NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F081743

Metagenome / Metatranscriptome Family F081743

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F081743
Family Type Metagenome / Metatranscriptome
Number of Sequences 114
Average Sequence Length 88 residues
Representative Sequence MDWNLKDPLWLDVDDPRFGKMAEVGRVVKVGFVSDVPGLYFHKRFKGSGHPFYEAVYKKAAKINKKLADNMDTCIIK
Number of Associated Samples 74
Number of Associated Scaffolds 113

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Eukaryota
% of genes with valid RBS motifs 17.43 %
% of genes near scaffold ends (potentially truncated) 47.37 %
% of genes from short scaffolds (< 2000 bps) 74.56 %
Associated GOLD sequencing projects 70
AlphaFold2 3D model prediction Yes
3D model pTM-score0.44

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Eukaryota (94.737 % of family members)
NCBI Taxonomy ID 2759
Taxonomy All Organisms → cellular organisms → Eukaryota

Most Common Ecosystem
GOLD Ecosystem Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine
(38.053 % of family members)
Environment Ontology (ENVO) Unclassified
(57.895 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Saline → Water (saline)
(78.070 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 25.71%    β-sheet: 1.90%    Coil/Unstructured: 72.38%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  		pTM-score: 0.44
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 113 Family Scaffolds
PF08597eIF3_subunit 1.77
PF00152tRNA-synt_2 0.88
PF03330DPBB_1 0.88
PF01725Ham1p_like 0.88
PF01494FAD_binding_3 0.88
PF01764Lipase_3 0.88
PF06201PITH 0.88
PF02637GatB_Yqey 0.88
PF13768VWA_3 0.88
PF00069Pkinase 0.88
PF00226DnaJ 0.88

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 113 Family Scaffolds
COG0515Serine/threonine protein kinaseSignal transduction mechanisms [T] 3.54
COG06542-polyprenyl-6-methoxyphenol hydroxylase and related FAD-dependent oxidoreductasesEnergy production and conversion [C] 1.77
COG0017Aspartyl/asparaginyl-tRNA synthetaseTranslation, ribosomal structure and biogenesis [J] 0.88
COG0064Asp-tRNAAsn/Glu-tRNAGln amidotransferase B subunitTranslation, ribosomal structure and biogenesis [J] 0.88
COG0127Inosine/xanthosine triphosphate pyrophosphatase, all-alpha NTP-PPase familyNucleotide transport and metabolism [F] 0.88
COG0173Aspartyl-tRNA synthetaseTranslation, ribosomal structure and biogenesis [J] 0.88
COG0578Glycerol-3-phosphate dehydrogenaseEnergy production and conversion [C] 0.88
COG0644Dehydrogenase (flavoprotein)Energy production and conversion [C] 0.88
COG0665Glycine/D-amino acid oxidase (deaminating)Amino acid transport and metabolism [E] 0.88
COG1190Lysyl-tRNA synthetase, class IITranslation, ribosomal structure and biogenesis [J] 0.88
COG1610Uncharacterized conserved protein YqeY, may have tRNA amino acid amidase activityGeneral function prediction only [R] 0.88
COG2269Elongation factor P--beta-lysine ligase (EF-P beta-lysylation pathway)Translation, ribosomal structure and biogenesis [J] 0.88
COG2511Archaeal Glu-tRNAGln amidotransferase subunit E, contains GAD domainTranslation, ribosomal structure and biogenesis [J] 0.88

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms95.61 %
UnclassifiedrootN/A4.39 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300003346|JGI26081J50195_1006899All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Mediophyceae → Lithodesmiophycidae → Lithodesmiales → Lithodesmiaceae → Helicotheca → Helicotheca tamesis3174Open in IMG/M
3300006165|Ga0075443_10344878All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta552Open in IMG/M
3300006383|Ga0075504_1247372All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta516Open in IMG/M
3300006396|Ga0075493_1456342All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta633Open in IMG/M
3300006803|Ga0075467_10032435All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Coscinodiscophyceae → Thalassiosirophycidae → Thalassiosirales → Thalassiosiraceae → Thalassiosira → Thalassiosira pseudonana3321Open in IMG/M
3300006803|Ga0075467_10061606All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Mediophyceae → Lithodesmiophycidae → Lithodesmiales → Lithodesmiaceae → Helicotheca → Helicotheca tamesis2309Open in IMG/M
3300006803|Ga0075467_10069768All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta2146Open in IMG/M
3300008263|Ga0114349_1009902All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta8787Open in IMG/M
3300008834|Ga0103882_10044799All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta653Open in IMG/M
3300008929|Ga0103732_1019787All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta958Open in IMG/M
3300008929|Ga0103732_1074400All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta529Open in IMG/M
3300008929|Ga0103732_1080724All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta508Open in IMG/M
3300008936|Ga0103739_1062935All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta527Open in IMG/M
3300008937|Ga0103740_1018761All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta792Open in IMG/M
3300008938|Ga0103741_1125016All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta524Open in IMG/M
3300008938|Ga0103741_1129229All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta515Open in IMG/M
3300009023|Ga0103928_10014296All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta1795Open in IMG/M
3300009023|Ga0103928_10273605All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta622Open in IMG/M
3300009023|Ga0103928_10385116All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta542Open in IMG/M
3300009265|Ga0103873_1058032All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta754Open in IMG/M
3300009279|Ga0103880_10047357All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta607Open in IMG/M
3300009279|Ga0103880_10064529All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta554Open in IMG/M
3300009432|Ga0115005_10007669All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Coscinodiscophyceae → Chaetocerotophycidae → Chaetocerotales → Chaetocerotaceae → Chaetoceros → Chaetoceros debilis8500Open in IMG/M
3300009432|Ga0115005_10009903All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Coscinodiscophyceae → Chaetocerotophycidae → Chaetocerotales → Chaetocerotaceae → Chaetoceros → Chaetoceros debilis7445Open in IMG/M
3300009432|Ga0115005_10013566All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta6309Open in IMG/M
3300009432|Ga0115005_10024807All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta4633Open in IMG/M
3300009432|Ga0115005_10257297All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta1368Open in IMG/M
3300009432|Ga0115005_10443338All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta1032Open in IMG/M
3300009436|Ga0115008_10016091All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Coscinodiscophyceae → Thalassiosirophycidae → Thalassiosirales → Thalassiosiraceae → Thalassiosira → Thalassiosira pseudonana6090Open in IMG/M
3300009436|Ga0115008_10026246All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta4681Open in IMG/M
3300009436|Ga0115008_10203357All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Mediophyceae → Lithodesmiophycidae → Lithodesmiales → Lithodesmiaceae → Helicotheca → Helicotheca tamesis1420Open in IMG/M
3300009436|Ga0115008_10266264All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Mediophyceae → Lithodesmiophycidae → Lithodesmiales → Lithodesmiaceae → Helicotheca → Helicotheca tamesis1218Open in IMG/M
3300009436|Ga0115008_10487486All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Mediophyceae → Lithodesmiophycidae → Lithodesmiales → Lithodesmiaceae → Ditylum → Ditylum brightwellii880Open in IMG/M
3300009441|Ga0115007_11220670All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta524Open in IMG/M
3300009544|Ga0115006_10149743All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta2071Open in IMG/M
3300009544|Ga0115006_10451447All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta1126Open in IMG/M
3300009544|Ga0115006_11560464All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta598Open in IMG/M
3300009550|Ga0115013_10005998All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta6447Open in IMG/M
3300009592|Ga0115101_1842122All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Coscinodiscophyceae → Chaetocerotophycidae → Chaetocerotales → Chaetocerotaceae → Chaetoceros → Chaetoceros debilis1923Open in IMG/M
3300009606|Ga0115102_10369612All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta543Open in IMG/M
3300009606|Ga0115102_10862683All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta733Open in IMG/M
3300009790|Ga0115012_10350329All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Raphidophyceae → Chattonellales → Chattonellaceae → Fibrocapsa → Fibrocapsa japonica1123Open in IMG/M
3300012416|Ga0138259_1286953All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta945Open in IMG/M
3300016926|Ga0186602_102148All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Mediophyceae → Lithodesmiophycidae → Lithodesmiales → Lithodesmiaceae → Ditylum → Ditylum brightwellii2858Open in IMG/M
3300016978|Ga0186394_104644All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta1931Open in IMG/M
3300016991|Ga0186318_110567All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Mediophyceae → Lithodesmiophycidae → Lithodesmiales → Lithodesmiaceae → Ditylum → Ditylum brightwellii1061Open in IMG/M
3300017072|Ga0186672_114013All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta638Open in IMG/M
3300017072|Ga0186672_115099All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta517Open in IMG/M
3300017114|Ga0186529_113093All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta1031Open in IMG/M
3300017233|Ga0186366_101457All Organisms → Viruses → Predicted Viral2563Open in IMG/M
3300017740|Ga0181418_1129098All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta610Open in IMG/M
3300017771|Ga0181425_1079111All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Coscinodiscophyceae → Chaetocerotophycidae → Chaetocerotales → Chaetocerotaceae → Chaetoceros → Chaetoceros debilis1059Open in IMG/M
3300017783|Ga0181379_1128721All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Coscinodiscophyceae → Chaetocerotophycidae → Chaetocerotales → Chaetocerotaceae → Chaetoceros → Chaetoceros debilis912Open in IMG/M
3300018695|Ga0193259_1078328All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Coscinodiscophyceae → Chaetocerotophycidae → Chaetocerotales → Chaetocerotaceae → Chaetoceros → Chaetoceros debilis584Open in IMG/M
3300018844|Ga0193312_1013361All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Mediophyceae → Lithodesmiophycidae → Lithodesmiales → Lithodesmiaceae → Helicotheca → Helicotheca tamesis943Open in IMG/M
3300018844|Ga0193312_1071126All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta519Open in IMG/M
3300018848|Ga0192970_1104412All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Coscinodiscophyceae → Thalassiosirophycidae → Thalassiosirales → Thalassiosiraceae → Thalassiosira → Thalassiosira oceanica501Open in IMG/M
3300018934|Ga0193552_10223652All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta528Open in IMG/M
3300018978|Ga0193487_10258507All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta546Open in IMG/M
3300018981|Ga0192968_10051914All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta1126Open in IMG/M
3300018981|Ga0192968_10060599All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta1034Open in IMG/M
3300018981|Ga0192968_10063035All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta1012Open in IMG/M
3300018981|Ga0192968_10148374All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta608Open in IMG/M
3300018981|Ga0192968_10170738All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta555Open in IMG/M
3300018996|Ga0192916_10108674All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta831Open in IMG/M
3300018998|Ga0193444_10145544All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta628Open in IMG/M
3300019007|Ga0193196_10360147All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta617Open in IMG/M
3300019021|Ga0192982_10362743All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta518Open in IMG/M
3300019022|Ga0192951_10266600All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta643Open in IMG/M
3300019036|Ga0192945_10292598All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta509Open in IMG/M
3300019037|Ga0192886_10304117All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Coscinodiscophyceae → Chaetocerotophycidae → Chaetocerotales → Chaetocerotaceae → Chaetoceros → Chaetoceros debilis530Open in IMG/M
3300021169|Ga0206687_1692615All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta793Open in IMG/M
3300021335|Ga0213867_1002859All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Coscinodiscophyceae → Thalassiosirophycidae → Thalassiosirales → Thalassiosiraceae → Thalassiosira → Thalassiosira pseudonana7553Open in IMG/M
3300021335|Ga0213867_1007835All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Mediophyceae → Lithodesmiophycidae → Lithodesmiales → Lithodesmiaceae → Ditylum → Ditylum brightwellii4550Open in IMG/M
3300021335|Ga0213867_1087859All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta1128Open in IMG/M
3300021350|Ga0206692_1446763All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta1933Open in IMG/M
3300021373|Ga0213865_10023285All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Mediophyceae → Lithodesmiophycidae → Lithodesmiales → Lithodesmiaceae → Ditylum → Ditylum brightwellii3497Open in IMG/M
3300021373|Ga0213865_10031877All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Mediophyceae → Lithodesmiophycidae → Lithodesmiales → Lithodesmiaceae → Ditylum → Ditylum brightwellii2957Open in IMG/M
3300021389|Ga0213868_10591018All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta582Open in IMG/M
3300021927|Ga0063103_1054031All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Coscinodiscophyceae → Chaetocerotophycidae → Chaetocerotales → Chaetocerotaceae → Chaetoceros → Chaetoceros debilis1322Open in IMG/M
(restricted) 3300023271|Ga0233403_10201285All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta580Open in IMG/M
3300025684|Ga0209652_1026678All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Mediophyceae → Lithodesmiophycidae → Lithodesmiales → Lithodesmiaceae → Helicotheca → Helicotheca tamesis2636Open in IMG/M
3300025887|Ga0208544_10159189All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta962Open in IMG/M
3300027833|Ga0209092_10003186All Organisms → cellular organisms → Eukaryota14477Open in IMG/M
3300027833|Ga0209092_10033829All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Mediophyceae → Lithodesmiophycidae → Lithodesmiales → Lithodesmiaceae → Ditylum → Ditylum brightwellii3274Open in IMG/M
3300027849|Ga0209712_10010146All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Bacillariophyceae → Bacillariophycidae → Naviculales → Phaeodactylaceae → Phaeodactylum → Phaeodactylum tricornutum6979Open in IMG/M
3300027849|Ga0209712_10413994All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta759Open in IMG/M
(restricted) 3300028045|Ga0233414_10305334All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta730Open in IMG/M
3300030653|Ga0307402_10864922All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta528Open in IMG/M
3300030670|Ga0307401_10446610All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta588Open in IMG/M
3300030699|Ga0307398_10473769All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta689Open in IMG/M
3300030948|Ga0073977_1018473All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Bacillariophyceae → Bacillariophycidae → Bacillariales → Bacillariaceae → Pseudo-nitzschia → Pseudo-nitzschia australis3266Open in IMG/M
3300031522|Ga0307388_10515521All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta788Open in IMG/M
3300031522|Ga0307388_10609912All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta725Open in IMG/M
3300031522|Ga0307388_10657118All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta698Open in IMG/M
3300031522|Ga0307388_11044094All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta554Open in IMG/M
3300031709|Ga0307385_10276760All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta638Open in IMG/M
3300031709|Ga0307385_10424801All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta508Open in IMG/M
3300031717|Ga0307396_10579135All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta539Open in IMG/M
3300031717|Ga0307396_10590817All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta533Open in IMG/M
3300031717|Ga0307396_10590817All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta533Open in IMG/M
3300031717|Ga0307396_10643785All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta509Open in IMG/M
3300031725|Ga0307381_10117642All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Mediophyceae → Lithodesmiophycidae → Lithodesmiales → Lithodesmiaceae → Ditylum → Ditylum brightwellii887Open in IMG/M
3300031725|Ga0307381_10246360All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta634Open in IMG/M
3300031729|Ga0307391_10755961All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta556Open in IMG/M
3300031737|Ga0307387_10511827All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta744Open in IMG/M
3300031737|Ga0307387_10707018All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta634Open in IMG/M
3300031750|Ga0307389_10635295All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta693Open in IMG/M
3300033572|Ga0307390_10848448All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta576Open in IMG/M

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
MarineEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Marine38.05%
MarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Marine20.35%
Host-AssociatedHost-Associated → Human → Digestive System → Large Intestine → Fecal → Host-Associated7.08%
AqueousEnvironmental → Aquatic → Marine → Coastal → Unclassified → Aqueous6.19%
Ice Edge, Mcmurdo Sound, AntarcticaEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Ice Edge, Mcmurdo Sound, Antarctica6.19%
SeawaterEnvironmental → Aquatic → Marine → Coastal → Unclassified → Seawater5.31%
Surface Ocean WaterEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Surface Ocean Water3.54%
SeawaterEnvironmental → Aquatic → Marine → Strait → Unclassified → Seawater2.65%
Coastal WaterEnvironmental → Aquatic → Marine → Coastal → Unclassified → Coastal Water2.65%
SeawaterEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Seawater1.77%
SeawaterEnvironmental → Aquatic → Marine → Inlet → Unclassified → Seawater1.77%
MarineEnvironmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine1.77%
SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Sediment0.89%
Freshwater, PlanktonEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton0.89%
Polar MarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Polar Marine0.89%

Visualization
Powered by ApexCharts



Associated Samples

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Taxon OIDSample NameHabitat TypeIMG/M Link
3300003346Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - ESP_74LU_5_DNAEnvironmentalOpen in IMG/M
3300006165Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG006-DNAEnvironmentalOpen in IMG/M
3300006383Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_D_>0.8_RNA1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006394Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_20_>0.8_RNA1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006396Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_20_>0.8_RNA2 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006803Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_20_>0.8_DNAEnvironmentalOpen in IMG/M
3300008263Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0106-53-LTREnvironmentalOpen in IMG/M
3300008834Eukaryotic communities of water from the North Atlantic ocean - ACM26EnvironmentalOpen in IMG/M
3300008929Eukaryotic and microbial communities from ice edge, McMurdo Sound, Antarctica - 1AEnvironmentalOpen in IMG/M
3300008936Eukaryotic and microbial communities from ice edge, McMurdo Sound, Antarctica - 3BEnvironmentalOpen in IMG/M
3300008937Eukaryotic and microbial communities from ice edge, McMurdo Sound, Antarctica - 3CEnvironmentalOpen in IMG/M
3300008938Eukaryotic and microbial communities from ice edge, McMurdo Sound, Antarctica - 4AEnvironmentalOpen in IMG/M
3300009023Planktonic microbial communities from coastal waters of California, USA - Canon-29EnvironmentalOpen in IMG/M
3300009265Eukaryotic communities of water from the North Atlantic ocean - ACM8EnvironmentalOpen in IMG/M
3300009279Eukaryotic communities of water from the North Atlantic ocean - ACM42EnvironmentalOpen in IMG/M
3300009432Marine eukaryotic phytoplankton communities from Arctic Ocean - Arctic Ocean - Greenland ARC118M MetagenomeEnvironmentalOpen in IMG/M
3300009436Marine eukaryotic phytoplankton communities from Arctic Ocean - Fram Strait ARC3M MetagenomeEnvironmentalOpen in IMG/M
3300009441Marine eukaryotic phytoplankton communities from Arctic Ocean - Arctic Ocean ARC135M MetagenomeEnvironmentalOpen in IMG/M
3300009544Marine eukaryotic phytoplankton communities from Arctic Ocean - Arctic Ocean- Svalbard ARC20M MetagenomeEnvironmentalOpen in IMG/M
3300009550Marine eukaryotic phytoplankton communities from Atlantic Ocean - South Atlantic ANT15 MetagenomeEnvironmentalOpen in IMG/M
3300009592Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - MBTS_20Mar14_M1_3um Metatranscriptome (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300009606Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - MBTS_5May14_M2_3um Metatranscriptome (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300009790Marine eukaryotic phytoplankton communities from Atlantic Ocean - Tropical Atlantic ANT10 MetagenomeEnvironmentalOpen in IMG/M
3300012416Metatranscriptomics of polar marine prokaryotic and eukaryotic communities from Palmer Station, Antarctica after 24hr light incubation - RNA9.A_24.20151111 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300016926Metatranscriptome of marine eukaryotic communities from Antarctic Ocean in modified f/2 medium with seawater, 3 C, 33.6 psu salinity and 366 ?mol photons light - Thalassionema nitzschioides L26-B (MMETSP0156)Host-AssociatedOpen in IMG/M
3300016978Metatranscriptome of marine eukaryotic communities from Mediterranean Sea in f/2 medium, 20 C, 36 psu salinity and 297 ?mol photons light - Pseudo-nitzschia arenysensis B593 (MMETSP0329)Host-AssociatedOpen in IMG/M
3300016991Metatranscriptome of marine eukaryotic communities from Pacific Ocean in f/2 medium with Sargasso seawater w/o nitrate, 14 C, 36 psu salinity and 101 ?mol photons light - Ditylum brightwellii GSO105 (MMETSP1001)Host-AssociatedOpen in IMG/M
3300017044Metatranscriptome of coastal eukaryotic communities from Seto Inland Sea in f/2 medium with seawater, 14 C, 36 psu salinity and 214 ?mol photons light - Skeletonema japonicum CCMP 2506 (MMETSP0593)Host-AssociatedOpen in IMG/M
3300017072Metatranscriptome of coastal eukaryotic communities from Pacific Ocean in 0.2u filtered seawater with ES enrichments, NH4, 15 C, 33 psu salinity and 468 ?mol photons light - Pseudo-nitzschia australis 10249 10 AB (MMETSP0140_2)Host-AssociatedOpen in IMG/M
3300017114Metatranscriptome of marine eukaryotic communities from Atlantic Ocean in f/2 medium, 13 C, 21 psu salinity and 436 ?mol photons light - Amphiprora paludosa CCMP 125 (MMETSP1065)Host-AssociatedOpen in IMG/M
3300017116Metatranscriptome of marine eukaryotic communities from unknown location in f/2 medium with seawater, at -2 C, 35 psu salinity and 559 ?mol photons light - Thalassiosira antarctica CCMP 982 (MMETSP0902)EnvironmentalOpen in IMG/M
3300017233Metatranscriptome of marine eukaryotic communities from North Pacific Ocean in enriched f/2 medium with seawater, 27 C, 0 psu salinity and 313 ?mol photons light - Astrosyne radiata 13vi08-1A (MMETSP0418)Host-AssociatedOpen in IMG/M
3300017740Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 41 SPOT_SRF_2013-03-13EnvironmentalOpen in IMG/M
3300017771Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 48 SPOT_SRF_2013-11-13EnvironmentalOpen in IMG/M
3300017783Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 2 SPOT_SRF_2009-07-10EnvironmentalOpen in IMG/M
3300018695Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_092 - TARA_N000001305 (ERX1789500-ERR1719457)EnvironmentalOpen in IMG/M
3300018844Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_102 - TARA_N000001656 (ERX1782100-ERR1711982)EnvironmentalOpen in IMG/M
3300018848Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_084 - TARA_N000001442 (ERX1789421-ERR1719148)EnvironmentalOpen in IMG/M
3300018934Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_144 - TARA_N000003183EnvironmentalOpen in IMG/M
3300018978Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_136 - TARA_N000002965 (ERX1789639-ERR1719422)EnvironmentalOpen in IMG/M
3300018981Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_084 - TARA_N000001440 (ERX1782157-ERR1712238)EnvironmentalOpen in IMG/M
3300018996Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_072 - TARA_N000000839 (ERX1782178-ERR1712156)EnvironmentalOpen in IMG/M
3300018998Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_131 - TARA_N000002360 (ERX1782428-ERR1712117)EnvironmentalOpen in IMG/M
3300019000Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_082 - TARA_N000001394 (ERX1782320-ERR1712129)EnvironmentalOpen in IMG/M
3300019007Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_039 - TARA_N000000011 (ERX1782393-ERR1712012)EnvironmentalOpen in IMG/M
3300019021Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_085 - TARA_N000001034 (ERX1782268-ERR1711957)EnvironmentalOpen in IMG/M
3300019022Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_082 - TARA_N000001390 (ERX1782474-ERR1712194)EnvironmentalOpen in IMG/M
3300019036Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_082 - TARA_N000001382 (ERX1782404-ERR1712086)EnvironmentalOpen in IMG/M
3300019037Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_068 - TARA_N000000703 (ERX1782146-ERR1712183)EnvironmentalOpen in IMG/M
3300019745Sediment microbial communities from the Broadkill River, Lewes, Delaware, United States ? FLT_8-9_MGEnvironmentalOpen in IMG/M
3300021169Metatranscriptome of ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 30m 12015 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021335Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO540EnvironmentalOpen in IMG/M
3300021350Metatranscriptome of ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M2 40m 12015 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021373Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO282EnvironmentalOpen in IMG/M
3300021389Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO127EnvironmentalOpen in IMG/M
3300021927Metatranscriptome of marine eukaryotic phytoplankton communities from the Arctic Ocean - ARK-122M (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300023271 (restricted)Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Na_oxic_1_MGEnvironmentalOpen in IMG/M
3300025684Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - ESP_74LU_5_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300025887Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_20_>0.8_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300027833Marine eukaryotic phytoplankton communities from Arctic Ocean - Fram Strait ARC3M Metagenome (SPAdes)EnvironmentalOpen in IMG/M
3300027849Marine eukaryotic phytoplankton communities from Arctic Ocean - Arctic Ocean - Greenland ARC118M Metagenome (SPAdes)EnvironmentalOpen in IMG/M
3300028045 (restricted)Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Na_anoxic_10_MGEnvironmentalOpen in IMG/M
3300030653Metatranscriptome of marine eukaryotic phytoplankton communities from Antarctic Ocean - PS103-29 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030670Metatranscriptome of marine eukaryotic phytoplankton communities from Antarctic Ocean - PS103-23 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030699Metatranscriptome of marine eukaryotic phytoplankton communities from Antarctic Ocean - PS103-11 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030948Seawater microbial communities from Saanich Inlet, British Columbia, Canada - DeepDOM_E7_V_0.2 metaT (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031522Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean ? PS103-3.R2 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031709Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean ? PS103-2.R2 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031717Metatranscriptome of marine eukaryotic phytoplankton communities from Antarctic Ocean - PS103-6 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031725Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean ? PS103-1.R1 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031729Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean ? PS103-4.R2 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031737Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean ? PS103-3.R1 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031750Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean ? PS103-3.R3 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300033572Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean ? PS103-4.R1 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Protein ID Sample Taxon ID Habitat Sequence
JGI26081J50195_100689963300003346MarineMDWNLKDPLWLDVDDPRFGKMAEVGRVVKVGFVSDVPGLYFHKRFKGSGHPFYEAVYKKAAKINKKLADNMDTCIIK*
Ga0075443_1034487813300006165MarineMHSLDHCRMDWNVEDPLWLNVDHPKYGKMAQLGRIVKVGFVSDIPGLLVHRRYKGSGHPFYDKIYAKAATINLQLADCMDTCIVK*
Ga0075504_124737223300006383AqueousMDWNLKDALYLDTTDNRFGKMAEVGQIVKVGFVSDVDGLYFHKRFKGSGHPFYDSVYEKAAKIDKVFADHMDTCIVK*
Ga0075492_113576313300006394AqueousHSLDHTCQDWACEDPLWLDVDDEKFGLMAQMGRVVKVGFIKDLPLLMFHKRFKGAKHPFYAGFYDKAARIDKKYADMMDTCIVK*
Ga0075493_145634213300006396AqueousMFVGTVLHSLDHCLMDWNLKDPLWLDVDDPRFGKMAEVGRVVKVGFVSDIPGLYFHKRFKGSGHPFYEAVCRKAAKINKKFADNMDTCIIK*
Ga0075467_1003243513300006803AqueousMFVGTILHSLDHSLMDWNLKDPLWLDVDDPRFGKMAELGRVVKVGFVSDIPGLYFHKRYKGSGHPFYEAVYRKAAKINKKFADVMDTCIIK*
Ga0075467_1006160623300006803AqueousMDWNLKDPLWLDVDDPRFGKMAEVGRVVKVGFVSDIPGLYFHKRFKGSGHPFYEAVYRKAAKINKKFADNMDTCIIK*
Ga0075467_1006976813300006803AqueousVPSSCFAEFQKHKDLFPGTDGEAMFVGTILHSLDHSLMDWNLKDPLWLDVDDPLFGKMAELGRVVKVGFVSDIPGLYFHKRYKGSGHPFYEAVYRKAAKINKKFVDVMDTCIIK*
Ga0114349_100990283300008263Freshwater, PlanktonLWLDVDDPRFGKMAEVGRIIKAGFVSDVPGLYFHKRFKGSDHPFYEAVYRKAAKINKNFADQMDTCIIK*
Ga0103882_1004479923300008834Surface Ocean WaterMEWNLCDPLWLDVNEPRFGEMAKLGRIVRVGFVSDVPFLYFHKRFKGSGHPFYEEVYRKAAKINKKLADNMDTCIIK*
Ga0103732_101978723300008929Ice Edge, Mcmurdo Sound, AntarcticaMDNNLDDPMWLNVNHPKFGRMAEVGRIVKVGFVQDVPGLIFEKRFKGSKHPFYESVYRKAAKIDKYMADNMDTC
Ga0103732_107440023300008929Ice Edge, Mcmurdo Sound, AntarcticaMSEFAKHKDSFPGIDGEAFFVGTVMHSLDHTCMDNNLDDPMWLNVNHPKFGRMAEVGRIVKVGFVQDVPGLIFEKRFKGSKHPFYESVYRKAAKIDKYMADNMDTC
Ga0103732_108072413300008929Ice Edge, Mcmurdo Sound, AntarcticaSEFAKHKDSFPGIDGEAFFVGTVMHSLDHTCMDNNLDDPMWLDVNHPKFGRMAEVGRIVKVGFVQDVPGLIFEKRFKGSKHPFYESVYRKAAKIDKYMADNMDTCIIK*
Ga0103739_106293523300008936Ice Edge, Mcmurdo Sound, AntarcticaMDNNLDDPMWLDVNHPKFGRMAEVGRIVKVGFVQDVPGLIFEKRFKGSKHPFYESVYRKAAKIDKYMADNMDTCIIK*
Ga0103740_101876123300008937Ice Edge, Mcmurdo Sound, AntarcticaMDNNLDDPMWLNVNHPKFGRMAEVGRIVKVGFVQDVPGLIFEKRFKGSKHPFYESVYKKAAKIDKYMADNMDTCIIK*
Ga0103741_112501623300008938Ice Edge, Mcmurdo Sound, AntarcticaMSEFVKHKDSFPGIDGEAFFVGTVMHSLDHTCMDNNLDDPMWLNVNHPKFGRMAEVGRIVKVGFVQDVPGLIFEKRFKGSKHPFYESVYRKAAKIDKYMA
Ga0103741_112922923300008938Ice Edge, Mcmurdo Sound, AntarcticaMSEFVKHKDSFPGIDGEAFFVGTVMHSLDHTCMDNNLDDPMWLDVNHPKFGRMAEVGRIVKVGFVQDVPGLIFEKRFKGSKHPFYESVYRKAAKIDKYMADNMDTCIIK*
Ga0103928_1001429623300009023Coastal WaterMFGKMAEMCRIVRVGFVEDVPFLYFNKRFKGSDHPFYKAVYEKAAKIDKKFADNMDTCIIK*
Ga0103928_1027360523300009023Coastal WaterSILVDPLWLDVDAPRFGKMAEVGRVAKAGFVSDVPGLYFHKRFKGSGHPFYESVYEKAAKINKTLADHMDTCITK*
Ga0103928_1038511613300009023Coastal WaterVCSFTIKLRNHFLGCFMRHRCSLRGIDGEAMFVGTVLHSLDHSLLERNLRDPLWLDVDSPDFGFMAEIGRIVRAGFTADIPLVPFERRYKDSSHPFHRAVYAHASKINRRLADMMDTCIIK*
Ga0103873_105803213300009265Surface Ocean WaterDLCDPLWLDVNEPRFGEMAKLGRIVRVGFVSDVPFLYFHKRFKGSGHPFYEEVYRKAAKINKKLADNMDTCIIK*
Ga0103880_1004735713300009279Surface Ocean WaterLDPLWLDVKDPKYGKMAEIGRIVRVGFVPDVPFLYFNKRFSGSNHPFYKRVYERAARIDKDLADNMDTCIIK*
Ga0103880_1006452913300009279Surface Ocean WaterFMDWNMQDPLWLDVNDANFGKMAELGRVVKVGFVSDVAGIYFHKCFKGSGHPFYESVYAKAAKIDKELADHMDTCIIK*
Ga0115005_1000766993300009432MarineMDWNIGDPLWLDVDHPEFGRMAEIGRVVKIGFVRDLPGLLFHRRYKGSNHPFYESIYKKAATINVGLADLMDTCIVK*
Ga0115005_1000990333300009432MarineMDWNVEDPLWLNVDHPKYGKMAQLGRIVKVGFVSDIPGLLVHRRYKGSGHPFYDKIYAKAATINLQLADCMDTCIVK*
Ga0115005_1001356623300009432MarineVKLPGAFMHEFAEHKKDLFPGVYGEAMFASTVLHSLAHTLMDWNLEDPLWLDLDNPRFGIMAQIGRIVKVHKRFKGSGNPFYEAVYRKAARINKELADNMDTCIIK*
Ga0115005_1002480743300009432MarineMEWNLVDPLWLDVDDPRFGKMAELGRIVRVGFVEDVPLLYFHKRFKGSGHPFYEAVYEKAAKIDKKFADHMDTCIIK*
Ga0115005_1025729743300009432MarineLDHSGYAIPDPLWFDVSCPKYGHMAELVRIVRVGFIDDLPGLAFHKSFRNSGHPFYEAVYKRAAKINKQYADQMDTYIIK*
Ga0115005_1044333833300009432MarineMEWNLVDPLWLDVDDPRFGKMAEIGRIVRVGFVPDVPLLYFHKRFKGSGHPFYEAVYEKAAKVDKQFADHIDTCIIK*
Ga0115008_1001609133300009436MarineLTQFEKYRNEFPGVDGEALFIGTVLHSLDHTTMDWNLEDPLWLDVDDPEYGHMARIGRIVKVGFVADVPGLLFHKRFKGCKHPFYSSVYEKAAKIDVKYADHMDTCIIK*
Ga0115008_1002624653300009436MarineMKEWNVDDPLWLDVDDKKFGMMAQLGRIVRVGFVSDVPGLYFHKNFKDSGNPFYEGVSKEACKVDANLAEYMDTCIAK*
Ga0115008_1020335713300009436MarineMAELGRIVRAGFVEDVPFLYFNKRFKGSDHPFYKSVYEKAAKIDKNFADNMDTCIIKQIGQLRSM*
Ga0115008_1026626423300009436MarineLEWNLDDPLWLDVNDPRFGKLAELGRIVRVGFVEDVPLLYFNKRFKGSDHPFYKSVYEKAAKIDKKFADNMDTCIIK*
Ga0115008_1048748623300009436MarineHAFMDWNLHDPLWLDVKHPRFGKMAELGRIVKVGFVPEVSVCYFHRKWKGSGHPFYEAVYAKAAKVNKKLADAMDTCICR*
Ga0115007_1122067013300009441MarineMEWNLADPLWLDVNDSRFGKMAELGRIVRVGFVSDVPLLYFHERSKNSGHPFYDAVYEKAVKINKRLADKMDTCIIK*
Ga0115006_1014974323300009544MarineDWNLKDPLWLDVDDPRFGKMAEVGRVVKVGFVSDIPGLYFHKRFKGSGHPFYEAVYRKSAKINKKFADNMDTCIIK*
Ga0115006_1045144723300009544MarineFAEFQKHKDLFPGTDGEAMFVGTILHSLDHTLFNWNFSDPLWLDVDDPRFGKMAELCRVIKVGFVSDLPGLCIHKRFKGSGHPFYEAVYRKAAKINKKFADQMDTCIIK*
Ga0115006_1156046413300009544MarineYFPGCRGEAMYIGTIMQSLDHCRMDWNIEDPLWLDVDHSRFGKMAEIGRIVNVGFVSDLPGLLFHRRYKDSGHPFYDAICEKAATINVKLADQMDTCIVK*
Ga0115013_1000599873300009550MarineLEWNLTDPLWLDINDPKFGVMAELCRIVRVGFVEDVPFLYFNKRFKGSDHPFYKTVYEKAAKIDQKFADNMDTCIIK*
Ga0115101_184212223300009592MarineVKSPFFNIIFQTALTKSLVILFYQRYVGTIMHSLDHCLLDWNIEDPLWLDDNHPEYGKMAQLGRIVKVGFVSDLPGLLIHRRYKGSGHPFYEKIYAKAATINVQLADCMDTCIVK*
Ga0115102_1036961223300009606MarineFPGIDGEALFIGTILHSLDHTLMEWNLPDPLWLDVKNPKFGKMAEMGRIVRAGFVQDIPLVYFEKRFKGSKHPFYQAVYKKAAKIDKELADHMDTCIVK*
Ga0115102_1086268323300009606MarineMEWNVVDPLWLDTEDPKYGKMAELGRIVRVGFVEDVPFLYFNKRFKGSKHPFYKAVYEKAAKIDQGLADYMDTCIIK*
Ga0115012_1035032913300009790MarineMAQTDTSKIPSLPGIDAESLFVGTVLHSLDHTLMGWHCEDPLWLDIDHPRFGPMASVGRVVRVGFVEDLPSLFFERHMRGSNHPFFKAVYNRAAKIDKLYADHMDTCIIK*
Ga0138259_128695313300012416Polar MarineLEWNLEDPLWLDTNDPKFGVMAELCRIVRVGFVQDVPFLYFNRRFKGSDHPFYKNVYEKAAKIDQKFADNMDTCIIK*
Ga0186602_10214853300016926Host-AssociatedMFVGTVLHSLDHSLMDWNLEDPLWLDVDCPKFGKMAEIGRIVKVGFVKDVPFLYFHKRFKGSGHPFYDSVYEKAAKINKKFADNMDTCIIK
Ga0186394_10464413300016978Host-AssociatedMEWNLPDPLWLDIDNPKFGKMAELGRIVRVGFVQDVPFLYFNRRFKGSDHPFYKAVYEKAVKIDKGLADMMDTCIIK
Ga0186318_11056723300016991Host-AssociatedMHSLDHALMDWNLEDPLWLDVDDPKYGKMAEIGRIIKVGFVPEVGGYYFHRKWKGSGHPFYEAVYRKLVKIDRKFADAMDTCICR
Ga0186657_10471023300017044Host-AssociatedPRFGKMAEVGRVVKVGFVSDVPGLYFHKRFKGSGHPFYEAVYRKAAKINKKFADNMDTCIIK
Ga0186672_11401313300017072Host-AssociatedMADPLWLDIDDPKFGPMAEFGRVVRVGFVEDLPLLSFNKRFKGSKHPFYEAVYKKAAKIDKELADNMDTCIAN
Ga0186672_11509913300017072Host-AssociatedKHLFPGVDGEALFVATVLHSVDHTLMEWNMADPLWLDIDDPKFGPMAEFGRVVRVGFVEDLPLLSFNKRFKGSKHPFYEAVYKKAAKIDKELADNMDTCIAN
Ga0186529_11309323300017114Host-AssociatedWLDVDHEEFGIMAEIGRIVKVGFVKDVPGLAFHKRFKGSNHPFYESVYAKASKVNQFMADNMDTCIIK
Ga0186168_11395823300017116VHGEAFFIGTVLHSLDHTCQDWACEDPLWLDVDDERFGLMAQMGCVVKVGFIKDLPGLYFHKRFKGANHPFYSGFYAKAARIDKKYADVM
Ga0186366_10145733300017233Host-AssociatedMLERNIEDPLWLDVDCPKFGLMAEMSRVIRVSFSSEIDGLYFHKSFKGSGHPFYDSVYRKAARINKDLADHMDTCIVR
Ga0181418_112909813300017740SeawaterELNLEDPLWLDIDDPRFGKMAELGRVVRVGFVPEVPGYYFNRHFKGSGHPFYEAVYAKAAKINKKMADNMETCICR
Ga0181425_107911113300017771SeawaterALWLDVDHPEYGKMAQLGRVVKVGFVSDLPGLLFHRRYKGSGHPFYEKIYKKAATINVKLADCMDTCIVK
Ga0181379_112872113300017783SeawaterLFVGTVMHSLEHSHMDWNLEDVLWLDTSNPEYGKMAEMGRIVKVGFVPDLPGLLFHKRYKGSKHPFYDKIYREAAKINLKLADNMDTCVVK
Ga0193259_107832823300018695MarineEAMYIGTIMHSLDHTRMDWNIEDPLWLDADHPRFGKMAQVGRVVKVGFVSDIPGLLFHRRYKGSGHPFYEKIYEKAATINLRLADHMDTCIVK
Ga0193312_101336113300018844MarineLPFIVHSVPCQALFVGTVLHSLDHTLMDENLKDALWLDTEDERFGKMAELGQIVKAGFVSDVDGLMFNKRFKGSDHPFYQSVYRFAAGKNKWFADHMDTCIIK
Ga0193312_107112613300018844MarineHGEFQKHKALFPGVNGEAMFVGTVLHSLDHTLMDWNLKDPLFLDTKDNKFGKMAEIGQIVKAGFVSDVDGLYFNKSFKGSSHPFYKTVYEKAAKIDKDLADHMDTCIIK
Ga0192970_110441223300018848MarineMMIPCGLTNVNRLIFGRMAEVGWIVKVGFVQNVPGLLFEKRFKGSKHPFYKSGYRKAEKIDKYMADNMDTCIIK
Ga0193552_1022365213300018934MarineGVDGEAFFIGTIMHSLDHTLMEWNLPDPLWLDIDNERFGKMAELGRVVRVGFVQDVPFLYFTKRFKDSDHPFYKAVYEKAAKIDKKLADHMDTCIVK
Ga0193487_1025850723300018978MarineVGSILHSLDHTLMDRNLPDPLLLDITCPKYGCMAELGRIVKVGFVSDVPGLYFHKRCKGAPHPFFAAVYEKASKFNADLASNMDTCIIK
Ga0192968_1005191433300018981MarineVNFIIKTRAIFMSEFAKHKDSFPGIDGEAFFVGTVMHSLDHTCMDNNLDDPMWLDVNHPKFGRMAEVGRIVKVGFVQDVPGLIFEKRFKGSKHPFYESVYRKAAKIDKYMADNMDTCIIK
Ga0192968_1006059933300018981MarineFVGTVMHSLDHTCMDNNLEDPMWLDVNHPKYGRMAEVGRIVKVGFVQDVPGLIFEKRFKGSKHPFYESVYKKAAKIDKYMADNMDTCIIK
Ga0192968_1006303513300018981MarineMSEFAKHKDCFPGIDGEAFFVGTVMHSLDHTCMDNNLDDPMWLDVNHPKFGRMAEVGRIVKVGFVQDVPGLIFEKRFKGSKHPFYESVYRKAAKIDKYMADNMDTCIIK
Ga0192968_1014837423300018981MarineMDWNLEDALWLDVDDPQFGIMAELGRIVKVGFVEDVPGLMFHKRFKGSKHPFYKSVYEKGVRINKKYADVMDTCIIK
Ga0192968_1017073813300018981MarineSLDHTCMDNNLDDPMWLDVNHPRFGRMAEVGRIVKVGFVQDVPGLIFEKRFKGSNHPFYESVYRKAAKIDRYMADNMDTCIIK
Ga0192916_1010867413300018996MarineVDPLWLDVDDPEFGKMAEIGRIVKMGFVKDVPGLYFHKRYKGSGHPFYDAVYEKAAKVNKKLADNMDTCIIK
Ga0193444_1014554413300018998MarineGQKYKKEFPGIHGEAMFVGSVVHSLDHTQMDWNLEDPLWLDITDENFGLMAEMGRIVKVGFVSDLPFLTFHKRFKGSKHPFYKSVYDKTVKFNKKYADNMDTCIVK
Ga0192953_1017593213300019000MarineIFLKEFQKHKASFPGVNGEAMFVGTVLHSLDHTLMDWNLKDPLYLDTENNRFGKMAEMGQIVKTGFVSDVDGLYFNKRFKGSSHPFYKSVYEKAAKIDKQLADHMDTCIIK
Ga0193196_1036014723300019007MarineIHGEALFVGSILHSLDHTLMDRNLPDPLLLDITCPKYGCMAELGRIVKVGFVSDVPGLYFHKRCKGAPHPFFAAVYEKASKFNADLASNMDTCIIK
Ga0192982_1036274313300019021MarineGVMAELCRIVRVGFVQDVPFLYFNRRFKGSDHPFYKNVYEKAAKIDQKFADNMDTCIIK
Ga0192951_1026660013300019022MarineMDWNLLDPLWLDVDDPRFGKMAELGRIVKVGFVSDVPMLYFHKRFKGSGHPFYESVYRKAAKVDRELADNMDTCIIK
Ga0192945_1029259813300019036MarineTLMEWNLPDPLYLDIDDPKFGRMAEIGRIIRVGFVQDVSGLYFNKRFSGSTHPFYKKVYDRACMVDKELADNMDTCIIK
Ga0192886_1030411713300019037MarineGRIVRVGFVEDVPGLLFHKRFKGCKHPFYKSIYEKGARINKKYADMMDTCIIK
Ga0194002_101171013300019745SedimentMLFSLKHYTDPLWLDVDDEKFGLMAQMGRVVKVGFIKDLPLLMFHKRFKGAKHPFYAGFYDKAARIDKKYADMMDTCIVK
Ga0206687_169261513300021169SeawaterVIVQSAMTDSLVLLFIERYVGTIMHSLDHCRMDWNIEDPLWLDVDHPEYGKMAQLGRVVKVGFVSDIPGLLIHRRYKGSGHPFYEKIYAKAATINLLLADSMDTCVVK
Ga0213867_100285933300021335SeawaterMFPIGFFVGTILHSLDHCLLEWNLEDALWLDVDDPRFGKMAEIGRITRAGFVEDVPFLYFNKCFKGSNHPFYKNVYEKAAKIDTKFADRMDTCIVK
Ga0213867_100783533300021335SeawaterMLHQAFFVGTVLHSLDHCLLEWNLDDPLWLDVDDPRFGKMAELGRIVRAGFVEDVPFLYFNRRFKGSDHPFYKSVYEKAAKIDKKFADNMDTCIIK
Ga0213867_108785923300021335SeawaterVGTILHSLDHCLLEWNLEDPLWLDVDDPRFGKMAELGRIVRAGFTEDVPFLYFNKRFKGSNHPFYKNVYEKAAKIDKKFADNMDTCIVK
Ga0206692_144676323300021350SeawaterMEWNMADPLWLDIDDPKFGPMAEFGRVVRVGFVEDLPLLSFNKRFKGSKHPFYEAVYKKAAKIDKELADNMDTCIAN
Ga0213865_1002328533300021373SeawaterVGTVLHSLDHCLLEWNLDDPLWLDVDDPRFGKMAELGRIVRAGFVEDVPFLYFNRRFKGSDHPFYKSVYEKAAKIDKKFADNMDTCIIK
Ga0213865_1003187723300021373SeawaterVGTILHSLDHCLLEWNLEDPLWLDVDDPRFGKMAELGRIVRVGFVEDVPFLYFNKRFKGSNHPFYKNVYEKAAKIDKKFADNMDTCIVK
Ga0213868_1059101813300021389SeawaterMDWNLKDPLWLDVDDPRFGKMAEVGRVVKVGFVSDIPGLYFHKRFKGSGHPFYEAVYRKAAKINKKFADNMDTCIIK
Ga0063103_105403123300021927MarineMHSLDHCRMDWNVEDPLWLNVDHPKYGKMAQLGRIVKVGFVSDIPGLLVHRRYKGSGHPFYDKIYAKAATINLQLADCMDTCIVK
(restricted) Ga0233403_1020128523300023271SeawaterESERPFVVGHRHIDIDDPRFGKMAEVGRIVQAGFFVSDVPGLYFHKRYKGSGHPFYEYEAVYQKAAKINKKLADHMDTCICK
Ga0209652_102667853300025684MarineMDWNLKDPLWLDVDDPRFGKMAEVGRVVKVGFVSDVPGLYFHKRFKGSGHPFYEAVYKKAAKINKKLADNMDTCIIK
Ga0208544_1015918913300025887AqueousVFVGTVLHSLDHCLMDWNLKDPLWLDVDDPRFGKMAEVGRVVKVGFVSDIPGLYFHKRFKGSGHPFYEAVYRKAAKINKKFADNMDTCIIK
Ga0209092_1000318693300027833MarineLTQFEKYRNEFPGVDGEALFIGTVLHSLDHTTMDWNLEDPLWLDVDDPEYGHMARIGRIVKVGFVADVPGLLFHKRFKGCKHPFYSSVYEKAAKIDVKYADHMDTCIIK
Ga0209092_1003382933300027833MarineLEWNLDDPLWLDVNDPRFGKLAELGRIVRVGFVEDVPLLYFNKRFKGSDHPFYKSVYEKAAKIDKKFADNMDTCIIK
Ga0209712_1001014683300027849MarineMHSLDHTRMDWNIGDPLWLDVDHPEFGRMAEIGRVVKIGFVSDLPGLLFHRRYKGSNHPFYESIYKKAATINVGLADLMDTCIVK
Ga0209712_1041399413300027849MarineLEWNLVDPLWLDVDDPRFGKMAELFRIVRVGFVPDLPLLYFHKRFKGSGHPFYEAVYEKAAKVDKQFADHMDTCIIK
(restricted) Ga0233414_1030533413300028045SeawaterMTDSLVLLFIERYVGTIMHSLDHCRMDWNIEDPLWLDVDHPEYGKMAQLGRVDKVGFVSDIPGLLIQRRYKGSGHPFYEKIYAKAATINLLLADCMDTCVVK
Ga0307402_1086492213300030653MarineGEAFFVGTVMHSLDHTCMDNNLDDPMWLDVNHPKFGRMAEVGRIVKVGFVQDVPGLIFEKRFKGSKHPFYESVYRKAAKIDKYMADNMDTCIIK
Ga0307401_1044661013300030670MarineGIDGEAFFVGTVLHSLDHTLLEWNVADPLWLDIDDPKFGKMAELTRIVLAGFTKDLPFLYFNKRFSGSDHPFYKRVYERAAMIDKELADHMDTCIIK
Ga0307398_1047376913300030699MarineVRVIFINEFARHKHLFPGIDGEAFFVGTVLHSLDHTLLEWNVADPLWLDIDDPKFGKMAELTRIVLAGFTKDLPFLYFNKRFSGSDHPFYKRVYERAAMIDKELADHMDTCIIK
Ga0073977_101847323300030948MarineMHSLDHTLMEWNLPDPLWLDIDNERFGKMAELGRIVRVGFVQDVPFLYFTKRFKGSDHPFYKSVYEKAAKIDKKLADHMDTCIVK
Ga0307388_1051552123300031522MarineEAFFVGTVMHSLDHTCMDNNLDDPMWLDVNHPKFGRMAEVGRIVKVGFVQDVPGLIFEKRFKGSKHPFYESVYRKAAKIDKYMADNMDTCIIK
Ga0307388_1060991213300031522MarineHTCMDNNLDDPMWLDVNHSEFGRMAEVGRIVKVGFVQDVPGLIFEKRFKGSKHPFYESVYRKAAKIDKYMADNMDTCIIK
Ga0307388_1065711813300031522MarineAFFVGTVMHSLDHTCMDNNLDDPMWLDVNHSKFGRMAEVGRIVKVGFVQDVPGLIFEKRFKGSKHPFYESVYRKAAKIDKYMADNMDTCIIK
Ga0307388_1104409413300031522MarineAIFMSEFAKHKDCFPGIDGEAFFVGTVMHSLDHTCMDNNLDDPMWLDVKHPKFGRMAEVGRIVKVGFVQDVPGLIFEKRFKGSKHPFYESVYRKAAKIDKYMADNMDTCIIK
Ga0307385_1027676013300031709MarineDCFPGIDGEAFFVGTVMHSLDHTCMDNNLDDPMWLDVNHPKYGRMAEVGRIVKVGFVQDVPGLIFEKRFKGSKHPFYESVYRKAAKIDKYMADNMDTCIIK
Ga0307385_1042480113300031709MarineDCFPGIDGEAFFVGTVMHSLDHTCMDNNLDDPMWLDVNHPRYGRMAEVGRIVKVGFVQDVPGLIFEKRFKGSKHPFYESVYRKAAKIDKYMADNMDTCIIK
Ga0307396_1057913513300031717MarinePGIGGEAFFVGTVLHSLDHTCMDDNLDDPMWLDVNHPKFGRMAELGRIVKAGFVQDVPGLIFEKRFKGSKHPFYESVYKKAAKIDKYMADNMDTCIIK
Ga0307396_1059081713300031717MarineEAFFVGTVMHSLDHTCMDNNLDDPMWLDVNHPKFGRMAEVGRIVKVGFVQDVPGLIFEKRFKGSIHPFYESVYRKAAKIDKYMADNMDTCIIK
Ga0307396_1059081723300031717MarineMWLDVNHPKFGRMAEMGRIVKAGFVQDVPGLIFEKRFKGSKHPFYESVYRKVARIDKYMADNMDTCIIK
Ga0307396_1064378513300031717MarineFPGIDGEAFFVGTVLHSLDHTLLEWNVADPLWLDIDDPKFGKMAELTRIVLAGFTKDLPFLYFNKRFSGSDHPFYKRVYERAAMIDKELADHMDTCIIK
Ga0307381_1011764223300031725MarineMFVGTILHSLDHTLMEWNLPDPLWLDVDNPRFGKMAELGRIVRVGFVSDLPCLYFQTRFKGSKHPFYKAVYEKAAKIDKELADNMDTCIIK
Ga0307381_1024636013300031725MarineTIMHSLDHTLMEWNLPDPLWLDIENEKFGKMAELGRIVRVGFVQDVPFLYFNKRFKGSNHPFYKAVYEKAAKIDKKLADHMDTCIVK
Ga0307391_1075596113300031729MarineRMVFMDQFAKHKHLFPGVDGEAFFIGTIVHSLDHTLMEWNLPDPLWLDIDNPKFGKMAEIGRVVRAGFVQDVPFLYFNKRFKGSNHPFYKTVYEKAAKVDQELADHMDTCIIK
Ga0307387_1051182713300031737MarineDHTCMDNNLDHPMWLDVNHPKFGRMAEGGRIVKVGFVQDVPGLIFEKRFKGSNHPFYESVYRKAAKIDKYMADNMDTCIIK
Ga0307387_1070701823300031737MarineEFAKHKDCFPGIDGEAFFVGTVMHSLDHTCMDNNLDDPMWLDVNHPKFGRMAEVGRIVKVGFVQDVPGLIFEKRFKGSKHPFYESVYRKAAKIDKYMADNMDTCIIK
Ga0307389_1063529513300031750MarineDHTCMDDNLDDPMWLDVNHPKFGRMAELGRIVKAGFVQDVPGLIFEKRFKGSKHPFYESVYKKAAKIDKYMADNMDTCIIK
Ga0307390_1084844823300033572MarineFVGTIMHSLDHTLMEWNLPDPLWLDVNNPRFGKMAELGRIVRVGFVQDVPFLYFNKRFKGSNHPFYKAVYDKAAKIDKELADHMDTCIVK

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.