Basic Information | |
---|---|
Family ID | F082070 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 113 |
Average Sequence Length | 47 residues |
Representative Sequence | MGVNLRLLVVVLGLQSLLVVRDVLLGPLGVRGVDQLLLAKGLFVITNY |
Number of Associated Samples | 88 |
Number of Associated Scaffolds | 113 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Unclassified |
% of genes with valid RBS motifs | 81.98 % |
% of genes near scaffold ends (potentially truncated) | 18.58 % |
% of genes from short scaffolds (< 2000 bps) | 96.46 % |
Associated GOLD sequencing projects | 87 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.38 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Unclassified (84.956 % of family members) |
NCBI Taxonomy ID | N/A |
Taxonomy | N/A |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Switchgrass Phyllosphere (57.522 % of family members) |
Environment Ontology (ENVO) | Unclassified (78.761 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant surface (68.142 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 55.26% β-sheet: 0.00% Coil/Unstructured: 44.74% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.38 |
Powered by PDBe Molstar |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
Unclassified | root | N/A | 84.96 % |
All Organisms | root | All Organisms | 15.04 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300005347|Ga0070668_101777929 | Not Available | 567 | Open in IMG/M |
3300005367|Ga0070667_100647421 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum | 975 | Open in IMG/M |
3300005544|Ga0070686_100449070 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum | 991 | Open in IMG/M |
3300005617|Ga0068859_101774438 | Not Available | 681 | Open in IMG/M |
3300005719|Ga0068861_101355012 | Not Available | 693 | Open in IMG/M |
3300005719|Ga0068861_102585058 | Not Available | 512 | Open in IMG/M |
3300005842|Ga0068858_100787332 | Not Available | 927 | Open in IMG/M |
3300005843|Ga0068860_101738835 | Not Available | 645 | Open in IMG/M |
3300009101|Ga0105247_10091513 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum | 1932 | Open in IMG/M |
3300009553|Ga0105249_10260409 | Not Available | 1723 | Open in IMG/M |
3300009972|Ga0105137_100376 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum | 1289 | Open in IMG/M |
3300009973|Ga0105136_100627 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum | 1393 | Open in IMG/M |
3300009975|Ga0105129_100158 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum | 2040 | Open in IMG/M |
3300009980|Ga0105135_103158 | Not Available | 973 | Open in IMG/M |
3300009980|Ga0105135_114771 | Not Available | 642 | Open in IMG/M |
3300009981|Ga0105133_125260 | Not Available | 545 | Open in IMG/M |
3300009981|Ga0105133_126165 | Not Available | 539 | Open in IMG/M |
3300009989|Ga0105131_132324 | Not Available | 563 | Open in IMG/M |
3300009990|Ga0105132_118053 | Not Available | 673 | Open in IMG/M |
3300009992|Ga0105120_1003015 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum | 1326 | Open in IMG/M |
3300009992|Ga0105120_1025317 | Not Available | 678 | Open in IMG/M |
3300009995|Ga0105139_1020978 | Not Available | 977 | Open in IMG/M |
3300010267|Ga0134101_1065162 | Not Available | 632 | Open in IMG/M |
3300010371|Ga0134125_10818795 | Not Available | 1024 | Open in IMG/M |
3300010373|Ga0134128_11895790 | Not Available | 656 | Open in IMG/M |
3300010396|Ga0134126_10657224 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum | 1195 | Open in IMG/M |
3300010399|Ga0134127_10847039 | Not Available | 966 | Open in IMG/M |
3300010401|Ga0134121_10394592 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum | 1249 | Open in IMG/M |
3300010403|Ga0134123_10560633 | Not Available | 1089 | Open in IMG/M |
3300014325|Ga0163163_10919745 | Not Available | 938 | Open in IMG/M |
3300014968|Ga0157379_11552659 | Not Available | 645 | Open in IMG/M |
3300014968|Ga0157379_11864400 | Not Available | 592 | Open in IMG/M |
3300015273|Ga0182102_1005324 | Not Available | 876 | Open in IMG/M |
3300015273|Ga0182102_1006652 | Not Available | 829 | Open in IMG/M |
3300015273|Ga0182102_1032278 | Not Available | 559 | Open in IMG/M |
3300015280|Ga0182100_1006323 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum | 1166 | Open in IMG/M |
3300015280|Ga0182100_1035994 | Not Available | 709 | Open in IMG/M |
3300015284|Ga0182101_1044123 | Not Available | 664 | Open in IMG/M |
3300015290|Ga0182105_1020378 | Not Available | 868 | Open in IMG/M |
3300015290|Ga0182105_1055593 | Not Available | 636 | Open in IMG/M |
3300015311|Ga0182182_1002781 | Not Available | 1670 | Open in IMG/M |
3300015312|Ga0182168_1050920 | Not Available | 729 | Open in IMG/M |
3300015316|Ga0182121_1037417 | Not Available | 845 | Open in IMG/M |
3300015316|Ga0182121_1050328 | Not Available | 763 | Open in IMG/M |
3300015316|Ga0182121_1144176 | Not Available | 505 | Open in IMG/M |
3300015318|Ga0182181_1007928 | Not Available | 1211 | Open in IMG/M |
3300015318|Ga0182181_1057686 | Not Available | 640 | Open in IMG/M |
3300015319|Ga0182130_1067161 | Not Available | 653 | Open in IMG/M |
3300015325|Ga0182148_1030345 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum | 874 | Open in IMG/M |
3300015326|Ga0182166_1079215 | Not Available | 633 | Open in IMG/M |
3300015327|Ga0182114_1048654 | Not Available | 804 | Open in IMG/M |
3300015327|Ga0182114_1072032 | Not Available | 697 | Open in IMG/M |
3300015329|Ga0182135_1089476 | Not Available | 625 | Open in IMG/M |
3300015331|Ga0182131_1041778 | Not Available | 826 | Open in IMG/M |
3300015331|Ga0182131_1112309 | Not Available | 575 | Open in IMG/M |
3300015334|Ga0182132_1129253 | Not Available | 564 | Open in IMG/M |
3300015335|Ga0182116_1044964 | Not Available | 878 | Open in IMG/M |
3300015335|Ga0182116_1126233 | Not Available | 588 | Open in IMG/M |
3300015335|Ga0182116_1158536 | Not Available | 532 | Open in IMG/M |
3300015336|Ga0182150_1064712 | Not Available | 727 | Open in IMG/M |
3300015337|Ga0182151_1065639 | Not Available | 722 | Open in IMG/M |
3300015338|Ga0182137_1139472 | Not Available | 561 | Open in IMG/M |
3300015338|Ga0182137_1145193 | Not Available | 551 | Open in IMG/M |
3300015339|Ga0182149_1094784 | Not Available | 647 | Open in IMG/M |
3300015339|Ga0182149_1098167 | Not Available | 638 | Open in IMG/M |
3300015340|Ga0182133_1092911 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum | 684 | Open in IMG/M |
3300015340|Ga0182133_1101159 | Not Available | 662 | Open in IMG/M |
3300015349|Ga0182185_1071080 | Not Available | 958 | Open in IMG/M |
3300015350|Ga0182163_1044610 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum | 1231 | Open in IMG/M |
3300015350|Ga0182163_1231421 | Not Available | 579 | Open in IMG/M |
3300015352|Ga0182169_1025941 | Not Available | 1598 | Open in IMG/M |
3300015353|Ga0182179_1127757 | Not Available | 780 | Open in IMG/M |
3300015354|Ga0182167_1253033 | Not Available | 635 | Open in IMG/M |
3300015354|Ga0182167_1366376 | Not Available | 501 | Open in IMG/M |
3300017408|Ga0182197_1140460 | Not Available | 518 | Open in IMG/M |
3300017414|Ga0182195_1191814 | Not Available | 534 | Open in IMG/M |
3300017422|Ga0182201_1093438 | Not Available | 586 | Open in IMG/M |
3300017432|Ga0182196_1106854 | Not Available | 575 | Open in IMG/M |
3300017440|Ga0182214_1013485 | Not Available | 1582 | Open in IMG/M |
3300017445|Ga0182198_1125847 | Not Available | 607 | Open in IMG/M |
3300017446|Ga0182217_1066537 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta | 839 | Open in IMG/M |
3300017691|Ga0182212_1147698 | Not Available | 535 | Open in IMG/M |
3300017692|Ga0182210_1113831 | Not Available | 588 | Open in IMG/M |
3300020223|Ga0182118_102508 | Not Available | 848 | Open in IMG/M |
3300025910|Ga0207684_11228579 | Not Available | 619 | Open in IMG/M |
3300026035|Ga0207703_12136110 | Not Available | 536 | Open in IMG/M |
3300026088|Ga0207641_11469479 | Not Available | 683 | Open in IMG/M |
3300026088|Ga0207641_11574226 | Not Available | 659 | Open in IMG/M |
3300028049|Ga0268322_1040575 | Not Available | 566 | Open in IMG/M |
3300028050|Ga0268328_1053501 | Not Available | 562 | Open in IMG/M |
3300028051|Ga0268344_1015971 | Not Available | 588 | Open in IMG/M |
3300028061|Ga0268314_1020867 | Not Available | 704 | Open in IMG/M |
3300028140|Ga0268334_1004289 | Not Available | 820 | Open in IMG/M |
3300028151|Ga0268308_1017745 | Not Available | 620 | Open in IMG/M |
3300028154|Ga0268341_1000876 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum | 1476 | Open in IMG/M |
3300028380|Ga0268265_11483181 | Not Available | 682 | Open in IMG/M |
3300028464|Ga0268302_106731 | Not Available | 553 | Open in IMG/M |
3300028470|Ga0268307_1002112 | Not Available | 1016 | Open in IMG/M |
3300028475|Ga0268327_1023855 | Not Available | 526 | Open in IMG/M |
3300028527|Ga0268335_1003127 | Not Available | 844 | Open in IMG/M |
3300032464|Ga0214492_1029278 | Not Available | 1050 | Open in IMG/M |
3300032502|Ga0214490_1131764 | Not Available | 567 | Open in IMG/M |
3300032698|Ga0214485_1009190 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum | 1595 | Open in IMG/M |
3300032757|Ga0314753_1068421 | Not Available | 635 | Open in IMG/M |
3300032823|Ga0314723_1076863 | Not Available | 632 | Open in IMG/M |
3300032827|Ga0314730_113622 | Not Available | 881 | Open in IMG/M |
3300032913|Ga0314739_1040571 | Not Available | 878 | Open in IMG/M |
3300032915|Ga0314749_1071502 | Not Available | 748 | Open in IMG/M |
3300032966|Ga0314722_1036957 | Not Available | 783 | Open in IMG/M |
3300033538|Ga0314755_1000739 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta | 4552 | Open in IMG/M |
3300033538|Ga0314755_1030156 | Not Available | 1308 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Switchgrass Phyllosphere | Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Switchgrass Phyllosphere | 57.52% |
Switchgrass Associated | Host-Associated → Plants → Unclassified → Unclassified → Unclassified → Switchgrass Associated | 10.62% |
Phyllosphere | Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Phyllosphere | 9.73% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 7.96% |
Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 5.31% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 1.77% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 1.77% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 1.77% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 0.89% |
Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 0.89% |
Switchgrass Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere | 0.89% |
Switchgrass Degrading | Engineered → Bioreactor → Unclassified → Unclassified → Unclassified → Switchgrass Degrading | 0.89% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Host-Associated | Open in IMG/M |
3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Host-Associated | Open in IMG/M |
3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Environmental | Open in IMG/M |
3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Host-Associated | Open in IMG/M |
3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Host-Associated | Open in IMG/M |
3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Host-Associated | Open in IMG/M |
3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Host-Associated | Open in IMG/M |
3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Host-Associated | Open in IMG/M |
3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Host-Associated | Open in IMG/M |
3300009972 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_224 metaG | Host-Associated | Open in IMG/M |
3300009973 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_222 metaG | Host-Associated | Open in IMG/M |
3300009975 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_187 metaG | Host-Associated | Open in IMG/M |
3300009980 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_219 metaG | Host-Associated | Open in IMG/M |
3300009981 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_208 metaG | Host-Associated | Open in IMG/M |
3300009989 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_197 metaG | Host-Associated | Open in IMG/M |
3300009990 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_206 metaG | Host-Associated | Open in IMG/M |
3300009992 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_108 metaG | Host-Associated | Open in IMG/M |
3300009995 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_227 metaG | Host-Associated | Open in IMG/M |
3300010267 | Switchgrass degrading microbial communities from high solid loading bioreactors in New Hampshire, USA - 12_48_3.3_201_A2 metaG | Engineered | Open in IMG/M |
3300010371 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1 | Environmental | Open in IMG/M |
3300010373 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4 | Environmental | Open in IMG/M |
3300010396 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2 | Environmental | Open in IMG/M |
3300010399 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3 | Environmental | Open in IMG/M |
3300010401 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1 | Environmental | Open in IMG/M |
3300010403 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3 | Environmental | Open in IMG/M |
3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Host-Associated | Open in IMG/M |
3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Host-Associated | Open in IMG/M |
3300015273 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_09MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015280 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_09MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015284 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_09MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015290 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_09MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015311 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_22AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015312 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_01AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015316 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_31MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015318 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_22AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015319 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_MAIN_20JUN2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015325 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_12JUL2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015326 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_01AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015327 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_MAIN_31MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015329 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_20JUN2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015331 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_20JUN2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015334 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_20JUN2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015335 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_31MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015336 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_12JUL2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015337 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_12JUL2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015338 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_20JUN2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015339 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_12JUL2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015340 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_20JUN2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015349 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_22AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015350 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_01AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015352 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_01AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015353 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_22AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015354 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_01AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
3300017408 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_12SEP2016_LD1 MG | Host-Associated | Open in IMG/M |
3300017414 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_12SEP2016_LD1 MG | Host-Associated | Open in IMG/M |
3300017422 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_12SEP2016_LD1 MG | Host-Associated | Open in IMG/M |
3300017432 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_12SEP2016_LD1 MG | Host-Associated | Open in IMG/M |
3300017440 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_03OCT2016_LD1 MG | Host-Associated | Open in IMG/M |
3300017445 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_12SEP2016_LD1 MG | Host-Associated | Open in IMG/M |
3300017446 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_03OCT2016_LD1 MG | Host-Associated | Open in IMG/M |
3300017691 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_03OCT2016_LD1 MG | Host-Associated | Open in IMG/M |
3300017692 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_MAIN_03OCT2016_LD1 MG | Host-Associated | Open in IMG/M |
3300020223 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_31MAY2016_LD2 MG | Host-Associated | Open in IMG/M |
3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) | Environmental | Open in IMG/M |
3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300028049 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_NF_26JUN2017_LD1 | Host-Associated | Open in IMG/M |
3300028050 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_NF_17JUL2017_LD1 | Host-Associated | Open in IMG/M |
3300028051 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_NF_28AUG2017_LD1 | Host-Associated | Open in IMG/M |
3300028061 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_NF_05JUN2017_LD1 | Host-Associated | Open in IMG/M |
3300028140 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_MAIN_07AUG2017_LD1 | Host-Associated | Open in IMG/M |
3300028151 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_MAIN_05JUN2017_LD1 | Host-Associated | Open in IMG/M |
3300028154 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R2_MAIN_28AUG2017_LD1 | Host-Associated | Open in IMG/M |
3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300028464 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_MAIN_15MAY2017_LD1 | Host-Associated | Open in IMG/M |
3300028470 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R4_NF_15MAY2017_LD1 | Host-Associated | Open in IMG/M |
3300028475 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R4_MAIN_17JUL2017_LD1 | Host-Associated | Open in IMG/M |
3300028527 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R4_MAIN_07AUG2017_LD1 | Host-Associated | Open in IMG/M |
3300032464 | Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_MAIN_12JUL2016_LR1 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
3300032502 | Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_MAIN_12JUL2016_LR1 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
3300032698 | Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R4_MAIN_31MAY2016_LR1 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
3300032757 | Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_07AUG2017_LR1 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
3300032823 | Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_MAIN_05JUN2017_LR1 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
3300032827 | Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_05JUN2017_LR1 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
3300032913 | Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_MAIN_17JUL2017_LR1 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
3300032915 | Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_07AUG2017_LR1 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
3300032966 | Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_15MAY2017_LR1 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
3300033538 | Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_MAIN_28AUG2017_LR1 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
Ga0070668_1017779291 | 3300005347 | Switchgrass Rhizosphere | VNLRLLIVVLGLQSLLVVRDVLLGPLGVRGVDQLLLAKGLFVIANY* |
Ga0070667_1006474211 | 3300005367 | Switchgrass Rhizosphere | MGVNLRLLVVVLGLRSLLVVRYVHLGPLGVRGIDKLLLAKGLFVI |
Ga0070686_1004490702 | 3300005544 | Switchgrass Rhizosphere | MGMNLRLLVVVLGLRSLLIVQDVLLGLLGVDQLLLARSLFVITYYYRGQS |
Ga0068859_1017744381 | 3300005617 | Switchgrass Rhizosphere | MGVNLRLLVVVLGLQSLLVVRDVLLGPLGVRGVDQLLLAKGLFVNTNY* |
Ga0068861_1013550121 | 3300005719 | Switchgrass Rhizosphere | MGVNLRLLVVVLGLQSLPVVRDILLGPLGVRGVDQLLLAKGLFVITNY* |
Ga0068861_1025850582 | 3300005719 | Switchgrass Rhizosphere | MGVNLRLLVVVLGLQSLLVVRDVLLGPLGVRGVDQLLLAKGPFVITNY* |
Ga0068858_1007873321 | 3300005842 | Switchgrass Rhizosphere | MGVNLRLLVVVLGLQSLLVVRDVLLGPLGVRGVNQLLLAKGLFIITNY* |
Ga0068860_1017388352 | 3300005843 | Switchgrass Rhizosphere | MGVNLRLLVVVLGLQSLLVVRDVLLGPLGVRGVDQLLLAKGLFVITNY* |
Ga0105247_100915131 | 3300009101 | Switchgrass Rhizosphere | MGVNLRLLVVVLGLRSLLVVRYVLLGPLGVRDVDQLLLAKDLFVITNY* |
Ga0105249_102604091 | 3300009553 | Switchgrass Rhizosphere | MGVNLRLLVVVLGLQSLLVVRDVLLGPLGVRGVDQLLLAKGLFVITSY* |
Ga0105137_1003762 | 3300009972 | Switchgrass Associated | MGVNLRLLVVVLGLRSHLIVRYVLLGPLGVRGVDQLLLAKGLFVITNY* |
Ga0105136_1006271 | 3300009973 | Switchgrass Associated | MGVNLRLLVVVLDLQSLLVVRDVLLGPLGVRGVDQLLLAKGLFVITNY* |
Ga0105129_1001581 | 3300009975 | Switchgrass Associated | MGVNLRLLVVVLGLQSLLVVRDVLLGPLGIRGVDQLLLAKGLFIITNY* |
Ga0105135_1031581 | 3300009980 | Switchgrass Associated | MGVNLRLLIVVLGLRSHLVVRYVLLGPLGVRGIDQLLLAKGLFVITNY* |
Ga0105135_1147711 | 3300009980 | Switchgrass Associated | MGVNLRLLVVVLGLRSLLVVRYVLLGPLGVRGVDQLLLAKGLFAITNY* |
Ga0105133_1252601 | 3300009981 | Switchgrass Associated | MGVNLRLFIVVLALQSLLFVRDVLLGPLGVRGVDQLLLAKGLFVITNY* |
Ga0105133_1261652 | 3300009981 | Switchgrass Associated | MNLRLLVVVLGLRSLLVVRYVLLGPLGVRGVDQILLAKGLFVNTNY* |
Ga0105131_1323241 | 3300009989 | Switchgrass Associated | MGVNLRLLVVVLGLPSLLVVRHILLGPLGVRGVDQLLLAKGLFVITNY* |
Ga0105132_1180531 | 3300009990 | Switchgrass Associated | MGVNLRLLVVVLGLQSLLVVRDVLLGPLGIRGVDQLLLAKGLFVITNY* |
Ga0105120_10030151 | 3300009992 | Switchgrass Associated | MGVNLRLLVVVLDLQSLLVVRDVLLGPLGIRGVDQLLLAKGLFVNLNY* |
Ga0105120_10253171 | 3300009992 | Switchgrass Associated | MGVNLRLLIVILGLRSHLIVRYVLLGPLGVRGVDQLLLAKGLFVITNY* |
Ga0105139_10209781 | 3300009995 | Switchgrass Associated | MDVNPRLLIVVLGLQSLLVVRDVLLGPLGVRGVDQLLLAKGLFVITNY* |
Ga0134101_10651621 | 3300010267 | Switchgrass Degrading | MGVNLRLLVVVLGLQSLLFVRDVLLGPLGVRGVDQLLLAKGLFIITNY* |
Ga0134125_108187951 | 3300010371 | Terrestrial Soil | MGVNLRILIVILGSQSLLVVRDVLLGPLGVRGVDQLLLAKGLFVITNY* |
Ga0134128_118957901 | 3300010373 | Terrestrial Soil | MGVNLRLLVVVLGLWSLLVVRYVLLSPLGVRGVDQLLLAKGLFVIMNY* |
Ga0134126_106572241 | 3300010396 | Terrestrial Soil | MGVNLRLLVVVLGLQSHLVVRYVLLGPLGVRGVGQLLLAKGLFVITNY* |
Ga0134127_108470391 | 3300010399 | Terrestrial Soil | MGMNLRLLVVILGLQSLIVVRDVLLGPLGVRGVDQLLLAKGLFVIT |
Ga0134121_103945921 | 3300010401 | Terrestrial Soil | MGVNLRLLVVVLGLRSLLVVRYVLLGPLGVRGVDQLLLAKGLFVITNY* |
Ga0134123_105606331 | 3300010403 | Terrestrial Soil | MGVNLRLLVVVLGLRSLLVVRYVLLGPLGVRGIDQLLLAKGLFVNTNY* |
Ga0163163_109197451 | 3300014325 | Switchgrass Rhizosphere | MGVNLRLLVVVLGLQSLLVVRDVLLGLLGVRGVDQLLLAKGLFVITNY* |
Ga0157379_115526592 | 3300014968 | Switchgrass Rhizosphere | MGVNLRLLVVVLDLRSHLIVRYVLLGPLGVRGVDQLLLAKGLFVNTNY* |
Ga0157379_118644001 | 3300014968 | Switchgrass Rhizosphere | MDVNMRLLVVVLGLKSLLVVRDVLLGPLGVRGVDQLLLAKGLFVITNY* |
Ga0182102_10053241 | 3300015273 | Switchgrass Phyllosphere | MGVNLRLLVVVLGLQSLLIVRDVLLGLLGVRGVDQLLLAMGLFVNTHY* |
Ga0182102_10066521 | 3300015273 | Switchgrass Phyllosphere | MRLLVVVLDLWSLLVVRDVLLGPLGVRGVDQLLLAKGLFVNTNY* |
Ga0182102_10322781 | 3300015273 | Switchgrass Phyllosphere | MGVNLRLLVVVLGLQSHLVVRYVLLGPLGVRGVDQLLLAKGLFVITNY* |
Ga0182100_10063232 | 3300015280 | Switchgrass Phyllosphere | MGVNLRLLVVILGLRSLLVVRYVLLGPLAVRGVDQLLLTKGLFVNTNY* |
Ga0182100_10359942 | 3300015280 | Switchgrass Phyllosphere | VNLRLLVVVLGLRSLLVVRYVLLGPLGVRDVDQLLLAKDLFVITNY* |
Ga0182101_10441231 | 3300015284 | Switchgrass Phyllosphere | MNLRLLVVVLGLRSLLVVRYVLLGPLGIRGVDQLLLAKGLFVITNF* |
Ga0182105_10203781 | 3300015290 | Switchgrass Phyllosphere | MGVNLRLLIVVLGLQSLLVVRDVLLGPLGVRGVDQLLLAKGLFVNTNY* |
Ga0182105_10555931 | 3300015290 | Switchgrass Phyllosphere | GVNLRLLVVVLGLQSLLVVRDVLLGPLGVRGVDQLLLDKGLFVITNY* |
Ga0182182_10027811 | 3300015311 | Switchgrass Phyllosphere | MGVNLRLLVVVLGLWVLLIFWDVLLGLLGVRCIDKLLLARGLFVITY* |
Ga0182182_11021922 | 3300015311 | Switchgrass Phyllosphere | LGLRSLLVVRYVLLGPLGVRGVDQLLLVKGLFVITNY* |
Ga0182168_10509202 | 3300015312 | Switchgrass Phyllosphere | MGVNLRLLVVVLGLQSLLVVRDVLLGPLVVRGVDQLLLAKGLFVITNY* |
Ga0182121_10374171 | 3300015316 | Switchgrass Phyllosphere | VNLRLLVVVLGLRSHLVVRYVLLGPLGVRGVDQLLLAKGLFVIMNY* |
Ga0182121_10503282 | 3300015316 | Switchgrass Phyllosphere | MGVNLRLLVVVLGLQSLLVVRDVLLGPLGVWGVDQLLLAKGLFVIMNY* |
Ga0182121_11441761 | 3300015316 | Switchgrass Phyllosphere | MGVNLRHIIVILGLWSHLVVWYVLLGPLGVRGVDQLLLAKGLFVITNY* |
Ga0182181_10079281 | 3300015318 | Switchgrass Phyllosphere | MTVNLRLLVVVLGLQSLLIVRDVLLGPLGVRGVDQLLLAKGLFVITNY* |
Ga0182181_10576861 | 3300015318 | Switchgrass Phyllosphere | MGVNLRLLVVILGLRSLLVVWYILLGPLGVRGVDQLLLAKGLFAITNY* |
Ga0182130_10671611 | 3300015319 | Switchgrass Phyllosphere | MGVNLRLLVVVLDLQSLLVVRDVLLGPLGVRVVDQLLLAKGLFVITNY* |
Ga0182148_10303451 | 3300015325 | Switchgrass Phyllosphere | MGVNLRLLVVILGLRSLLVVRYILLGPLGVRGVDQLLLAKGLFINTNY* |
Ga0182166_10792151 | 3300015326 | Switchgrass Phyllosphere | MGVNLRLLVVVLGLQSLPVVRDVLLGPLGVRGIDQLLLAKGLFVIYELLKG* |
Ga0182114_10486541 | 3300015327 | Switchgrass Phyllosphere | MGVNLRLLVVVLGLQSLPVVWGILLGPLGVRGVDQLLAKGLFVITNY* |
Ga0182114_10720321 | 3300015327 | Switchgrass Phyllosphere | MGVNLRFLIVVLGIRSHLVVRYVLLGPMGVRGVDQLLLAKGLFAITNY* |
Ga0182135_10894761 | 3300015329 | Switchgrass Phyllosphere | MGVNLRLLIVVLGLQSHLVVQYILLGPLGVRGIDHLLLAKGLFVITNY* |
Ga0182131_10417781 | 3300015331 | Switchgrass Phyllosphere | MGVNLRLLVVVLGLQSLLVVRDILLGPLGVRGVDQLLLAKGLFVITK |
Ga0182131_11123091 | 3300015331 | Switchgrass Phyllosphere | MGVNLRLLVVVLSLWSLLVVRDVVLGPLGIRGVDQLLLAKGLFVIYELLKG |
Ga0182132_11292531 | 3300015334 | Switchgrass Phyllosphere | MGVNLRLLVVILGLQCLLVVRDVLLGPLGVRGVDQLLLAKGLFVITNY* |
Ga0182116_10449641 | 3300015335 | Switchgrass Phyllosphere | MGVNLRLLIVVLGLRSLLIVRYILLGPLGVRGVDQLLLAKGLFVIANY* |
Ga0182116_11262331 | 3300015335 | Switchgrass Phyllosphere | MGVNLRLLVVVLGLRSHLVVWDVLLGPLGVRGVDQLLLAKGLFVIMNY* |
Ga0182116_11585362 | 3300015335 | Switchgrass Phyllosphere | MGVNLRLLVVVLGLWVLLIFWYVLLGLLGVRCVDQLLLARGLFEL |
Ga0182150_10647121 | 3300015336 | Switchgrass Phyllosphere | MGVNLRLLVVILGLQSLLVVRDVLLGPLGVRGVDQLLLAKGLFVITNY* |
Ga0182151_10656391 | 3300015337 | Switchgrass Phyllosphere | MGVNLRLLVVVLGLQSLLVVRDVLLGPLRVRGVDQLLLAKGLFVIMNY* |
Ga0182137_11394721 | 3300015338 | Switchgrass Phyllosphere | MGVNLRLLVVVLDLQSLLVVRDVLLGPLGIRGVDQLLLAKGLFVIYELLKG* |
Ga0182137_11451931 | 3300015338 | Switchgrass Phyllosphere | VNLRLLVVVLGLRSLLVVRYVLLGPLGVRGVDQLLLAKGLFVNTNY* |
Ga0182149_10947841 | 3300015339 | Switchgrass Phyllosphere | MGVNLRLLVVVLGLRSLLVVRYVLLGPLGVRGIGQLLLAKGLFVITNY* |
Ga0182149_10981671 | 3300015339 | Switchgrass Phyllosphere | MGVNLRLLVVVLGLRSHLVVRYVLLGPLGVRGVDQLLLAKGLFVNTNY* |
Ga0182133_10929111 | 3300015340 | Switchgrass Phyllosphere | MGVNLRLLVVVLGLRSHLVVRYVLLGPLGVRGVDQLLLAKGLFAITNY* |
Ga0182133_11011591 | 3300015340 | Switchgrass Phyllosphere | MGVNLRLLIVVLGLQNHLVVQYILLGPLGVRGVDQLLLAKGLFVITNY* |
Ga0182185_10710801 | 3300015349 | Switchgrass Phyllosphere | MGVNLRLLVVVLGLRSHLVVRYVLLGPLGVRGVDQLLLAKGLFLIMNY* |
Ga0182163_10446102 | 3300015350 | Switchgrass Phyllosphere | MGVNLRLLVVILGLQRLLVVRDILLGPLGVRGVDQLLLAKGLFVNTNY* |
Ga0182163_12314211 | 3300015350 | Switchgrass Phyllosphere | LVVVLDLRSLLVVRDVLLGPLGVRGIDQLLLVKGLFAITKY* |
Ga0182169_10259411 | 3300015352 | Switchgrass Phyllosphere | MGVNLRLLVVVLGLWVLLIFWDVLLGLLGVRCVDKLLLARGLFVIMY* |
Ga0182179_11277572 | 3300015353 | Switchgrass Phyllosphere | VVLGLRSLLIVRYVHLGPLGVRGVDKLLLAKGLFVITNY* |
Ga0182167_12530331 | 3300015354 | Switchgrass Phyllosphere | MGVNLRLLVVVLGLRSLLVVRYVLLGPLGIRGVDQLLLAKGLFVITNY* |
Ga0182167_13663761 | 3300015354 | Switchgrass Phyllosphere | LRLLIVVLGLRSLLVVRDILLGPLGVRGIDQVLHARGLFIITN |
Ga0182197_11404601 | 3300017408 | Switchgrass Phyllosphere | MGVNLRLLVVVLGLRSHLVVRYVLLGPLGVRGVDQLLLAKGLFVITNY |
Ga0182195_11918141 | 3300017414 | Switchgrass Phyllosphere | MGVNLRLLVVVLDLQSLLVVRDVLLGPLVVRGVDQLLLAKGLFVITNY |
Ga0182201_10629661 | 3300017422 | Switchgrass Phyllosphere | VLGPQSLLVVRDVLLGLLGVRGVDQLLPAKGLFVIMNY |
Ga0182201_10934381 | 3300017422 | Switchgrass Phyllosphere | MNLRLLVVVLGLWSLLVVRYILLGPLGVRGVDNLLLAKGLFAFTNY |
Ga0182196_11068541 | 3300017432 | Switchgrass Phyllosphere | MNLRLLIVVLGLQSLLVVRDVLLGPLGVWGVDQLLLAKGLFVITNY |
Ga0182214_10134852 | 3300017440 | Switchgrass Phyllosphere | MNLRLLIVILGLRSLLIVPYILLGPLGIRGVDQLLLAKGLFVNTNY |
Ga0182198_11258472 | 3300017445 | Switchgrass Phyllosphere | MGVNLRLLVVVLGLQSLLVVRDVLLGPLGVRGVDQLLLAKGLFVNTNY |
Ga0182217_10665371 | 3300017446 | Switchgrass Phyllosphere | MGVNLRLLVVVLGLRSLLAVRYVLLGPLGVRGVDQLLLAKGLFVITNY |
Ga0182212_11476981 | 3300017691 | Switchgrass Phyllosphere | MGVNLRLLVVVLGLQSLLVVRDVLLGLLGVRGVDQLLLAKGLFVNTNY |
Ga0182210_11138311 | 3300017692 | Switchgrass Phyllosphere | MGVNQRLLVVVLDLRSLLVVRYVLLGPLGVRGVDQLLLAKGLFVIMNY |
Ga0182118_1025081 | 3300020223 | Switchgrass Phyllosphere | MGVNLRLLVVVLGLQSLLVVRDVLLGPLGVRGVDQLLLAKGLFIITNY |
Ga0207684_112285791 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | MGVNLRLLVVVLGLRSLLVVRYVLLGPLGVRGVDQLLLAKGLFIITNY |
Ga0207703_121361101 | 3300026035 | Switchgrass Rhizosphere | MGVNLRLLVVVLGLQSLLVVRDILLGPLGVRGVDQLLLAKGLFVITNY |
Ga0207641_114694791 | 3300026088 | Switchgrass Rhizosphere | MGVNLRLLVVVLGLQSLLVVRDVLLGPLGIRGIDQLLLAKGLFVITNY |
Ga0207641_115742261 | 3300026088 | Switchgrass Rhizosphere | MGVNLRLLIVVLGLQSLLVVRDILLGPLGVRDVDQLLLAKGLFVITNY |
Ga0268322_10405751 | 3300028049 | Phyllosphere | MGVNLRLLVVVLGLQSLLVVRDVLLGPLGVRGVDQLLLAKGLFVITNY |
Ga0268328_10535011 | 3300028050 | Phyllosphere | MGVNLRLLIVVLGLQSLLVVWDVLLGPLGVRGVDQLLLAKGLFVITNY |
Ga0268344_10159711 | 3300028051 | Phyllosphere | MGVNLRLLVVVLDLQSLLVVRDILLGPLGVRGVDQLLLAKGLFVNTNY |
Ga0268314_10208671 | 3300028061 | Phyllosphere | MGVNLRLLVVILGLRSLLVVRYVLLGPLGVRGVDQLLLVKGLFVITNY |
Ga0268334_10042891 | 3300028140 | Phyllosphere | MGVNLRLLVVVLGLRSLLVVRYVLLGPLGVRGVDQLLLAKGLFVITNY |
Ga0268308_10177451 | 3300028151 | Phyllosphere | MGVNLRLLVVVLGLRSLLVVRYVLLGPLGVRGVDQLLLAKGLFVNTNY |
Ga0268341_10008761 | 3300028154 | Phyllosphere | MGVNLRLLVVVLGLRSLLVVRYVLLGPLGVRDVDQLLLAKDLFVITNY |
Ga0268265_114831811 | 3300028380 | Switchgrass Rhizosphere | MGVNLRLLVVVLGLRSLLVVRYVLLGPLGVRGVDQLLLAKGLFAITNY |
Ga0268302_1067311 | 3300028464 | Phyllosphere | MGVNLRLLVVVLGLQSLLVVRDVLLGPLGILLTKGLFVNTNY |
Ga0268307_10021121 | 3300028470 | Phyllosphere | MGVNLRLLVVVLGLQSLLIVRDVLLGPLGVRGVDQLLLAKGLFVIMNY |
Ga0268327_10238551 | 3300028475 | Phyllosphere | MNLRLLVVVLGLQSLLVVRDVLLGPLGVRGVDQLLLAKGLFVITNY |
Ga0268335_10031271 | 3300028527 | Phyllosphere | MGVNLRLLVVVLGLRSHLVVRYVLLGPLGVRGVDQLLLAKGLIGNTNY |
Ga0214492_10292782 | 3300032464 | Switchgrass Phyllosphere | MGVNLRLLVVVLGLRSLLVVRYVLLGPLGVRGVDQLLFAKGLLVITNY |
Ga0214490_11317641 | 3300032502 | Switchgrass Phyllosphere | MDVNLRLLVVVLGLQSLLIVRDVLLGPLGVRGVDQLLLAKGIFVITNY |
Ga0214485_10091902 | 3300032698 | Switchgrass Phyllosphere | MGVNLRLLVVVLGLQSLLVVRDVLLGPLGVRGVDQLLLAKGLFAITNY |
Ga0314753_10684211 | 3300032757 | Switchgrass Phyllosphere | MGVNLRLLVVVLDLRSLLVVRDVLLGPLGVRGVDQLLLDKGLFVITNY |
Ga0314723_10768631 | 3300032823 | Switchgrass Phyllosphere | MGVNLRLLVVVLGLRSLLVVRYVLLGPLGVRGVDKLLFAKGLLVITNY |
Ga0314730_1136221 | 3300032827 | Switchgrass Phyllosphere | MGVNLRLLVVVLGLQSLLVVRDVLLGPLGVRGVDQLLLAKGRSGSWRTEA |
Ga0314739_10405712 | 3300032913 | Switchgrass Phyllosphere | MGVNLRLLVVVLGLRSLLVVRYVLLCPLGVWGVDQPLLAKDLSVITNY |
Ga0314749_10715021 | 3300032915 | Switchgrass Phyllosphere | RLLVVVLGLQSLLVVRDVLLGPLGVRGVDQLLLAKGLFVITNY |
Ga0314722_10369571 | 3300032966 | Switchgrass Phyllosphere | MGVNLRLLIVVLGLQSLLVVWDVLLGPLGIRGVDQLLLAK |
Ga0314755_10007391 | 3300033538 | Switchgrass Phyllosphere | MGVNLRLLVVVLGLRSLLVVRYVLLGPLGVRGVDQLLFAK |
Ga0314755_10301562 | 3300033538 | Switchgrass Phyllosphere | MGVNLRLLVVLLGLRSLLVVRYVLLGPLGVRGVDQLLLAKGL |
⦗Top⦘ |