQAPLTAW |
Ga0210403_107560841 | 3300020580 | Soil | VNLLVLDESLELAVNIRNLALLRGWQPRFVGSLHELEL |
Ga0210399_104204433 | 3300020581 | Soil | VNLLVLDESLELAVNIRNLALLRGWQPHFVGSLHELE |
Ga0210382_100775861 | 3300021080 | Groundwater Sediment | VNVLVLDESLELAGVVGRLASLRGWQPHYIGSLHALELGVRAYGRPG |
Ga0210404_100471581 | 3300021088 | Soil | VNLLVLDESLELAVNIRNLALLRGWQPHFVGSLHELELAVGAQGRP |
Ga0126371_127309061 | 3300021560 | Tropical Forest Soil | VNLLVLDESLEFAGLIGRLAPLRGWQPHFVGSLHE |
Ga0242654_101968581 | 3300022726 | Soil | VNLLVLDESLDLAMVVGRIAPVRGWEPHFVGSLHELELAVQAHGRPALT |
Ga0247789_11398621 | 3300023266 | Soil | MNLLVLDESLELALLIGRIAPLRGWQPHFIGSLHEMELAVQAHGRPALTVVNLQAP |
Ga0207653_100084211 | 3300025885 | Corn, Switchgrass And Miscanthus Rhizosphere | VNLLVLDESLDLAVVVRRIAPVRGWEPHSVGSLHELEQAVQAHGRPALTVVNLQPPLTA |
Ga0207653_103295852 | 3300025885 | Corn, Switchgrass And Miscanthus Rhizosphere | VNLLVLDESLDLAMVIGRLAPARGWEPHFVGSLHELEVAVAAQGRPALT |
Ga0207688_100561821 | 3300025901 | Corn, Switchgrass And Miscanthus Rhizosphere | VNLLVLDESLDLAMVIGRLAPARGWEPHFVGSLHELEVAVA |
Ga0207684_103809771 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | VNLLVLDESLELAVLIGRLAPLRGWQPHFVGSLHEVELAVQAHGRPALLVVNLQ |
Ga0207654_100361111 | 3300025911 | Corn Rhizosphere | VNLLVLDESLDLAMVIGRLAPARGWEPHFVGSLHELEVAVAAQGRPALTVVN |
Ga0207660_110453602 | 3300025917 | Corn Rhizosphere | VNVLVLDESLDLAGVVGQLAPLRGWQPHFIGSLHELELGFRAYGRPA |
Ga0207657_1000059136 | 3300025919 | Corn Rhizosphere | VNLLVLDESLDLAMVIGRLAPARGWEPHFVGSLHELEVAVAAQGRPAL |
Ga0207649_109380912 | 3300025920 | Corn Rhizosphere | MNLLVLDESLELALLIGRIAPLRGWQPHFIGSLHEMELAVQ |
Ga0207640_102954151 | 3300025981 | Corn Rhizosphere | VNLLVLDESLDLAMVIGRLAPARGWEPHFVGSLHELEVAVAAQGRP |
Ga0208000_1031032 | 3300026001 | Rice Paddy Soil | MNLLVLDESLELAVMLGRLAPGRGWRPHFVGSLHELELAVRAHG |
Ga0257170_10079141 | 3300026351 | Soil | VNLLVLDESLDLAVVVRRIAPVRGWEPHFVGSLHELEQAVQAHGRPAL |
Ga0257171_10040051 | 3300026377 | Soil | VNLLVLDESLDLAVVVRRIAPVRGWEPHFVGSLHELEQAVQAHGRPALTVVNL |
Ga0257153_10157621 | 3300026490 | Soil | VNLLVLDESLDLAVVVRRIAPVRGWEPHFVGSLHELEQAVQAHGRPALTVVNLQP |
Ga0257156_10006441 | 3300026498 | Soil | VNLLVLDESLDLAVVVRRIAPVRGWEPHFVGSLHELEQAVQAHGRPALTV |
Ga0257181_10319062 | 3300026499 | Soil | VNVLVLDESLELAGVVGRLAPLRGWQPHFIGSLHELELGFRAYGRPALV |
Ga0257168_10208303 | 3300026514 | Soil | VNLLVLDESLDLAVVVRRIAPVRGWEPHFVGSLHELEQAVQAHGRPALTVVNLQPP |
Ga0209648_108337411 | 3300026551 | Grasslands Soil | VNLLVLDESLELAVQIGRLASLRGWQPHFVGLLHELE |
Ga0209995_10036961 | 3300027471 | Arabidopsis Thaliana Rhizosphere | MNLLVLDESLELALLIGRIAPLRGWQPHFIGSLHEMELAVQAHGRPALT |
Ga0209968_10004949 | 3300027526 | Arabidopsis Thaliana Rhizosphere | MNLLVLDESLELALLIGRIAPLRGWQPHFIGSLHEMELAVQAHGRPALTVVNLQA |
Ga0209999_10265311 | 3300027543 | Arabidopsis Thaliana Rhizosphere | MNLLVLDESLELALLIGRIAPLNGWQPHFIGSLHEMELAVQAHGRP |
Ga0209982_10179751 | 3300027552 | Arabidopsis Thaliana Rhizosphere | MNLLVLDESLELALLIGRIAPLNGWQPHFIGSLHEMELAVQAHGRPALTVVNLQ |
Ga0209329_10714721 | 3300027605 | Forest Soil | VNLLVLDESLDLAVVVRRIAPVRGWEPHFVGSLHELEQAVQ |
Ga0209998_101055732 | 3300027717 | Arabidopsis Thaliana Rhizosphere | VNLLVLDESLDLAMVIGRLAPARGWEPHFVGSLHELEVAAEEV |
Ga0209701_105452132 | 3300027862 | Vadose Zone Soil | VNVLVLDESLELAGVVGRLAPLRGWQPHFIGSLHEL |
Ga0209974_1000008231 | 3300027876 | Arabidopsis Thaliana Rhizosphere | MNLLVLDESLELALLIGRIAPLRGWQPHFIGSLHEMELAVQAHGRPALTVVNLQ |
Ga0209068_100684981 | 3300027894 | Watersheds | VNLLVLDESLDLAIVVGRIAPVRGWEPHFVGSLHELEQAVQAHGRPALT |
Ga0209526_100403945 | 3300028047 | Forest Soil | VNLLVLDESLDLAMVVGRIAPVRGWEPHFVGSLHELEQAVQAHGRAA |
Ga0307504_102076312 | 3300028792 | Soil | VNVLVLDESLDLAGVVGRLALLRGWEPHFLGSLLE |
(restricted) Ga0255311_11300731 | 3300031150 | Sandy Soil | VNVLVLDESLELAGVVGQLAALRGWQPHFIGSLHELELGVRAY |
Ga0308194_101710392 | 3300031421 | Soil | VNLLVLDESLDLAMVVGRIAPVRGWEPHFVGSLHEL |
Ga0307469_102322231 | 3300031720 | Hardwood Forest Soil | VNLLVLDESLDLAVVVRRIAPVRGWEPHFVGSLHELEQAVQAHGRPALTVVN |
Ga0307468_1000374881 | 3300031740 | Hardwood Forest Soil | MNVLVLDESLELAGVVGRLAPMRGWEPHFLGSLLELELG |
Ga0307473_104483522 | 3300031820 | Hardwood Forest Soil | VNLLVLDESLDLAVVVRRIAPVRGWEPHFVGSLHELEQAVQAHGRPALTVVNLQPPLT |
Ga0307479_109695331 | 3300031962 | Hardwood Forest Soil | VNLLVLDESLELAVNIRNLALLRGWQPHFVGSLHEL |
Ga0307472_1009439211 | 3300032205 | Hardwood Forest Soil | VNLLVLDESLELAVLIGRLAPLRGWQPHFVGSLHE |
Ga0335070_112293332 | 3300032829 | Soil | VNLLVLDESLELAVVIGRLAPIRGWQPHFVGSLHELELAVRAHGR |
Ga0326726_103397441 | 3300033433 | Peat Soil | VNLLVLDESLDLAVVVGRIAPVRGWEPHFVGSLHELEQAVQAHGRPALTV |
Ga0326732_10053541 | 3300033501 | Peat Soil | VNLLVLDESLDLAVVVGRIAPVRGWEPHFVGSLHELE |
Ga0316628_1003241993 | 3300033513 | Soil | VNLLVLDESLDLAVVVGRIAPVWGWEPHFVGSLHELELAVQAHGRPALTVVNLQPPLT |
Ga0326723_0287752_559_735 | 3300034090 | Peat Soil | VNLLVLDESLDLAVVVGRIAPVRGWEPHFVGSLHELEQAVQAHGRPALTVVNLQPPLTA |
⦗Top⦘ |