NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F081960

Metagenome / Metatranscriptome Family F081960

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F081960
Family Type Metagenome / Metatranscriptome
Number of Sequences 113
Average Sequence Length 119 residues
Representative Sequence EIQTMEKRKAYIEQMTSYLNDRIRELNKVKRDLAAEQKWIQVSNQRIAELAQKEKLIKLQDVMSCIKNEQDRLMGERGTKTIAIQNMQKQAAQLENNIQTIRSKMDTITTGKAAAAASAS
Number of Associated Samples 75
Number of Associated Scaffolds 113

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Eukaryota
% of genes with valid RBS motifs 2.00 %
% of genes near scaffold ends (potentially truncated) 84.07 %
% of genes from short scaffolds (< 2000 bps) 88.50 %
Associated GOLD sequencing projects 68
AlphaFold2 3D model prediction Yes
3D model pTM-score0.44

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Eukaryota (85.841 % of family members)
NCBI Taxonomy ID 2759
Taxonomy All Organisms → cellular organisms → Eukaryota

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil
(85.841 % of family members)
Environment Ontology (ENVO) Unclassified
(67.257 % of family members)
Earth Microbiome Project Ontology (EMPO) Unclassified
(97.345 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 79.05%    β-sheet: 0.00%    Coil/Unstructured: 20.95%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.44
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 113 Family Scaffolds
PF04689S1FA 0.88



 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms85.84 %
UnclassifiedrootN/A14.16 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300012469|Ga0150984_112868903All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Prymnesiophyceae → Coccolithales → Coccolithaceae → Coccolithus → Coccolithus braarudii609Open in IMG/M
3300012469|Ga0150984_120933724All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Prymnesiophyceae → Coccolithales → Coccolithaceae → Coccolithus → Coccolithus braarudii523Open in IMG/M
3300020077|Ga0206351_10529861All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Prymnesiophyceae → Coccolithales → Coccolithaceae → Coccolithus → Coccolithus braarudii588Open in IMG/M
3300030530|Ga0210264_1074363All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Prymnesiophyceae → Coccolithales → Coccolithaceae → Coccolithus → Coccolithus braarudii659Open in IMG/M
3300030535|Ga0210285_1165690All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Prymnesiophyceae → Coccolithales → Coccolithaceae → Coccolithus → Coccolithus braarudii512Open in IMG/M
3300030535|Ga0210285_1267708All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Prymnesiophyceae → Coccolithales → Coccolithaceae → Coccolithus → Coccolithus braarudii607Open in IMG/M
3300030535|Ga0210285_1430381All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Prymnesiophyceae → Coccolithales → Coccolithaceae → Coccolithus → Coccolithus braarudii703Open in IMG/M
3300030542|Ga0210249_1194573All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Prymnesiophyceae → Coccolithales → Coccolithaceae → Coccolithus → Coccolithus braarudii686Open in IMG/M
3300030546|Ga0247646_1191770Not Available581Open in IMG/M
3300030547|Ga0247656_1072905All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Prymnesiophyceae → Coccolithales → Coccolithaceae → Coccolithus → Coccolithus braarudii697Open in IMG/M
3300030547|Ga0247656_1242668All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Prymnesiophyceae → Coccolithales → Coccolithaceae → Coccolithus → Coccolithus braarudii506Open in IMG/M
3300030548|Ga0210252_10015677All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Prymnesiophyceae → Coccolithales → Coccolithaceae → Coccolithus → Coccolithus braarudii699Open in IMG/M
3300030548|Ga0210252_10338869All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Prymnesiophyceae → Coccolithales → Coccolithaceae → Coccolithus → Coccolithus braarudii709Open in IMG/M
3300030548|Ga0210252_10907806All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Prymnesiophyceae → Coccolithales → Coccolithaceae → Coccolithus → Coccolithus braarudii502Open in IMG/M
3300030549|Ga0210257_10026371All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Prymnesiophyceae → Coccolithales → Coccolithaceae → Coccolithus → Coccolithus braarudii509Open in IMG/M
3300030549|Ga0210257_10048965All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Prymnesiophyceae → Coccolithales → Coccolithaceae → Coccolithus → Coccolithus braarudii725Open in IMG/M
3300030549|Ga0210257_10376376All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Prymnesiophyceae → Coccolithales → Coccolithaceae → Coccolithus → Coccolithus braarudii727Open in IMG/M
3300030549|Ga0210257_10666558All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Prymnesiophyceae → Coccolithales → Coccolithaceae → Coccolithus → Coccolithus braarudii686Open in IMG/M
3300030550|Ga0247631_1099317All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Prymnesiophyceae → Coccolithales → Coccolithaceae → Coccolithus → Coccolithus braarudii609Open in IMG/M
3300030551|Ga0247638_1086678All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Prymnesiophyceae → Coccolithales → Coccolithaceae → Coccolithus → Coccolithus braarudii680Open in IMG/M
3300030564|Ga0210256_10903712All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Prymnesiophyceae → Coccolithales → Coccolithaceae → Coccolithus → Coccolithus braarudii649Open in IMG/M
3300030569|Ga0247628_1147749All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Prymnesiophyceae → Coccolithales → Coccolithaceae → Coccolithus → Coccolithus braarudii644Open in IMG/M
3300030572|Ga0210258_10052988All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Prymnesiophyceae → Coccolithales → Coccolithaceae → Coccolithus → Coccolithus braarudii501Open in IMG/M
3300030572|Ga0210258_10188425All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Prymnesiophyceae → Coccolithales → Coccolithaceae → Coccolithus → Coccolithus braarudii593Open in IMG/M
3300030572|Ga0210258_10473416All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Prymnesiophyceae → Coccolithales → Coccolithaceae → Coccolithus → Coccolithus braarudii663Open in IMG/M
3300030572|Ga0210258_10519805All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Prymnesiophyceae → Coccolithales → Coccolithaceae → Coccolithus → Coccolithus braarudii764Open in IMG/M
3300030572|Ga0210258_10891008All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Prymnesiophyceae → Coccolithales → Coccolithaceae → Coccolithus → Coccolithus braarudii528Open in IMG/M
3300030581|Ga0210270_1338149All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Prymnesiophyceae → Coccolithales → Coccolithaceae → Coccolithus → Coccolithus braarudii671Open in IMG/M
3300030582|Ga0210261_1093611All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Prymnesiophyceae → Coccolithales → Coccolithaceae → Coccolithus → Coccolithus braarudii677Open in IMG/M
3300030583|Ga0210262_1240565All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Prymnesiophyceae → Coccolithales → Coccolithaceae → Coccolithus → Coccolithus braarudii525Open in IMG/M
3300030586|Ga0265393_1101538All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Prymnesiophyceae → Coccolithales → Coccolithaceae → Coccolithus → Coccolithus braarudii651Open in IMG/M
3300030588|Ga0210283_1521787All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Prymnesiophyceae → Coccolithales → Coccolithaceae → Coccolithus → Coccolithus braarudii701Open in IMG/M
3300030589|Ga0210255_10144208All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Prymnesiophyceae → Coccolithales → Coccolithaceae → Coccolithus → Coccolithus braarudii679Open in IMG/M
3300030589|Ga0210255_10263504Not Available554Open in IMG/M
3300030591|Ga0247626_1077403All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Prymnesiophyceae → Coccolithales → Coccolithaceae → Coccolithus → Coccolithus braarudii797Open in IMG/M
3300030594|Ga0210280_1162086All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Prymnesiophyceae → Coccolithales → Coccolithaceae → Coccolithus → Coccolithus braarudii545Open in IMG/M
3300030596|Ga0210278_1096964All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Prymnesiophyceae → Coccolithales → Coccolithaceae → Coccolithus → Coccolithus braarudii657Open in IMG/M
3300030596|Ga0210278_1191060All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Prymnesiophyceae → Coccolithales → Coccolithaceae → Coccolithus → Coccolithus braarudii527Open in IMG/M
3300030597|Ga0210286_1144713All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Prymnesiophyceae → Coccolithales → Coccolithaceae → Coccolithus → Coccolithus braarudii675Open in IMG/M
3300030601|Ga0247650_1087961Not Available602Open in IMG/M
3300030602|Ga0210254_10707446All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Prymnesiophyceae → Coccolithales → Coccolithaceae → Coccolithus → Coccolithus braarudii556Open in IMG/M
3300030602|Ga0210254_11172215All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Prymnesiophyceae → Coccolithales → Coccolithaceae → Coccolithus → Coccolithus braarudii686Open in IMG/M
3300030603|Ga0210253_11155151All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Prymnesiophyceae → Coccolithales → Coccolithaceae → Coccolithus → Coccolithus braarudii717Open in IMG/M
3300030605|Ga0210265_1043692All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Prymnesiophyceae → Coccolithales → Coccolithaceae → Coccolithus → Coccolithus braarudii758Open in IMG/M
3300030608|Ga0247651_10175918All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Prymnesiophyceae → Coccolithales → Coccolithaceae → Coccolithus → Coccolithus braarudii634Open in IMG/M
3300030609|Ga0247634_10291765All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Prymnesiophyceae → Coccolithales → Coccolithaceae → Coccolithus → Coccolithus braarudii644Open in IMG/M
3300030610|Ga0247613_10273755All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Prymnesiophyceae → Coccolithales → Coccolithaceae → Coccolithus → Coccolithus braarudii627Open in IMG/M
3300030614|Ga0247657_10310184All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Prymnesiophyceae → Coccolithales → Coccolithaceae → Coccolithus → Coccolithus braarudii502Open in IMG/M
3300030623|Ga0265392_1077716All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Prymnesiophyceae → Coccolithales → Coccolithaceae → Coccolithus → Coccolithus braarudii712Open in IMG/M
3300030623|Ga0265392_1110499All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Prymnesiophyceae → Coccolithales → Coccolithaceae → Coccolithus → Coccolithus braarudii653Open in IMG/M
3300030623|Ga0265392_1212606All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Prymnesiophyceae → Coccolithales → Coccolithaceae → Coccolithus → Coccolithus braarudii541Open in IMG/M
3300030624|Ga0210251_10494040All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Prymnesiophyceae → Coccolithales → Coccolithaceae → Coccolithus → Coccolithus braarudii712Open in IMG/M
3300030624|Ga0210251_10776554All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Prymnesiophyceae → Coccolithales → Coccolithaceae → Coccolithus → Coccolithus braarudii659Open in IMG/M
3300030624|Ga0210251_11132596All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Prymnesiophyceae → Coccolithales → Coccolithaceae → Coccolithus → Coccolithus braarudii594Open in IMG/M
3300030625|Ga0210259_11172583All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Prymnesiophyceae → Coccolithales → Coccolithaceae → Coccolithus → Coccolithus braarudii549Open in IMG/M
3300030626|Ga0210291_10203064All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Prymnesiophyceae → Coccolithales → Coccolithaceae → Coccolithus → Coccolithus braarudii537Open in IMG/M
3300030626|Ga0210291_10419893All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Prymnesiophyceae → Coccolithales → Coccolithaceae → Coccolithus → Coccolithus braarudii680Open in IMG/M
3300030626|Ga0210291_10803254All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Prymnesiophyceae → Coccolithales → Coccolithaceae → Coccolithus → Coccolithus braarudii697Open in IMG/M
3300030629|Ga0210268_1139324All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Prymnesiophyceae → Coccolithales → Coccolithaceae → Coccolithus → Coccolithus braarudii720Open in IMG/M
3300030629|Ga0210268_1153395All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Prymnesiophyceae → Coccolithales → Coccolithaceae → Coccolithus → Coccolithus braarudii698Open in IMG/M
3300030629|Ga0210268_1171299All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Prymnesiophyceae → Coccolithales → Coccolithaceae → Coccolithus → Coccolithus braarudii672Open in IMG/M
3300030630|Ga0210282_10079324All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Prymnesiophyceae → Coccolithales → Coccolithaceae → Coccolithus → Coccolithus braarudii828Open in IMG/M
3300030630|Ga0210282_10191672All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Prymnesiophyceae → Coccolithales → Coccolithaceae → Coccolithus → Coccolithus braarudii654Open in IMG/M
3300030630|Ga0210282_10296936All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Prymnesiophyceae → Coccolithales → Coccolithaceae → Coccolithus → Coccolithus braarudii568Open in IMG/M
3300030631|Ga0210279_10202630All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Prymnesiophyceae → Coccolithales → Coccolithaceae → Coccolithus → Coccolithus braarudii706Open in IMG/M
3300030631|Ga0210279_10208475All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Prymnesiophyceae → Coccolithales → Coccolithaceae → Coccolithus → Coccolithus braarudii700Open in IMG/M
3300030631|Ga0210279_10299606All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Prymnesiophyceae → Coccolithales → Coccolithaceae → Coccolithus → Coccolithus braarudii616Open in IMG/M
3300030682|Ga0247622_1094009All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Prymnesiophyceae → Coccolithales → Coccolithaceae → Coccolithus → Coccolithus braarudii663Open in IMG/M
3300030684|Ga0247617_1084225All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Prymnesiophyceae → Coccolithales → Coccolithaceae → Coccolithus → Coccolithus braarudii581Open in IMG/M
3300030738|Ga0265462_11076381All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Prymnesiophyceae → Coccolithales → Coccolithaceae → Coccolithus → Coccolithus braarudii702Open in IMG/M
3300030738|Ga0265462_11469988All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Prymnesiophyceae → Coccolithales → Coccolithaceae → Coccolithus → Coccolithus braarudii632Open in IMG/M
3300030738|Ga0265462_12086547All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Prymnesiophyceae → Coccolithales → Coccolithaceae → Coccolithus → Coccolithus braarudii554Open in IMG/M
3300030740|Ga0265460_12012969All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Prymnesiophyceae → Coccolithales → Coccolithaceae → Coccolithus → Coccolithus braarudii601Open in IMG/M
3300030743|Ga0265461_12095169All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Prymnesiophyceae → Coccolithales → Coccolithaceae → Coccolithus → Coccolithus braarudii650Open in IMG/M
3300030804|Ga0102769_10871469All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Prymnesiophyceae → Coccolithales → Coccolithaceae → Coccolithus → Coccolithus braarudii640Open in IMG/M
3300030846|Ga0075403_11563541All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Prymnesiophyceae → Coccolithales → Coccolithaceae → Coccolithus → Coccolithus braarudii636Open in IMG/M
3300030848|Ga0075388_11599398All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Prymnesiophyceae → Coccolithales → Coccolithaceae → Coccolithus → Coccolithus braarudii661Open in IMG/M
3300030853|Ga0075372_11269799All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Prymnesiophyceae → Coccolithales → Coccolithaceae → Coccolithus → Coccolithus braarudii693Open in IMG/M
3300030923|Ga0138296_1556975All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Prymnesiophyceae → Coccolithales → Coccolithaceae → Coccolithus → Coccolithus braarudii600Open in IMG/M
3300030934|Ga0075391_11335043All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Prymnesiophyceae → Coccolithales → Coccolithaceae → Coccolithus → Coccolithus braarudii692Open in IMG/M
3300030945|Ga0075373_11441317All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Prymnesiophyceae → Coccolithales → Coccolithaceae → Coccolithus → Coccolithus braarudii515Open in IMG/M
3300030947|Ga0075390_10046238All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Prymnesiophyceae → Coccolithales → Coccolithaceae → Coccolithus → Coccolithus braarudii636Open in IMG/M
3300030968|Ga0075376_11367992All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Prymnesiophyceae → Coccolithales → Coccolithaceae → Coccolithus → Coccolithus braarudii511Open in IMG/M
3300030971|Ga0075375_11915466All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Prymnesiophyceae → Coccolithales → Coccolithaceae → Coccolithus → Coccolithus braarudii651Open in IMG/M
3300030972|Ga0075400_11682812All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Prymnesiophyceae → Coccolithales → Coccolithaceae → Coccolithus → Coccolithus braarudii607Open in IMG/M
3300030999|Ga0074019_11152804All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Prymnesiophyceae → Coccolithales → Coccolithaceae → Coccolithus → Coccolithus braarudii686Open in IMG/M
3300031049|Ga0074036_11190211All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Prymnesiophyceae → Coccolithales → Coccolithaceae → Coccolithus → Coccolithus braarudii504Open in IMG/M
3300031122|Ga0170822_12321025All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Prymnesiophyceae → Coccolithales → Coccolithaceae → Coccolithus → Coccolithus braarudii693Open in IMG/M
3300031128|Ga0170823_12756386All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Prymnesiophyceae → Coccolithales → Coccolithaceae → Coccolithus → Coccolithus braarudii645Open in IMG/M
3300031128|Ga0170823_17550953All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Prymnesiophyceae → Coccolithales → Coccolithaceae → Coccolithus → Coccolithus braarudii553Open in IMG/M
3300031231|Ga0170824_102821366All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Prymnesiophyceae → Coccolithales → Coccolithaceae → Coccolithus → Coccolithus braarudii592Open in IMG/M
3300031231|Ga0170824_105613917All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Prymnesiophyceae → Coccolithales → Coccolithaceae → Coccolithus → Coccolithus braarudii689Open in IMG/M
3300031231|Ga0170824_122267089All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Prymnesiophyceae → Coccolithales → Coccolithaceae → Coccolithus → Coccolithus braarudii595Open in IMG/M
3300031446|Ga0170820_11262760All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Prymnesiophyceae → Coccolithales → Coccolithaceae → Coccolithus → Coccolithus braarudii782Open in IMG/M
3300031446|Ga0170820_13368765All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Prymnesiophyceae → Coccolithales → Coccolithaceae → Coccolithus → Coccolithus braarudii593Open in IMG/M
3300031469|Ga0170819_17014295All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Prymnesiophyceae → Coccolithales → Coccolithaceae → Coccolithus → Coccolithus braarudii698Open in IMG/M
3300031474|Ga0170818_114928809All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Prymnesiophyceae → Coccolithales → Coccolithaceae → Coccolithus → Coccolithus braarudii786Open in IMG/M
3300032739|Ga0315741_11324143All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Prymnesiophyceae → Coccolithales → Coccolithaceae → Coccolithus → Coccolithus braarudii645Open in IMG/M
3300032756|Ga0315742_11796137All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Prymnesiophyceae → Coccolithales → Coccolithaceae → Coccolithus → Coccolithus braarudii673Open in IMG/M
3300032756|Ga0315742_11812425All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Prymnesiophyceae → Coccolithales → Coccolithaceae → Coccolithus → Coccolithus braarudii671Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil85.84%
Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil11.50%
Avena Fatua RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere1.77%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere0.89%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300012469Combined assembly of Soil carbon rhizosphereHost-AssociatedOpen in IMG/M
3300020077Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300030530Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO144-ARE041SO (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030531Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO143-VCO038SO (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030535Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO749-VDE026SO (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030539Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO151-VCO111SO (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030542Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO132-ANR003SO (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030543Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO410-VDE107SO (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030546Metatranscriptome of soil fungal communities from truffle orchard in Rollainville, France - Cnb11 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030547Metatranscriptome of soil fungal communities from truffle orchard in Rollainville, France - Db9 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030548Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO133-ANR016SO (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030549Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO137-ANR102SO (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030550Metatranscriptome of soil fungal communities from truffle orchard in Rollainville, France - Bb8 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030551Metatranscriptome of soil fungal communities from truffle orchard in Rollainville, France - Cb3 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030564Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO133-ANR020S0 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030569Metatranscriptome of soil fungal communities from truffle orchard in Rollainville, France - Bnb5 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030572Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO137-ANR103SO (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030573Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO143-VCO036SO (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030577Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO131-ARE010SO (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030581Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO142-VCO031SO (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030582Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO145-ARE022SO (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030583Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO145-ARE023SO (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030586Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO144-ARE041SO (Eukaryote Community Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300030588Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO740-VDE011SO (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030589Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO133-ANR019SO (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030591Metatranscriptome of soil fungal communities from truffle orchard in Rollainville, France - Bb3 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030594Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO141-VCO089SO (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030595Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO135-VCO083SO (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030596Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO135-VCO085SO (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030597Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO747-VDE046SO (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030601Metatranscriptome of soil fungal communities from truffle orchard in Rollainville, France - Db3 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030602Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO133-ANR018SO (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030603Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO133-ANR017SO (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030605Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO144-ARE042SO (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030608Metatranscriptome of soil fungal communities from truffle orchard in Rollainville, France - Dnb4 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030609Metatranscriptome of soil fungal communities from truffle orchard in Rollainville, France - Bnb11 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030610Metatranscriptome of soil fungal communities from truffle orchard in Rollainville, France - Ab2 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030614Metatranscriptome of soil fungal communities from truffle orchard in Rollainville, France - Dnb10 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030623Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO144-ARE043SO (Eukaryote Community Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300030624Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO132-ANR005SO (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030625Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO122-ANR120SO (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030626Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO410-VDE110SO (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030627Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO153-ARE095SO (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030629Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO153-ARE093SO (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030630Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO151-VCO115SO (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030631Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO141-VCO086SO (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030632Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO132-ANR004SO (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030682Metatranscriptome of soil fungal communities from truffle orchard in Rollainville, France - Anb11 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030684Metatranscriptome of soil fungal communities from truffle orchard in Rollainville, France - Anb6 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030738Forest Soil Metatranscriptomes Boreal Montmorency Forest, Quebec, Canada VDE Co-assemblyEnvironmentalOpen in IMG/M
3300030740Forest Soil Metatranscriptomes Boreal Montmorency Forest, Quebec, Canada ARE Co-assemblyEnvironmentalOpen in IMG/M
3300030743Forest Soil Metatranscriptomes Boreal Montmorency Forest, Quebec, Canada VCO Co-assemblyEnvironmentalOpen in IMG/M
3300030776Forest soil microbial communities from France for metatranscriptomics studies - Site 11 - Champenoux / Amance forest - FA10 Emin (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030804Forest soil microbial communities from USA, for metatranscriptomics studies - Jemez Pines PO 4B (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030846Forest soil microbial communities from France for metatranscriptomics studies - Site 11 - Champenoux / Amance forest - FB5 EcM (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030848Forest soil microbial communities from France for metatranscriptomics studies - Site 11 - Champenoux / Amance forest - OA8 EcM (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030853Forest soil microbial communities from France for metatranscriptomics studies - Site 11 - Champenoux / Amance forest - OA8 Emin (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030917Forest soil microbial communities from France for metatranscriptomics studies - Site 11 - Champenoux / Amance forest - FB5 Emin (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030923Forest soil microbial communities from Spain - ITS-tags Site 9-Mixed-thinned forest site A3_MS_autumn Metatranscriptome (Eukaryote Community Metatranscriptome) (version 2)EnvironmentalOpen in IMG/M
3300030934Forest soil microbial communities from France for metatranscriptomics studies - Site 11 - Champenoux / Amance forest - OB3 Emin (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030945Forest soil microbial communities from France for metatranscriptomics studies - Site 11 - Champenoux / Amance forest - FA10 EcM (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030947Forest soil microbial communities from France for metatranscriptomics studies - Site 11 - Champenoux / Amance forest - OB3 EcM (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030968Forest soil microbial communities from France for metatranscriptomics studies - Site 11 - Champenoux / Amance forest - FB6 EcM (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030971Forest soil microbial communities from France for metatranscriptomics studies - Site 11 - Champenoux / Amance forest - FA12 SO (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030972Forest soil microbial communities from France for metatranscriptomics studies - Site 11 - Champenoux / Amance forest - FB4 SO (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030999Metatranscriptome of forest soil microbial communities from Dalarna County, Sweden - Site 2 - LB 7 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031049Metatranscriptome of forest soil microbial communities from Dalarna County, Sweden - Site 2 - Mineral C2 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031122Oak Spring Coassembly Site 11 - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031128Oak Summer Coassembly Site 11 - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031231Coassembly Site 11 (all samples) - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031446Fir Summer Coassembly Site 11 - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031469Fir Spring Coassembly Site 11 - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031474Fir Coassembly Site 11 - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300032739Forest Soil Metatranscriptomics Site 2 LB Combined AssemblyEnvironmentalOpen in IMG/M
3300032756Forest Soil Metatranscriptomics Site 2 Humus Litter Mineral Combined AssemblyEnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
Ga0150984_11286890323300012469Avena Fatua RhizosphereQTMEKRKAYIEQMTQYLNDRIRELNKVKRDLAAEQKWIQVSNQRIAELAQKEKLIKLQDVMSCIKNEQDRLMGERGTKTIAIQNMQKQAATLENNIKTIRRKMETITTGKAGESSGSG*
Ga0150984_12093372413300012469Avena Fatua RhizosphereKQIGMSIMYEIQTMEKRKAYIEQMTAYLNDRIRELNKVKRDLAAEQKWIAVSNQRIAELAQKEKLIKLQDVMACIKSEQARLQGEKGSKAAALTSMGKQAASLEANIKAIRSQMEKVAVNAGANAAGNPADKAEGDF*
Ga0206351_1052986113300020077Corn, Switchgrass And Miscanthus RhizosphereEIQTMEKRKAYIEQMTAYLNDRIRELNKVKRDLAAEQKWIQVSNQRIAELAQKEKLIKLQDVMSCIKTEQDRLMGERGTKNQAILSMQHQATELENNIKAIRHKMDEITTGAAHAGESAAAAK
Ga0210264_107436313300030530SoilSYLNDRIRELNKVKRDLAAEQKWIQVSNQRIAELAQKEKLIKLPDVMSCIKNEQARLMGERGTKTIAIQNMQKQAAQLENNIKTIRGKMDTITTGKAEGAPAS
Ga0210274_132996913300030531SoilRELNKVKRDLAAEQKWIQVSNQRIAELAQKEKLIKLQDVMSCIKNEQDRLQGERGTKTVAIANMAKQAATLENNIKGIRAKMESITAGKAGAAAPGGDSSF
Ga0210285_116569013300030535SoilEIQTMEKRKAYIEQMTSYLNDRIRELNKVKRDLAAEQKWIQVSNQRIAELSQKEKLIKLQDVMSCIKNEQDRLMGERGTKTQAIAAMQKQAATLENNIKSIRDKMSSITSGKAGGGGGESSGAL
Ga0210285_126770823300030535SoilIQTMEKRKAYIEQMTSYLNDRIRELNKVKRDLAAEQKWIQVSNQRIAELAQKEKLIKLQDVMSCIKNEQDRLMGERGTKTIAIQNMQKQAAQLENNIKTIRGKMDTITTGKAEGAPAS
Ga0210285_143038113300030535SoilIMYEIQTMEKRKAYIEQMTSYLNDRILELNKVKRDLAAEQKWIQVSNQRIAELAQKEKLIKLQDVMSCIKGEQDRLMGERGTKTIAIQNMQKQAGQLESNIKSIRDKMESITTGTGGAHAAGSASTF
Ga0210281_137194613300030539SoilIQTMEKRKAYIEQMTSYLNDRIRELNKVKRDLSAEQKWIQISNKRISELAQKEKLIKLQDVMSCIRSEQERLQGEKGTKVTTLLSMNKQASDLEQSIKSIRDSMNRITVKAGADAAGIAAPPASSS
Ga0210249_119457313300030542SoilSYLNDRIRQLNKVKRDLAAEQKWIQVSNQRISELAQKEKLIKLQDVMSCIKNEQDRLLGERGTKSVAIANMAKQAATLENNIKGIRAKMESITGGKAAAGGSDSAGGF
Ga0210289_100935913300030543SoilVKRDLAAEQKWIQVSNQRIAELAQKEKLIKLQDVMSCIKNEQDRLQGERGTKTVAIANMAKQAATLENNIKGIRAKMESITAGKAGAAAPGGDSSF
Ga0210289_131661213300030543SoilELNKVKRDLAAEQKWIQVSNQRIAELAQKEKLIKLQDVMSCIKNEQDRLQGERGTKTVAIANMAKQAATLENNIKGIRAKMESITAGKAGAAAPGGDSSF
Ga0247646_119177013300030546SoilLNDRIRELNKVKRDLAAEQKWIQVSNQRIAELAQKEKLIKLQDVMSCIKNEQDRLMGERGTKTIAIQNMQKQAAQLENNIQTIRSKMDTITTGKAAAAASASS
Ga0247656_107290523300030547SoilCLSIMYEIQTMEKRKAYIEQMTSYLNDRIRELNKVKRDLAAEQKWIQVSNQRIAELAQKEKLIKLQDVMSCIKNEQDRLMGERGTKTIAIQNMQKQAAQLENNIQTIRSKMDTITTGKAAAAASASS
Ga0247656_124266813300030547SoilQMTAYLNDRIRELNKVKRDLGAEQKWIQVSNQRIAELAQKEKLIKLQDVMSCIKNEQDRLMGERGTKTIAIQNMQKQAAQLQSNIQTIRTKMETITSGKAAAAAEPAASS
Ga0210252_1001567713300030548SoilIGLAIMYEIQTMEKRKAYIEQMTSYLNDRIRELNKVKRDLAAEQKWIQVSNQRIAELAQKEKLIKLQDVMSCIKNEQDRLQGERGTKTVAIANMAKQAATLENNIKGIRAKMESITAGKAGAAAPGGDSSF
Ga0210252_1033886923300030548SoilSYLNDRIRELNKVKRDLAAEQKWIQVSNQRIAELAQKEKLIKLQDVMSCIKNEQDRLMGERGTKTIAIQNMQKQAAVLENNIKTIRSKMESITSGKAASAGSGSGSSA
Ga0210252_1090780613300030548SoilQMTSYLNDRIRELNKVKRDLAAEQKWIQVSNQRIAELAQKEKLIKLQDVMSCIKNEQDRLMGERGTKTIAIQNMQKQAAQLEQNIKTIRGKMDIITTGKAEAPQAST
Ga0210257_1002637113300030549SoilKRKAYIEQMTSYLNDRIRELNKVKRDLAAEQKWIQVSNQRIAELSQKEKLIKLQDVMSCIKNEQDRLMGERGTKTIAIQNMQKQAAQLQSNIASIRGKMDSITSGSKSEAAPAASS
Ga0210257_1004896513300030549SoilQIGLSIMYEIQTMEKRKAYIEQMTSYLNDRIRELNKVKRDLAAEQKWIQVSNQRIAELAQKEKLIKLQDVMSCIKGEQDRLMGERGTKTIAIQNMQKQAGQLESNIKSIRDKMESITTGTGGAHAAGSASTF
Ga0210257_1037637613300030549SoilSIMYEIQTMEKRKAYIEQMTSYLNDRIRELNKVKRDLAAEQKWIQVSNQRISELAQKEKLIKLQDVMSCIKNEQDRLLGERGTKSVAIANMAKQAATLENNIKGIRAKMESITGGKAAAGGSDSAGGF
Ga0210257_1066655813300030549SoilADAKQIGLSIMYEIQTMEKRKAYIEQMTSYLNDRIRELNKVKRDLAAEQKWIQVSNQRIAELAQKEKLIKLQDVMSCIKNEQDRLMGERGTKTIAIQNMQKQAAVLENNIKTIRSKMESITSGKAAGGGSGSSSA
Ga0247631_109931713300030550SoilEQMTSYLNDRIRELNKVKRDLAAEQKWIQVSNQRIAELAQKEKLIKLQDVMSCIKNEQDRLMGERGTKTIAIQNMQKQAAQLENNIQTIRSKMDTITTGKAAAAASASS
Ga0247638_108667813300030551SoilDAKQIGMSIMYEIQTMEKRKAYIEQMTSYLNDRIRELNKVKRDLAAEQKWIQVSNQRIAELAQKEKLIKLQDVMSCIKNEQDRLMGERGTKTIAIQNMQKQAAQLENNIQTIRSKMDTITTGKAAAAASASS
Ga0210256_1090371213300030564SoilAYIEQMTSYLNDRIRELNKVKRDLAAEQKWIQVSNQRIAELAQKEKLIKLQDVMSCIKGEQDRLMGERGTKTIAIQNMQKQAGQLESNIKSIRDKMESITTGTGGAHAAGSASTF
Ga0247628_114774923300030569SoilMTSYLNDRIRELNKVKRDLAAEQKWIQVSNQRIAELAQKEKLIKLQDVMSCIKNEQDRLMGERGTKTQAIANMAKQAATLEANIKSIRNKMKTITSGKGGAESESAAAL
Ga0210258_1005298813300030572SoilTSYLNDRIRELNKVKRDLAAEQKWIQVSNQRIAELSQKEKLIKLQDVMSCIKNEQDRLMGERGTKTIAIQNMQKQAAQLQQNIATIRGKMESITSGSKAEAPAGSSGSF
Ga0210258_1018842523300030572SoilYLNDRIRELNKVKRDLAAEQKWIQVSNQRIAELAQKEKLIKLQDVMSCIKNEQDRLMGERGTKTVAIQNMQKQAAQLENNIKTIRGKMESITSGKAAGSGSSA
Ga0210258_1047341613300030572SoilYLNDRIRELNKVKRDLAAEQKWIQVSNQRISELAQKEKLIKLQDVMSCIKNEQDRLLGERGTKSVAIANMAKQAATLENNIKGIRAKMESITGGKAAAGGSDSAGGF
Ga0210258_1051980513300030572SoilMEKRKAYIEQMTSYLHDRIRELNKVKRDLAAEQKWIQVSNQRIAELAQKEKLIKLQDVMSCIKNEQDRLMGERGTKTIAIQNMQKQAAVLENNIKTIRSKMESITSGKAASAGSGSGSSA
Ga0210258_1089100813300030572SoilEKRKAYIEQMTSYLNDRIRELNKVKRDLAAEQRWIQVSNQRIAELAQKEKLIKLQDVMSCIKNEQDRLMGERGTKTTAIQNMQKQAAQLESNIKSIRGKMDQITTGKKGGGGSESA
Ga0210272_117965913300030573SoilLNKVKRDLAAEQKWIQVSNQRIAELAQKEKLIKLQDVMSCIKNEQDRLQGERGTKTVAIANMAKQAATLENNIKGIRAKMESITAGKAGAAAPGGDSSF
Ga0210260_1020504813300030577SoilRIRELNKVKRDLAAEQKWIQVSNQRISELAQKEKLIKLQDVMSCIKNEQDRLLGERGTKSVAIANMAKQAATLENNIKGIRAKMESITGGKAAAGGSDSAGGF
Ga0210260_1022126413300030577SoilIRELNKVKRDLAAEQKWIQVSNQRIAELAQKEKLIKLQDVMSCIKGEQDRLMGERGTKTIAIQNMQKQAGQLESNIKSIRDKMESITTGTGGAHAAGSASTF
Ga0210270_133814913300030581SoilKQIGLSIMYEIQTMEKRKAYIEQMTSYLNDRIRELNKVKRDLAAEQKWIQVSNQRIAELAQKEKLIKLQDVMSCIKNEQDRLMGERGTKTIAIQNMQKQAAVLENNIKTIRSKMESITSGKAASAGSGSGSSA
Ga0210261_109361113300030582SoilRSNMYENQTMEKRKAYIEQMTSYLNDRIRELNKVKRDLAAEQKWIQVSNQRIAELAQKEKLIKLQDVMSCIKNEQDRLQGERGTKTVAIANMAKQAATLENNIKGIRAKMESITAGKAGAAAPGGDSSF
Ga0210262_124056513300030583SoilMYEIQTMEKRKAYIEQMTSYLNDRIRELNKVKRDLAAEQKWIQVSNQRIAELSQKEKLIKLQDVMSCIKNEQDRLMGERGTKTIAIQNMQKQAAQLQSNIASIRGKMDSITSGSKSEAAPAASS
Ga0265393_110153813300030586SoilYLNDRIRELNKVKRDLAAEQKWIQVSNQRIAELAQKEKLIKLQDVMSCIKGEQDRLMGERGTKTIAIQNMQKQAGQLESNIKSIRDKMESITTGTGGAHAAGSASTF
Ga0210283_152178713300030588SoilMEKRKAYIEQMTSYLNDRIRELNKVKRDLAAEQKWIQVSNQRISELAQKEKLIKLQDVMSCIKNEQDRLLGERGTKSVAIANMAKQAATLENNIKGIRAKMESITGGKAAAGGSDSAGGF
Ga0210255_1014420813300030589SoilEQMTSYLNDRIRELNKVKRDLAAEQKWIQVSNQRISELAQKEKLIKLQDVMSCIKNEQDRLLGERGTKSVAIANMAKQAATLENNIKGIRAKMESITGGKAAAGGSDSAGGF
Ga0210255_1026350413300030589SoilIRELNKVKRDLAAEQKWIQVSNQRIAELAQKEKLIKLQDVMSCIKNEQDRLMGERGTKTIAIQNMQKQAAVLENNIKTIRSKMESITSGKAASAGSGSGSSA
Ga0247626_107740323300030591SoilADAKQIGLSIMYEIQTMEKRKAYIEQMTAYLNDRIRELNKVKRDLAAEQKWIQVSNQRIAELAQKEKLIKLQDVMSCIKTEQDRLMGERGTKNQAIQAMAHQAAQLEHNIKTIRSKMDEITSGHHGESSGSK
Ga0210280_116208613300030594SoilIMYEIQTMEKRKAYIEQMTSYLNDRIRELNKVKRDLLAEQKWIQVSNQRIAELAQKEKLIKLQDVMSCIKMEQERLNGDRTTKTIAIGNLAQQAAQLESNIRQIRQRMQTITNGAAPEHSGSSSA
Ga0210276_1046975013300030595SoilDRIRELNKVKRDLAAEQKWIQVSNQRIAELAQKEKLIKLQDVMSCIKGEQDRLMGERGTKTIAIQNMQKQAGQLESNIKSIRDKMESITTGTGGAHAAGSASTF
Ga0210278_109696413300030596SoilYIEQMTSYLNDRIRELNKVKRDLAAEQKWIQVSNQRIAELAQKEKLIKLQDVMSCIKNEQDRLQGERGTKTVAIANMAKQAATLENNIKGIRAKMESITAGKAGAAAPGGDSSF
Ga0210278_119106013300030596SoilIMYEIQTMEKRKAYIEQMTSYLNDRIRELNKVKRDLAAEQKWIQVSNQRIAELAQKEKLIKLQDVMSCIKNEQDRLMGERGTKTIAIQNMQKQAAQLQSNIASIRGKMDSITSGSKSEAAPAASS
Ga0210286_114471323300030597SoilAYIEQMTSYLNDRIRELNKVKRDLAAEQKWIQVSNQRIAELAQKEKLIKLQDVMSCIKNEQDRLMGERGTKTIAIQNMQKQAAQLENNIKTIRGKMDTITTGKAEGAPAS
Ga0247650_108796113300030601SoilVKRDLAAEQKWIQVSNQRIAELAQKEKLIKLQDVMSCIKNEQDRLMGERGTKTIAIQNMQKQAAQLENNIQTIRSKMDTITTGKAAAAASASS
Ga0210254_1070744613300030602SoilTIFEIRKMRADAKQIGLSIMYEIQTMEKRKAYIEQMTSYLNDRIRELNKVKRDLAAEQKWIQVSNQRIAELSQKEKLIKLQDVMSCIKNEQDRLMGERGTKTQAIAAMQKQAATLENNIKSIRDKMSSITSGKAGGGGGESSGAL
Ga0210254_1117221513300030602SoilEIQTMEKRKAYIEQMTSYLNDRIRELNKVKRDLAAEQKWIQVSNQRIAELAQKENLIKLQDVMSCIKNEQDRLQGERGTKTVAIANMAKQAATLENNIKGIRAKMESITAGKAGAAAPGGDSSF
Ga0210253_1115515113300030603SoilYEIQTMEKRKAYIEQMTSYLNDRIRELNKVKRDLAAEQKWIQVSNQRISELAQKEKLIKLQDVMSCIKNEQDRLLGERGTKSVAIANMAKQAATLENNIKGIRAKMESITGGKAAAGGSDSAGGF
Ga0210265_104369213300030605SoilFEIRKMRADAKQIGLSIMYEIQTMEKRKAYIEQMTSYLNDRIRELNKVKRDLAAEQKWIQVSNQRIAELAQKEKLIKLQDVMSCIKGEQDRLMGERGTKTIAIQNMQKQAGQLESNIKSIRDKMESITTGTGGAHAAGSASTF
Ga0247651_1017591813300030608SoilEIQTMEKRKAYIEQMTSYLNDRIRELNKVKRDLAAEQKWIQVSNQRIAELAQKEKLIKLQDVMSCIKNEQDRLMGERGTKTIAIQNMQKQAAQLENNIQTIRSKMDTITTGKAAAAASAS
Ga0247634_1029176513300030609SoilGLSIMYEIQTMEKRKSYIEQMTSYLNDRIRELNKVKRDLAAEQKWIQVSNQRIAELAQKEKLIKLQDVMSCIKNEQDRLMGERGTKTIAIQNMQKQAAQLENNIQTIRSKMDTITTGKAAAAASASS
Ga0247613_1027375513300030610SoilEQMTSYLNDRIRELNKVKRDLSAEQKWIQVSNQRIAELAQKEKLIKLQDVMSCIKNEQDRLMGERGTKTIAIQNMQKQAAQLQQNIASIRGKMETITAGKSAAAPAASAAEPAQSA
Ga0247657_1031018413300030614SoilAYIEQMTSYLNDRIRELNKVKRDLAAEQKWIQVSNQRIAELAQKEKLIKLQDVMSCIKNEQDRLMGERGTKTQAIANMAKQAATLEANIKSIRNKMKTITSGKGGAESESAAAL
Ga0265392_107771623300030623SoilMYEIQTMEKRKAYIEQMTSYLNDRIRELNKVKRDLAAEQKWIQVSNQRIAELAQKEKLIKLQDVMSCIKNEQDRLMGERGTKTIAIQNMQKQAAVLENNIKTIRSKMESITSGKAAGGGSGSSSA
Ga0265392_111049913300030623SoilTSYLNDRIRELNKVKRDLAAEQKWIQVSNQRIAELAQKEKLIKLQDVMSCIKGEQDRLMGERGTKTIAIQNMQKQAGQLESNIKSIRDKMESITTGTGGAHAAGSASTF
Ga0265392_121260623300030623SoilEIQTMEKRKAYIERMTSYLNDRIRELNKVKRDLAAEQKWIQVSNQRIAELAQKEKLIKLQDVMSCIKNEQDRLMGERGTKTIAIQNMQKQAAQLQSNIASIRGKMDSITSGSKSEAAPAASS
Ga0210251_1049404013300030624SoilTIFEIRKMRADAKQIGLSIMYEIQTMEKRKAYIEQMTSYLNDRIRELNKVKRDLAAEQKWIQVSNQRIAELAQKEKLIKLQDVMSCIKNEQDRLMGERGTKTIAIQNMQKQAAVLENNIKTIRSKMESITSGKAASAGSGSGSSA
Ga0210251_1077655413300030624SoilMTSYLNDRIRELNKVKRDLAAEQKWIQVSNQRIAELAQKEKLIKLQDVMSCIKNEQDRLMGERGTKTIAIQNMQKQAAQLENNIKTIRGKMDTITTGKAEGAPAS
Ga0210251_1113259613300030624SoilQIGLSIMYEVQTMEKRKAYVEQMTMYLNDRIRELNKVKRDLAAEQKWIQISNERIAELAQKEKLIKLQDVMSCIRNEQDRLMGERGTKTEAISSMQKQAATLENNIKSIRSKMEAITSGKIITGSSESSAH
Ga0210259_1117258313300030625SoilMYEIQTMEKRKAYIEQMTSYLNDRIRELNKVKRDLAAEQKWIQVSNQRIAELAQKEKLIKLQDVMSCIKNEQDRLMGERGTKTIAIQNMQKQAAQLQSNIASIRGKMDSITSGSKSEAAPAASS
Ga0210291_1020306413300030626SoilADAKQIGLSIMYEIQTMEKRKAYIEQMTSYLNDRIRELNKVKRDLAAEQKWIQVSNQRIAELAQKEKLIKLQDVMSCIKNEQDRLQGERGTKTVAIANMAKQAATLENNIKGIRAKMESITAGKAGAAAPGGDSSF
Ga0210291_1041989323300030626SoilGLSIMYEIQTMEKRKAYIEQMTAYLNDRIRELNKVKRDLAAEQKWIQVSNQRIAELAQKEKLIKLQDVMSCIKMEQDRLTGERTTKTIAIGNLAQQAQQLESNIKAIRSRMDAITHTGQQWRWRWQWRSCCSRRSL
Ga0210291_1080325423300030626SoilMYEIQTMEKRKAYIEQMTSYLNDRIRELNKVKRDLAAEQKWIQVSNQRIAELAQKEKLIKLQDVMSCIKNEQDRLMGERGTKTIAIQNMQKQAAQLENNIKTIRGKMDTITTGKAEGAPA
Ga0210269_1022393413300030627SoilNKVKRDLAAEQKWIQVSNQRIAELAQKEKLIKLQDVMSCIKNEQDRLQGERGTKTVAIANMAKQAATLENNIKGIRAKMESITAGKAGAAAPGGDSSF
Ga0210268_113932413300030629SoilIQTMEKRKAYIEQMTSYLNDRIRELNKVKRDLAAEQKWIQVSNQRIAELAQKEKLIKLQDVMSCIKGEQDRLMGERGTKTIAIQNMQKQAGQLESNIKSIRDKMESITTGTGGAHAAGSASTF
Ga0210268_115339523300030629SoilEIQTMEKRKAYIEQMTSYLNDRIRELNKVKRDLAAEQKWIQVSNQRIAELAQKVKLIKLQDVMSCIKNEQDRLMGERGTKTIAIQNMQKQAAQLENNIKTIRGKMDTITTGKAEGAPAS
Ga0210268_117129913300030629SoilIMYEIQTMEKRKAYIEQMTSYLNDRIRELNKVKRDLAAEQKWIQVSNQRIAELAQKEKLIKLQDVMSCIKNEQDRLQGERGTKTVAIANMAKQAATLENNIKGIRAKMESITAGKAGAAAPGGDSSF
Ga0210282_1007932423300030630SoilRGQTIFEIRKMRADAKQIGLSIMYEIQTMEKRKAYIEQMTSYLNDRIRELNKVKRDLAAEQKWIQVSNQRISELAQKEKLIKLQDVMSCIKNEQDRLLGERGTKSVAIANMAKQAATLENNIKGIRAKMESITGGKAAAGGSDSAGGF
Ga0210282_1019167213300030630SoilYIEQMTSYLNDRIRELNKVKRDLAAEQKWIQVSNQRIAELAQKEKLIKLQDVMSCIKNEQDRLMGERGTKTIAIQNMQKQAAVLENNIKTIRSKMESITSGKAASAGSGSGSSA
Ga0210282_1029693623300030630SoilADAKQIGLSIMYEIQTMEKRKAYIEQMTSYLNDRIRELNKVKRDLAAEQRWIQVSNQRIAELAQKEKLIKLQDVMSCIKNEQDRLMGERGTKTTAIQNMQKQAAQLESNIKSIRGKMDQITTGKKGGGGSESA
Ga0210279_1020263013300030631SoilTMEKRKAYIEQMTSYLNDRIRELNKVKRDLAAEQKWIQVSNQRISELAQKEKLIKLQDVMSCIKNEQDRLLGERGTKSVAIANMAKQAATLENNIKGIRAKMESITGGKAAAGGSDSAGG
Ga0210279_1020847513300030631SoilGLSIMYEIQTMEKRKAYIEQMTSYLNDRIRELNKVKRDLAAEQKWIQVSNQRIAELAQKEKLIKLQDVMSCIKNEQDRLQGERGTKTVAIANMAKQAATLENNIKGIRAKMESITAGKAGAAAPGGDSSF
Ga0210279_1029960613300030631SoilADAKQIGMSIMYEIQTMEKRKAYIEQMTSYLNDRIRELNKVKRDLLAEQKWIQVSNQRIAELAQKEKLIKLQDVMSCIKMEQERLNGDRTTKTIAIGNLAQQAAQLESNIRQIRQRMQTITNGAAPEHSGSSSA
Ga0210250_1148072713300030632SoilLNDRIRELNKVKRDLAAEQKWIQVSNQRIAELAQKEKLIKLQDVMSCIKNEQDRLQGERGTKTVAIANMAKQAATLENNIKGIRAKMESITAGKAGAAAPGGDSSF
Ga0247622_109400913300030682SoilIMYEIQTMEKRKAYIEQMTSYLNDRIRELNKVKRDLSAEQKWIQVSNQRIAELAQKEKLIKLQDVMSCIKNEQDRLMGERGTKTIAIQNMQKQAAQLQQNIASIRGKMETITAGKSAAAPAASAAEPAQSA
Ga0247617_108422513300030684SoilYLNDRIRELNKVKRDLAAEQKWIQVSNQRIAELAQKEKLIKLQDVMSCIKNEQDRLMGERGTKTIAIQNMQKQAAQLENNIQTIRSKMDTITTGKAAAAASASS
Ga0265462_1107638113300030738SoilGLSIMYEIQPMEKRKAYIEQLTSYLNDRLRESPKVKRALAAEQKWIQVSNQRIAELAQKEKLIKLQDVMSCIKNEQDRLMGERGTKTVAIQNMQKQAAQLENNIKTIRGKMESITSGKAAGSGSSA
Ga0265462_1146998813300030738SoilIEQMTSYLNDRIRELNKVKRDLAAEQKWIQVSNQRIAELAQKEKLIKLQDVMSCIKNEQDRLMGERGTKTIAIQNMQKQAAQLENNIKTIRGKMESITTGKPAGSGSSA
Ga0265462_1208654723300030738SoilAYIEQMTSYLNDRIRELNKVKRDLAAEQKWIQVSNQRIAELAQKEKLIKLQDVMSCIKNEQDRLMGERGTKTIAIQNMQKQAAVLENNIKTIRSKMESITSGKAAGGGSGSSSA
Ga0265460_1201296913300030740SoilKRKAYIEQMTGYLNDRIRELNKVKRDLAAEQKWIQVSNQRIAELSQKEKLIKLQDVMSCIKNEQDRLMGERGTKTIAIQNMQKQAAQLTQNIASIRGKMETITSGHDGSSSAAAGSSGSS
Ga0265461_1096382313300030743SoilQMTSYLNDRIRELNKVKRDLAAEQKWIQVSNQRIAELAQKEKLIKLQDVMSCIKGEQDRLMGERGTKTIAIQNMQKQAAQLQNNIASIRGKMDSITSGKAGAAAGSGDSGGSAAGF
Ga0265461_1209516923300030743SoilGLSIMYEIQTMEKRKAYIEQMTSYLNDRIRELNKVKRDLAAEQKWISVSNQRIAELAQKEKLIKLQDVMSCIKNEQDRLMGERGTKTVAIQHMQKQAAQLENNIKVIRGKMESITTGHGGSAGSGSA
Ga0075396_194434713300030776SoilNDRIRELNKVKRDLAAEQKWIQVSNQRIAELAQKEKLIKLQDVMSCIKNEQDRLQGERGTKTVAIANMAKQAATLENNIKGIRAKMESITAGKAGAAAPGGDSSF
Ga0102769_1087146913300030804SoilIQTMEKRKAYIEQMTSYLNDRIRELNKVKRDLAAEQKWIQVSNQRIAELAQKEKLIKLQDVMSCIKNEQDRLMGERGTKTIAIQNMQKQASVLENNIKTIRSKMESITTGKAAGGGSGSSSA
Ga0075403_1156354123300030846SoilIMYEIQTMEKRKAYIEQMTSYLNDRIRELNKVKRDLAAEQKWIQVSNQRIAELAQKEKLIKLQDVMSCIKNEQDRLMGERGTKTIAIQNMQKQAAQLESNIKTIRGKMDTITTGKSEAAPAASS
Ga0075388_1159939813300030848SoilTEVIIMEKRKTYVEQMTAYLNDRIRELNKVKRDLAAEQKWIQVSNQRIAELAQKEKLIKLQDVMSCIKNEQDRLQGERGTKTVAIANMAKQAATLENNIKGIRAKMESITAGKAGAAAPGGDSSF
Ga0075372_1126979913300030853SoilSIMYEIQTMEKRKAYIEQMTSYLNDRIRELNKVKRDLAAEQKWIQVSNQRIAELAQKEKLIKLQDVMSCIKNEQDRLQGERGTKTVAIANMAKQAATLENNIKGIRAKMESITAGKAGAAAPGGDSSF
Ga0075382_1141932513300030917SoilVEQMTSYLNDRIRELNKVKRDLSAEQKWIQVSNQRIAELAQKEKLIKLQDVMGCIKSEQDRLMGERGTKNLAIASMAKQAATLENNIKSIRSRMQSITKGGGAASESSAGF
Ga0138296_155697523300030923SoilADAKQIGLSIMYEIQTMEKRKAYIEQMTSYLNDRIRELNKVKRDLAAEQKWIQVSNQRIAELAQKEKLIKLQDVMSCIKNEQDRLMGERGTKTIAIQNMQKQAAVLENNIKTIRTKMESITTGKAAGGGSGSSSG
Ga0075391_1133504313300030934SoilMYEIQTMEKRKAYIEQMTSYLNDRIRELNKVKRDLAAEQKWIQVSNQRIAELAQKEKLIKLQDVMSCIKNEQDRLQGERGTKTVAIANMAKQAATLENNIKGIRAKMESITAGKAGAAAPGGDSSF
Ga0075373_1144131713300030945SoilMEKRKAYIEQMTSYLNDRIRELNKVKRDLAAEQKWIQVSNQRIAELAQKEKLIKLQDVMSCIKNEQDRLMGERGTKTIAIQNMQKQAAQLQSNIASIRGKMDSITSGSKSEAAPAASS
Ga0075390_1004623813300030947SoilTMEKRKAYIEAMTAYLNDRIRELNKVKRDLAAEQKWIQVSNQRIAELAQKEKLIKLQDVMSCIKNEQDRLQGERGTKTVAIANMAKQAATLENNIKGIRAKMESITAGKAGAAAPGGDSS
Ga0075376_1136799213300030968SoilYIEQMTSYLNDRIRELNKVKRDLGAEQKWIQVSNQRIAELAQKEKLIKLQDVMSCIKNEQDRLMGERGTKTIAIQNMQKQAAQLQSNIASIRGKMDSITSGSKSEAAPAASS
Ga0075375_1191546613300030971SoilMYEIQTMEKRKAYIEQMTSYLNDRIRELNKVKRDLAAEQKWIQVSNQRIAELAQKEKLIKLQDVMSCIKNEQDRLMGERGTKTIAIQNMQKQAAVLENNIKTIRSKMESITTGKAAGGGSGSSSA
Ga0075400_1168281223300030972SoilMYEIQTMEKRKAYIEQMTSYLNDRIRELNKVKRDLAAEQKWIQVSNQRIAELAQKEKLIKLQDVMSCIKNEQDRLMGERGTKTQAIANMAKQAATLEANIKSIRNKMKTITTGAADGESSAAAL
Ga0074019_1115280423300030999SoilYIEQMTSYLNDRIRELNKVKRDLAAEQKWIQVSNQRIAELAQKEKLIKLQDVMSCIKNEQDRLMGERGTKTIAIQNMQKQAAQLENNIKTIRGKMDTITTGKAEGAPAS
Ga0074036_1119021113300031049SoilEIQTMEKRKAYIEQMTSYLNDRIRELNKVKRDLAAEQKWIQVSNQRIAELAQKEKLIKLQDVMSCIKNEQDRLMGERGTKTIAIQNMQKQAAQLQSNIASIRGKMDSITSGSKSEAAPAASS
Ga0170822_1232102513300031122Forest SoilAADAKQIGLSIMYEILTMEKRKAYIEQMTSYLNDRIRELNKVKRDLAAEQKWIQVSNQRIAELAQKEKLIKLQDVMSCIKNEQDRLQGERGTKTVAIANMAKQAATLENNIKGIRAKMESITAGKAGAAAPGGDSSF
Ga0170823_1275638613300031128Forest SoilLSIMYEIQTMEKRKAYIEQMTSYLNDRIRELNKVKRDLAAEQKWIQVSNQRIAELAQKEKLIKLQDVMSCIKNEQDRLQGERGTKTVAIANMAKQAATLENNIKGIRAKMESITAGKAGAAAPGGDSSF
Ga0170823_1755095323300031128Forest SoilAIMYEIQTMEKRKAYIEQMTSYLNDRIRELNKVKRDLAAEQKWIQVSNQRIAELAQKEKLIKLQDVMSCIKNEQDRLMGERGTKTIAIQNMQKQAAQLQSNIASIRGKMDSITSGSKSEAAPAASS
Ga0170824_10282136613300031231Forest SoilGLAIMYEIQTMEKRKAYIEQMTSYLNDRIRELNKVKRDLAAEQKWIQVSNQRIAELSQKEKLIKLQDVMSCIKNEQDRLMGERGTKTIAIQNMQKQAAQLQSNIQTIRTKMDTITTGKAAAAAEPAASS
Ga0170824_10561391713300031231Forest SoilLSIMYEIQTMEKRKAYIEQMTQYLNDRIRELNKVKRDLAAEQKWIQVSNQRIAELAQKEKLIKLQDVMSCIKNEQDRLMGERGTKTVAISNMQKQAATLENNIKTIRKKMESITTGKGGESSGSG
Ga0170824_12226708913300031231Forest SoilGLSIMYEIQTMEKRKAYIEQMTQYLNDRIRELNKVKRDLAAEQKWIQVSNQRIAELAQKEKLIKLQDVMSCIKNEQDRLMGERGTKTIAIQNMQKQAATLENNIKTIRRKMETITTGKAGESSGSG
Ga0170820_1126276013300031446Forest SoilMEKRKAYIEQMTSYLNDRIRELNKVKRDLGAEQKWIQVSNQRIAELAQKEKLIKLQDVMSCIKGEQDRLMGERGTKTIAIQNMQKQAAQLQNNIAAIRGKMETITTGAGAAAPAAEAQAS
Ga0170820_1336876513300031446Forest SoilDAKQIGLSIMYEIQTMEKRKAYIEQMTQYLNDRIRELNKVKRDLAAEQKWIQVSNQRIAELAQKEKLIKLQDVMSCIKNEQDRLMGERGTKTIAIQNMQKQAATLENNIKTIRRKMETITTGKAGESSGSG
Ga0170819_1701429513300031469Forest SoilIQTMEKRKAYIEQMTQYLNDRIRELNKVKRDLAAEQKWIQVSNQRIAELAQKEKLIKLQDVMSCIKNEQDRLMGERGTKTIAIQNMQKQAAQLQSNIATIRTKMDTITTGKSEAAPAASS
Ga0170818_11492880913300031474Forest SoilYEIQTMEKRKAYIERMTSYLNDRIRELNKVKRDLAAEQKWIQVSNQRIAELAQKEKLIKLQDVMSCIKNEQDRLMGERGTKTIAIQNMQKQAAQLENNIKTIRGKMEQITSGKGGGAASSGSSSA
Ga0315741_1132414313300032739Forest SoilMYEIQTMEKRKAYIEQMTSYLNDRIRELNKVKRDLAAEQKWIQVSNQRIAELAQKEKLIKLQDVMSCIKNEQDRLMGERGTKTIAIQNMQKQAAVLENNIKTIRSKMESITSGKAASAGSGSGSSA
Ga0315742_1179613713300032756Forest SoilHIEQMTSYLNDRIRELNKVKRDLAAEQKWIQVSNQRIAELAQKEKLIKLQDVMSCIKGEQDRLMGERGTKTIAIQNMQKQAGQLESNIKSIRDKMESITTGTGGAHAAGSASTF
Ga0315742_1181242523300032756Forest SoilMYEIQTMEKRKAYIEQMTSYLNDRIRELNKVKRDLAAEQKWIQVSNQRIAELAQKEKLIKLQDVMSCIKNEQDRLMGERGTKTVAIQNMQKQAAQLENNIKTIRGKMESITSGKAAGSGSSA


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.