Basic Information | |
---|---|
Family ID | F082159 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 113 |
Average Sequence Length | 41 residues |
Representative Sequence | MVLELTKEVAALGVKVEFLTKENDKLEKALPKTKRQING |
Number of Associated Samples | 90 |
Number of Associated Scaffolds | 113 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Viruses |
% of genes with valid RBS motifs | 1.79 % |
% of genes near scaffold ends (potentially truncated) | 84.96 % |
% of genes from short scaffolds (< 2000 bps) | 79.65 % |
Associated GOLD sequencing projects | 86 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.50 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Duplodnaviria (69.027 % of family members) |
NCBI Taxonomy ID | 2731341 |
Taxonomy | All Organisms → Viruses → Duplodnaviria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine (18.584 % of family members) |
Environment Ontology (ENVO) | Unclassified (65.487 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Water (non-saline) (56.637 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 41.79% β-sheet: 0.00% Coil/Unstructured: 58.21% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.50 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 113 Family Scaffolds |
---|---|---|
PF01583 | APS_kinase | 6.19 |
PF01165 | Ribosomal_S21 | 5.31 |
PF06414 | Zeta_toxin | 2.65 |
PF13661 | 2OG-FeII_Oxy_4 | 2.65 |
PF13640 | 2OG-FeII_Oxy_3 | 1.77 |
PF11450 | DUF3008 | 0.88 |
PF13884 | Peptidase_S74 | 0.88 |
PF09834 | DUF2061 | 0.88 |
COG ID | Name | Functional Category | % Frequency in 113 Family Scaffolds |
---|---|---|---|
COG0529 | Adenylylsulfate kinase or related kinase | Inorganic ion transport and metabolism [P] | 6.19 |
COG0828 | Ribosomal protein S21 | Translation, ribosomal structure and biogenesis [J] | 5.31 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 92.04 % |
Unclassified | root | N/A | 7.96 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
2035265000|ErSWdraf_F5BXKTZ02GE6KL | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 577 | Open in IMG/M |
3300002274|B570J29581_100843 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2127 | Open in IMG/M |
3300002835|B570J40625_100577808 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1035 | Open in IMG/M |
3300003430|JGI25921J50272_10120197 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 552 | Open in IMG/M |
3300004054|Ga0063232_10048569 | All Organisms → Viruses → Predicted Viral | 1111 | Open in IMG/M |
3300005582|Ga0049080_10175157 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 714 | Open in IMG/M |
3300005805|Ga0079957_1010619 | Not Available | 6948 | Open in IMG/M |
3300005805|Ga0079957_1028535 | All Organisms → Viruses → Predicted Viral | 3735 | Open in IMG/M |
3300007559|Ga0102828_1004369 | All Organisms → Viruses → Predicted Viral | 2703 | Open in IMG/M |
3300007560|Ga0102913_1211085 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 622 | Open in IMG/M |
3300007562|Ga0102915_1085950 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1033 | Open in IMG/M |
3300007590|Ga0102917_1207495 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 683 | Open in IMG/M |
3300007597|Ga0102919_1177904 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 667 | Open in IMG/M |
3300007606|Ga0102923_1086761 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 984 | Open in IMG/M |
3300007606|Ga0102923_1188393 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 642 | Open in IMG/M |
3300007617|Ga0102897_1154939 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 695 | Open in IMG/M |
3300007620|Ga0102871_1068861 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1029 | Open in IMG/M |
3300007625|Ga0102870_1053396 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1198 | Open in IMG/M |
3300007627|Ga0102869_1129155 | Not Available | 685 | Open in IMG/M |
3300007630|Ga0102903_1128278 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 697 | Open in IMG/M |
3300007634|Ga0102901_1124758 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 733 | Open in IMG/M |
3300007649|Ga0102912_1088690 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 892 | Open in IMG/M |
3300008107|Ga0114340_1011646 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 4346 | Open in IMG/M |
3300008107|Ga0114340_1029557 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Oscillatoriophycideae → Chroococcales → unclassified Chroococcales → Chroococcales cyanobacterium metabat2.561 | 3474 | Open in IMG/M |
3300008108|Ga0114341_10042700 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3002 | Open in IMG/M |
3300008108|Ga0114341_10072266 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2168 | Open in IMG/M |
3300008110|Ga0114343_1078898 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1188 | Open in IMG/M |
3300008117|Ga0114351_1126818 | All Organisms → Viruses → Predicted Viral | 2215 | Open in IMG/M |
3300008119|Ga0114354_1142763 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 900 | Open in IMG/M |
3300008120|Ga0114355_1065581 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1567 | Open in IMG/M |
3300008261|Ga0114336_1104565 | All Organisms → cellular organisms → Bacteria → Spirochaetes → Spirochaetia → unclassified Spirochaetia → Spirochaetia bacterium | 1325 | Open in IMG/M |
3300008961|Ga0102887_1261367 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 522 | Open in IMG/M |
3300009049|Ga0102911_1246501 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 501 | Open in IMG/M |
3300009059|Ga0102830_1249016 | Not Available | 519 | Open in IMG/M |
3300009068|Ga0114973_10064080 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2140 | Open in IMG/M |
3300009080|Ga0102815_10254364 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 969 | Open in IMG/M |
3300009159|Ga0114978_10253288 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1093 | Open in IMG/M |
3300009419|Ga0114982_1174264 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 665 | Open in IMG/M |
3300010157|Ga0114964_10219896 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 909 | Open in IMG/M |
3300010158|Ga0114960_10519047 | Not Available | 570 | Open in IMG/M |
3300010160|Ga0114967_10197936 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1082 | Open in IMG/M |
3300013005|Ga0164292_10934050 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 543 | Open in IMG/M |
3300013372|Ga0177922_11212857 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 597 | Open in IMG/M |
3300017722|Ga0181347_1156376 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 620 | Open in IMG/M |
3300017766|Ga0181343_1145674 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 661 | Open in IMG/M |
3300017778|Ga0181349_1212266 | Not Available | 664 | Open in IMG/M |
3300017778|Ga0181349_1247044 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 597 | Open in IMG/M |
3300017784|Ga0181348_1031724 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2219 | Open in IMG/M |
3300017784|Ga0181348_1273679 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 575 | Open in IMG/M |
3300020141|Ga0211732_1008456 | All Organisms → Viruses → Predicted Viral | 1353 | Open in IMG/M |
3300020141|Ga0211732_1035642 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 905 | Open in IMG/M |
3300020151|Ga0211736_10228034 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1068 | Open in IMG/M |
3300020151|Ga0211736_10289219 | All Organisms → Viruses → Predicted Viral | 4748 | Open in IMG/M |
3300020159|Ga0211734_10601595 | Not Available | 1819 | Open in IMG/M |
3300020160|Ga0211733_10009031 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 832 | Open in IMG/M |
3300020160|Ga0211733_10158952 | All Organisms → Viruses → Predicted Viral | 3677 | Open in IMG/M |
3300020160|Ga0211733_10231031 | All Organisms → Viruses → Predicted Viral | 3432 | Open in IMG/M |
3300020161|Ga0211726_10180664 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 695 | Open in IMG/M |
3300020161|Ga0211726_10226032 | All Organisms → Viruses → Predicted Viral | 3701 | Open in IMG/M |
3300020161|Ga0211726_10629029 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 678 | Open in IMG/M |
3300020162|Ga0211735_10148168 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 615 | Open in IMG/M |
3300020162|Ga0211735_10755453 | All Organisms → Viruses → Predicted Viral | 1334 | Open in IMG/M |
3300020172|Ga0211729_10379913 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 786 | Open in IMG/M |
3300020172|Ga0211729_11373717 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 591 | Open in IMG/M |
3300020205|Ga0211731_11474428 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 589 | Open in IMG/M |
3300020205|Ga0211731_11515973 | All Organisms → cellular organisms → Bacteria | 2823 | Open in IMG/M |
3300020220|Ga0194119_10046080 | All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon | 4064 | Open in IMG/M |
3300020531|Ga0208487_1010227 | All Organisms → Viruses → Predicted Viral | 1241 | Open in IMG/M |
3300020532|Ga0208601_1049397 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 587 | Open in IMG/M |
3300020539|Ga0207941_1035955 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 671 | Open in IMG/M |
3300020563|Ga0208082_1057239 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 660 | Open in IMG/M |
3300020578|Ga0194129_10111304 | All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon | 1841 | Open in IMG/M |
3300020603|Ga0194126_10574389 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 679 | Open in IMG/M |
3300021091|Ga0194133_10132101 | All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon | 1825 | Open in IMG/M |
3300021963|Ga0222712_10128277 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1739 | Open in IMG/M |
3300021963|Ga0222712_10628004 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 616 | Open in IMG/M |
3300023311|Ga0256681_10712414 | Not Available | 504 | Open in IMG/M |
3300026459|Ga0255170_1024685 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1137 | Open in IMG/M |
3300026569|Ga0255277_1090522 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 771 | Open in IMG/M |
3300027193|Ga0208800_1002623 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2221 | Open in IMG/M |
3300027211|Ga0208307_1060835 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 558 | Open in IMG/M |
3300027291|Ga0255139_1037449 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 929 | Open in IMG/M |
3300027608|Ga0208974_1113388 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 714 | Open in IMG/M |
3300027710|Ga0209599_10030293 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1473 | Open in IMG/M |
3300027734|Ga0209087_1196159 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 777 | Open in IMG/M |
3300027753|Ga0208305_10185567 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 752 | Open in IMG/M |
3300027782|Ga0209500_10245813 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 783 | Open in IMG/M |
3300027963|Ga0209400_1088588 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1471 | Open in IMG/M |
3300028025|Ga0247723_1039442 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1417 | Open in IMG/M |
3300031784|Ga0315899_11439799 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 581 | Open in IMG/M |
3300031787|Ga0315900_10317803 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1278 | Open in IMG/M |
3300032116|Ga0315903_10667339 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 784 | Open in IMG/M |
3300033816|Ga0334980_0393124 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 526 | Open in IMG/M |
3300033994|Ga0334996_0163445 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1225 | Open in IMG/M |
3300033996|Ga0334979_0109629 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1709 | Open in IMG/M |
3300034093|Ga0335012_0197277 | All Organisms → Viruses → Predicted Viral | 1068 | Open in IMG/M |
3300034093|Ga0335012_0339733 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 750 | Open in IMG/M |
3300034093|Ga0335012_0395166 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 677 | Open in IMG/M |
3300034093|Ga0335012_0505914 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 572 | Open in IMG/M |
3300034103|Ga0335030_0313784 | All Organisms → Viruses → Predicted Viral | 1045 | Open in IMG/M |
3300034103|Ga0335030_0355670 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 964 | Open in IMG/M |
3300034105|Ga0335035_0028544 | All Organisms → Viruses → Predicted Viral | 3715 | Open in IMG/M |
3300034106|Ga0335036_0010995 | All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon | 7414 | Open in IMG/M |
3300034108|Ga0335050_0183587 | All Organisms → Viruses → Predicted Viral | 1103 | Open in IMG/M |
3300034111|Ga0335063_0042321 | All Organisms → Viruses → Predicted Viral | 2896 | Open in IMG/M |
3300034116|Ga0335068_0395032 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 663 | Open in IMG/M |
3300034167|Ga0335017_0579030 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 584 | Open in IMG/M |
3300034279|Ga0335052_0088383 | All Organisms → Viruses → Predicted Viral | 1880 | Open in IMG/M |
3300034279|Ga0335052_0195317 | All Organisms → Viruses → Predicted Viral | 1168 | Open in IMG/M |
3300034283|Ga0335007_0241586 | Not Available | 1223 | Open in IMG/M |
3300034355|Ga0335039_0052976 | All Organisms → cellular organisms → Bacteria → FCB group | 2441 | Open in IMG/M |
3300034355|Ga0335039_0525997 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 589 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 18.58% |
Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine | 18.58% |
Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 16.81% |
Freshwater, Plankton | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton | 7.96% |
Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 7.96% |
Freshwater Lake | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake | 7.08% |
Freshwater | Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater | 5.31% |
Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 3.54% |
Freshwater | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater | 2.65% |
Freshwater | Environmental → Aquatic → Freshwater → River → Unclassified → Freshwater | 2.65% |
Freshwater Lentic | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lentic | 1.77% |
Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Lake | 1.77% |
Estuarine Water | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water | 1.77% |
Deep Subsurface | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface | 1.77% |
Freshwater | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater | 0.89% |
Deep Subsurface Sediment | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface Sediment | 0.89% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
2035265000 | Freshwater microbial communities from Swedish Lakes - surface of Lake Erken | Environmental | Open in IMG/M |
3300002274 | Freshwater microbial communities from Lake Mendota, WI - 12OCT2012 deep hole epilimnion | Environmental | Open in IMG/M |
3300002835 | Freshwater microbial communities from Lake Mendota, WI - (Lake Mendota Combined Ray assembly, ASSEMBLY_DATE=20140605) | Environmental | Open in IMG/M |
3300003430 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.SD | Environmental | Open in IMG/M |
3300004054 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.SN (v2) | Environmental | Open in IMG/M |
3300005582 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER15MSRF | Environmental | Open in IMG/M |
3300005805 | Microbial and algae communities from Cheney Reservoir in Wichita, Kansas, USA | Environmental | Open in IMG/M |
3300007559 | Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.541 | Environmental | Open in IMG/M |
3300007560 | Estuarine microbial communities from the Columbia River estuary - metaG 1560A-02 | Environmental | Open in IMG/M |
3300007562 | Estuarine microbial communities from the Columbia River estuary - metaG 1561A-02 | Environmental | Open in IMG/M |
3300007590 | Estuarine microbial communities from the Columbia River estuary - metaG 1562A-02 | Environmental | Open in IMG/M |
3300007597 | Estuarine microbial communities from the Columbia River estuary - metaG 1563A-02 | Environmental | Open in IMG/M |
3300007606 | Estuarine microbial communities from the Columbia River estuary - metaG 1569-02 | Environmental | Open in IMG/M |
3300007617 | Estuarine microbial communities from the Columbia River estuary - metaG 1554B-02 | Environmental | Open in IMG/M |
3300007620 | Estuarine microbial communities from the Columbia River estuary - metaG 1546C-02 | Environmental | Open in IMG/M |
3300007625 | Estuarine microbial communities from the Columbia River estuary - metaG 1546B-02 | Environmental | Open in IMG/M |
3300007627 | Estuarine microbial communities from the Columbia River estuary - metaG 1546A-02 | Environmental | Open in IMG/M |
3300007630 | Estuarine microbial communities from the Columbia River estuary - metaG 1555C-02 | Environmental | Open in IMG/M |
3300007634 | Estuarine microbial communities from the Columbia River estuary - metaG 1555A-02 | Environmental | Open in IMG/M |
3300007649 | Estuarine microbial communities from the Columbia River estuary - metaG 1560A-3 | Environmental | Open in IMG/M |
3300008107 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0046-3-NA | Environmental | Open in IMG/M |
3300008108 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0048-C-NA | Environmental | Open in IMG/M |
3300008110 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0048-3-NA | Environmental | Open in IMG/M |
3300008117 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0108-C-NA | Environmental | Open in IMG/M |
3300008119 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE4, Sample E2014-0110-C-NA | Environmental | Open in IMG/M |
3300008120 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0108-3-NA | Environmental | Open in IMG/M |
3300008261 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, sample HABS-E2014-0024-C-NA | Environmental | Open in IMG/M |
3300008961 | Estuarine microbial communities from the Columbia River estuary - metaG 1550B-02 | Environmental | Open in IMG/M |
3300009049 | Estuarine microbial communities from the Columbia River estuary - metaG 1558A-02 | Environmental | Open in IMG/M |
3300009059 | Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.703 | Environmental | Open in IMG/M |
3300009068 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140807_MF_MetaG | Environmental | Open in IMG/M |
3300009080 | Estuarine microbial communities from the Columbia River estuary - Ebb tide ETM metaG S.759 | Environmental | Open in IMG/M |
3300009159 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140212_EF_MetaG | Environmental | Open in IMG/M |
3300009419 | Subsurface microbial communities from deep shales in Ohio, USA - Utica-3 well 1 S input2 FT | Environmental | Open in IMG/M |
3300010157 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_131016_MF_MetaG | Environmental | Open in IMG/M |
3300010158 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130625_MF_MetaG | Environmental | Open in IMG/M |
3300010160 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130628_MF_MetaG | Environmental | Open in IMG/M |
3300013005 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES117 metaG | Environmental | Open in IMG/M |
3300013372 | Freshwater microbial communities from Lake Erie, Ontario, Canada. Combined Assembly of 10 SPs | Environmental | Open in IMG/M |
3300017722 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.S.N | Environmental | Open in IMG/M |
3300017766 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MLB.S.D | Environmental | Open in IMG/M |
3300017778 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.S.D | Environmental | Open in IMG/M |
3300017784 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.D.N | Environmental | Open in IMG/M |
3300020141 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_104 megahit1 | Environmental | Open in IMG/M |
3300020151 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_202 megahit1 | Environmental | Open in IMG/M |
3300020159 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_108 megahit1 | Environmental | Open in IMG/M |
3300020160 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_105 megahit1 | Environmental | Open in IMG/M |
3300020161 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_101 megahit1 | Environmental | Open in IMG/M |
3300020162 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_201 megahit1 | Environmental | Open in IMG/M |
3300020172 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_102 megahit1 | Environmental | Open in IMG/M |
3300020205 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_103 megahit1 | Environmental | Open in IMG/M |
3300020220 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015018 Mahale Deep Cast 100m | Environmental | Open in IMG/M |
3300020531 | Freshwater microbial communities from Lake Mendota, WI - 21SEP2012 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
3300020532 | Freshwater microbial communities from Lake Mendota, WI - 09NOV2012 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
3300020539 | Freshwater microbial communities from Lake Mendota, WI - 13SEP2012 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
3300020563 | Freshwater microbial communities from Lake Mendota, WI - 09JUN2009 deep hole epilimnion ns (SPAdes) | Environmental | Open in IMG/M |
3300020578 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015038 Kigoma Deep Cast 35m | Environmental | Open in IMG/M |
3300020603 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015035 Kigoma Deep Cast 150m | Environmental | Open in IMG/M |
3300021091 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015055 Kigoma Offshore 40m | Environmental | Open in IMG/M |
3300021963 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_657D | Environmental | Open in IMG/M |
3300023311 | Combined Assembly of Gp0281739, Gp0281740, Gp0281741 | Environmental | Open in IMG/M |
3300026459 | Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Yuk_RepA_8d | Environmental | Open in IMG/M |
3300026569 | Metatranscriptome of freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Cont_RepA_8d (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300027193 | Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.541 (SPAdes) | Environmental | Open in IMG/M |
3300027211 | Estuarine microbial communities from the Columbia River estuary - metaG 1449B-02 (SPAdes) | Environmental | Open in IMG/M |
3300027291 | Freshwater microbial communities from St. Lawrence River, New York, United States - Law_Colum_RepB_8d | Environmental | Open in IMG/M |
3300027608 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER15MSRF (SPAdes) | Environmental | Open in IMG/M |
3300027710 | Subsurface microbial communities from deep shales in Ohio, USA - Utica-3 well 1 S input2 FT (SPAdes) | Environmental | Open in IMG/M |
3300027734 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027753 | Estuarine microbial communities from the Columbia River estuary - Flood tide ETM metaG S.741 (SPAdes) | Environmental | Open in IMG/M |
3300027782 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140212_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027963 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300028025 | Subsurface sediment microbial communities from gas well in West Virginia, United States - MSEEL Well Study Marcellus 5H_FC | Environmental | Open in IMG/M |
3300031784 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 4 MA112 | Environmental | Open in IMG/M |
3300031787 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA114 | Environmental | Open in IMG/M |
3300032116 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA119 | Environmental | Open in IMG/M |
3300033816 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME16Sep2004-rr0005 | Environmental | Open in IMG/M |
3300033994 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME25Jul2006D11-rr0046 | Environmental | Open in IMG/M |
3300033996 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME20Jul2016-rr0004 | Environmental | Open in IMG/M |
3300034093 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME08Jun2014-rr0072 | Environmental | Open in IMG/M |
3300034103 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME27Sep2002-rr0119 | Environmental | Open in IMG/M |
3300034105 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME15May2014-rr0127 | Environmental | Open in IMG/M |
3300034106 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME23Aug2013-rr0131 | Environmental | Open in IMG/M |
3300034108 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME24Jun2014-rr0157 | Environmental | Open in IMG/M |
3300034111 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME03Oct2011-rr0186 | Environmental | Open in IMG/M |
3300034116 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-CONTROL-GENDONOR | Environmental | Open in IMG/M |
3300034167 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME11Apr2015-rr0082 | Environmental | Open in IMG/M |
3300034279 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME17Jul2014-rr0163 | Environmental | Open in IMG/M |
3300034283 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME07Aug2003-rr0061 | Environmental | Open in IMG/M |
3300034355 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME18Oct2015-rr0135 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
ErSWdraft_6455830 | 2035265000 | Freshwater | MVLELTREVAALGVKVEFLTKENDKLEKSIPKNKKQLNG |
B570J29581_1008435 | 3300002274 | Freshwater | DDLRNMVLELTREVAALGVKVEFLTKENDKLEKSIPKAKKQILNG* |
B570J40625_1005778083 | 3300002835 | Freshwater | MVLELTKEVAALGVKVEFLTKENDKLEKALPKTKRQING* |
JGI25921J50272_101201972 | 3300003430 | Freshwater Lake | KDELRGMVLALTKEVAALSVKVEYLTKENDKLEKALPKTKRQING* |
Ga0063232_100485693 | 3300004054 | Freshwater Lake | MVLELTKEVAALGVKVEFLTKENDKLEKSLPKTRKQING* |
Ga0049080_101751571 | 3300005582 | Freshwater Lentic | LTKEVAALSVKVEFLTKENDKLEKSIPKRKKTLLND* |
Ga0079957_10106195 | 3300005805 | Lake | LRAMVLALTKEVAALSVKVEYLTKENDKLEKALPKTRKQING* |
Ga0079957_10285351 | 3300005805 | Lake | LRAMVLALTKEVAALSVKVEYLTKENDKLEKALPKAKRQING* |
Ga0102828_10043695 | 3300007559 | Estuarine | EKDELRNMVLGLTKEVAALSVKVEFLTRENDKLEKAIPKTKKQLNG* |
Ga0102913_12110852 | 3300007560 | Estuarine | EAAGREKDELRMMVLELTKEVAALGVKVEYLTKENDKLEKALPKTKRQING* |
Ga0102915_10859501 | 3300007562 | Estuarine | EKDDLRMMVLNLTKEVAALSVKVEFLTKENDKLEKAVPKTKIKKQLNG* |
Ga0102917_12074952 | 3300007590 | Estuarine | SKEKDELRSMVLALTKEVAALTVKVEYLTKENDKLEKALPKTKRQING* |
Ga0102919_11779042 | 3300007597 | Estuarine | EKDELRGMVLALTKEVAALTVKVEYLTKENDKLEKALPKTKRQING* |
Ga0102923_10867611 | 3300007606 | Estuarine | TREVAALSVKVEFLTRENDKLEKAIPKTKKQLNG* |
Ga0102923_11883932 | 3300007606 | Estuarine | QMILALTKEVAALSVKVEYLTKENEELHKKTKKQLNG* |
Ga0102897_11549391 | 3300007617 | Estuarine | LRNMVLGLTKEVAALSVKVEFLTKENDKLEKALPKTKKQLNG* |
Ga0102871_10688611 | 3300007620 | Estuarine | MILALTKEVAALSVKVEYLTKENEELHKKTKKQLNG* |
Ga0102870_10533963 | 3300007625 | Estuarine | REKDDLRNMVLALTKEVAALSVKVEFLTKENDKLEKALPKTKKQLNG* |
Ga0102869_11291551 | 3300007627 | Estuarine | LRGMVLELTREVAALGVKVEFLTRENDKLEKALPKTKKQILNG* |
Ga0102903_11282781 | 3300007630 | Estuarine | KEKDDLRNMVLELTREVAALGVKVEFLTKENDKLEKALPKTKKQLNG* |
Ga0102901_11247583 | 3300007634 | Estuarine | LELTKEVAALGVKVEFLTKENDKLEKAIPKTKRQING* |
Ga0102912_10886902 | 3300007649 | Estuarine | RNMVLGLTKEVAALSVKVEFLTKENDKLEKAVPKTKKQLNG* |
Ga0114340_10116461 | 3300008107 | Freshwater, Plankton | KEKDELRNMVLSLTKEVAALSVKVEFLTKENDKLEKALPKTKKQLNG* |
Ga0114340_10295573 | 3300008107 | Freshwater, Plankton | MIIEMTAKVAELTVKVEYLTKENDKLEKALPKTKRQING* |
Ga0114341_100427004 | 3300008108 | Freshwater, Plankton | MVLNLTKEVAALSVKVEFLTKENDKLEKALPKTKKQLNG* |
Ga0114341_100722661 | 3300008108 | Freshwater, Plankton | TKEVAALSVKVEYLTKENDKLEKALPKAKRQING* |
Ga0114343_10788981 | 3300008110 | Freshwater, Plankton | KDEMRKMIIEMTAKVAELTVKVEYLTKENDKLEKALPKTKRQING* |
Ga0114351_11268184 | 3300008117 | Freshwater, Plankton | MVLDMTAKVAELTVKVEYLTRENDKLEKALPKTRKQVNG* |
Ga0114354_11427631 | 3300008119 | Freshwater, Plankton | EVAALSVKVEFLTKENDKLEKALPKTRKKQQLNG* |
Ga0114355_10655811 | 3300008120 | Freshwater, Plankton | SKEKDDLRNMVLALTKEVAALSVKVEFLTKENDKLEKALPKTKKQLNG* |
Ga0114336_11045651 | 3300008261 | Freshwater, Plankton | SKEKDELRMMVLNLTKEVAALSVKVEFLTKENDKLEKALPKAKRQING* |
Ga0102887_12613671 | 3300008961 | Estuarine | RQMILALTKEVAALSVKVEYLTKENEELHKKTKKQLNG* |
Ga0102911_12465012 | 3300009049 | Estuarine | LTKEVAALTVKVEYLTKENDKLEKALPKTKRQING* |
Ga0102830_12490161 | 3300009059 | Estuarine | RNMVLELTREVAALSVKVEFLTRENDKLEKALPKTKKQTLNG* |
Ga0114973_100640801 | 3300009068 | Freshwater Lake | MVLELTKEVAALGVKVEFLTRENDKLEKALPKTKRQING* |
Ga0102815_102543641 | 3300009080 | Estuarine | ELTKEVAALSVKVEFLTRENDKLEKALPKTKKQLNG* |
Ga0114978_102441751 | 3300009159 | Freshwater Lake | KGDLRNMVLALTKEVAALSVKVEFLTKENEELNKKSKSKKTLLNG* |
Ga0114978_102532881 | 3300009159 | Freshwater Lake | TKEVAALGVKVEFLTKENDKLEKALPKTKRQING* |
Ga0114982_11742641 | 3300009419 | Deep Subsurface | EKDELRNMVLALTKEVAALGVKVEFLTKENDKLEKALPKTKRQING* |
Ga0114964_102198961 | 3300010157 | Freshwater Lake | AAGKEKDDLRKMILDLTKQVAALGVKVEFLTKENEKLANLKPSAKKILKG* |
Ga0114960_105190472 | 3300010158 | Freshwater Lake | DLTKHVAELSVKVEFLTKENEKLAKTSTKPTKKQLNG* |
Ga0114967_101979363 | 3300010160 | Freshwater Lake | ELTKEVAALGVKVEFLTKENDKLEKAIPKTKRQING* |
Ga0164292_109340502 | 3300013005 | Freshwater | SKEKDELRSMVLALTKEVAALSVKVEYLTKENDKLEKALPKAKRQING* |
Ga0177922_112128571 | 3300013372 | Freshwater | LRNMVLELTREVAALSVKVEFLTKENDKLEKALPKTKKQILNG* |
Ga0181347_11563761 | 3300017722 | Freshwater Lake | KDELRNMVLELTREVAALSVKVEFLTRENDKLEKAIPKTKKQILNG |
Ga0181343_11456741 | 3300017766 | Freshwater Lake | VLALTKEVAALSVKVEFLTKENEELNKKTKARKQTLNG |
Ga0181349_12122661 | 3300017778 | Freshwater Lake | LELTREVAALSVKVEFLTRENDKLEKALPKTKKQTLNG |
Ga0181349_12470442 | 3300017778 | Freshwater Lake | SKEKDELRSMVLELTKEVAALGVKVEFLTKENDKLEKALPKTKRQING |
Ga0181348_10317241 | 3300017784 | Freshwater Lake | DELRNMVLELTREVAALSVKVEFLTRENDKLEKALPKTKKQTLNG |
Ga0181348_12736792 | 3300017784 | Freshwater Lake | ELTREVAALSVKVEFLTKENDKLEKALPKTKKQILNG |
Ga0211732_10084561 | 3300020141 | Freshwater | DELRMMVLELTKEVAALGVKVEFLTKENDKLEKALPKTRKQING |
Ga0211732_10356421 | 3300020141 | Freshwater | DELRMMVLELTKEVAALGVKVEFLTKENDKLEKALPKTKRQING |
Ga0211736_102280341 | 3300020151 | Freshwater | LELTREVAALGVKVEFLTKENDKLEKSIPKNKKQLNG |
Ga0211736_102892191 | 3300020151 | Freshwater | ELRSMVLGLTKEVAALSVKVEFLTKENDKLEKAIPKTRKQING |
Ga0211734_106015955 | 3300020159 | Freshwater | RSMVLALTKEVAALSVKVEYLTKENDKLEKALPKAKRQING |
Ga0211733_100090311 | 3300020160 | Freshwater | LRNMVLALTKEVAELGVKVEYLTKENDKLEKALPKAKRQIING |
Ga0211733_101589521 | 3300020160 | Freshwater | LRMMVLELTKEVAALGVKVEFLTKENDKLEQALPKTKKQING |
Ga0211733_102310316 | 3300020160 | Freshwater | NMVLALTKEVAALGVKVEYLTKENDKLEKALPKTRKQING |
Ga0211726_101806642 | 3300020161 | Freshwater | KDELRMMVLELTKEVAALGVKVEFLTKENDKLEKALPKTRKQING |
Ga0211726_102260321 | 3300020161 | Freshwater | KDELRMMVLELTKEVAALGVKVEFLTKENDKLEKALPKTKKQING |
Ga0211726_106290292 | 3300020161 | Freshwater | LRNMVLELTREVAALGVKVEFLTKENDKLEKALPKTKKQLNG |
Ga0211735_101481681 | 3300020162 | Freshwater | REKDELRMMVLELTKEVAALGVKVEYLTKENDKLEKALPKTRKQING |
Ga0211735_107554533 | 3300020162 | Freshwater | RMMVLELTKEVAALGVKVEFLTKENDKLEKALPKTKRQING |
Ga0211729_103799132 | 3300020172 | Freshwater | KEKDELRSMVLELTREVAALGVKVEFLTKENDKLEKSIPKTRKQING |
Ga0211729_113737172 | 3300020172 | Freshwater | LELTREVAALGVKVEFLTKENDKLEKALPKTKKQLNG |
Ga0211731_114744281 | 3300020205 | Freshwater | LELTREVAALGVKVEFLTKENDKLEKAIPKSKKQING |
Ga0211731_115159731 | 3300020205 | Freshwater | ESSKEKDELRSMVLALTKEVAALSVKVEYLTKENDKLEKALPKTRKQING |
Ga0194119_100460801 | 3300020220 | Freshwater Lake | LTKEVAALSVKVEFLTKENEELHKKASKTKRIING |
Ga0208487_10102271 | 3300020531 | Freshwater | LTKEVAALGVKVEFLTKENDKLEKALPKTKRQING |
Ga0208601_10493972 | 3300020532 | Freshwater | RSMVLELTKEVAALGVKVEFLTKENDKLEKALPKTKRQING |
Ga0207941_10359552 | 3300020539 | Freshwater | KEKDDLRNMVLELTREVAALGVKVEFLTKENDKLEKSIPKAKKQILNG |
Ga0208082_10572392 | 3300020563 | Freshwater | LRNMVLALTKEVAALSVKVEFLTKENDKLEKALPKTKRQING |
Ga0194129_101113041 | 3300020578 | Freshwater Lake | SREKNELRTMVLNLTKEVAALSVKVEFLTKENEELHKKASKTKRIING |
Ga0194126_105743891 | 3300020603 | Freshwater Lake | ELRTMVLNLTKEVAALSVKVEFLTKENEELHKKASKTKRIING |
Ga0194133_101321011 | 3300021091 | Freshwater Lake | NLTKEVAALSVKVEFLTKENEELHKKASKTKRIING |
Ga0222712_101282771 | 3300021963 | Estuarine Water | REKDELRTMILSLTKEVAALTVKVEYLTKENDKLEKALPKAKKTLLNG |
Ga0222712_106280042 | 3300021963 | Estuarine Water | DELRSMVLALTKEVAALSVKVEYLTKENDKLEKALPKAKRQING |
Ga0256681_107124142 | 3300023311 | Freshwater | VQAGKEKDDLRGMILDLTKQVAALSVKVEFLTKENEKLKSNKAENNKKQLNG |
Ga0255170_10246853 | 3300026459 | Freshwater | MTAKVAELTVKVEYLTRENDKLEKALPKAKRQLNG |
Ga0255277_10905221 | 3300026569 | Freshwater | MTAKVAELTVKVEYLTRENDKLEKSLPKAKRQLNG |
Ga0208800_10026231 | 3300027193 | Estuarine | GLLEAAGSEKNDLRMMILDLTKQVAALSVKVEFLTKENDKLVKATPKTTKKQLNG |
Ga0208307_10608352 | 3300027211 | Estuarine | RSMVLALTKEVAALSVKVEYLTKENDKLEKALPKAKRQQING |
Ga0255139_10374491 | 3300027291 | Freshwater | LRTMVLELTKEVAALGVKVEFLTKENDKLEKALPKTKRQING |
Ga0208974_11133881 | 3300027608 | Freshwater Lentic | LTKEVAALSVKVEFLTKENDKLEKSIPKRKKTLLND |
Ga0209599_100302931 | 3300027710 | Deep Subsurface | RNMVLSLTKEVAALSVKVEFLTKENEKLEKTTKPKKQQLNG |
Ga0209087_11961592 | 3300027734 | Freshwater Lake | ELRSMVLELTKEVAALGVKVEFLTKENDKLEKAIPKTKRQING |
Ga0208305_101855671 | 3300027753 | Estuarine | LTKEVAALSVKVEFLTRENDKLEKALPKTKKQLNG |
Ga0209500_102458131 | 3300027782 | Freshwater Lake | ELRTMVLELTKEVAALGVKVEFLTKENDKLEKALPKTKRQING |
Ga0209400_10885883 | 3300027963 | Freshwater Lake | RNMVLELTKEVAALGVKVEFLTKENDKLEKALPKTKKQING |
Ga0247723_10394423 | 3300028025 | Deep Subsurface Sediment | MVLALTKEVAALSVKVEFLTKENDKLEKALPKIRKKQQING |
Ga0315899_114397992 | 3300031784 | Freshwater | RNMVLALTKEVAALSVKVEFLTKENEELNKKTKVRKQTLNG |
Ga0315900_103178034 | 3300031787 | Freshwater | DEMRKMIIEMTAKVAELTVKVEYLTKENDKLEKALPKAKRQING |
Ga0315903_106673393 | 3300032116 | Freshwater | ALTKEVAALSVKVEFLTKENDKLEKALPKTRKKQQLNG |
Ga0334980_0393124_2_121 | 3300033816 | Freshwater | MVLALTKEVAALSVKVEYLTKENDKLEKALPKTKRQING |
Ga0334996_0163445_1088_1207 | 3300033994 | Freshwater | MVLELTKEVAALGVKVEFLTKENDKLEKALPKTKRQING |
Ga0334979_0109629_1570_1692 | 3300033996 | Freshwater | MVLELTREVAALGVKVEFLTKENDKLEKSIPKAKKQILNG |
Ga0335012_0197277_7_129 | 3300034093 | Freshwater | MMVLELTKEVAALGVKVEYLTKENDKLEKALPRTKRQING |
Ga0335012_0339733_600_722 | 3300034093 | Freshwater | MMVLNLTKEVAALSVKVEFLTKENDKLEKALPKTKKQLNG |
Ga0335012_0395166_1_111 | 3300034093 | Freshwater | ELTKEVAALGVKVEFLTKENDKLEKALPKTKRQING |
Ga0335012_0505914_404_562 | 3300034093 | Freshwater | LEASAREKDDLRGMVLALTKEVAALSVKVEYLTKENDKLEKALPRTKRQING |
Ga0335030_0313784_928_1044 | 3300034103 | Freshwater | LALTKEVAALSVKVEFLTKENDKLEKALPKTKKQQLNG |
Ga0335030_0355670_27_146 | 3300034103 | Freshwater | MVLALTKEVAALSVKVEYLTKENDKLEKALPKTRKQING |
Ga0335035_0028544_2_115 | 3300034105 | Freshwater | LELTKEVAALGVKVEFLTKENDKLEKALPKTKRQING |
Ga0335036_0010995_7283_7402 | 3300034106 | Freshwater | MVLELTREVAALSVKVEFLTKENDKLEKSLPKTKRQING |
Ga0335050_0183587_994_1101 | 3300034108 | Freshwater | LTKEVAALGVKVEFLTKENDKLEKALPKTRKQING |
Ga0335063_0042321_30_149 | 3300034111 | Freshwater | MVFELTKEVAALGVKVEFLTKENDKLEKALPKTKRQING |
Ga0335068_0395032_22_144 | 3300034116 | Freshwater | MVLALTKEVAALSVKVEFLTKENDKLEKALPKTKKQTLNG |
Ga0335017_0579030_477_584 | 3300034167 | Freshwater | TKEVAALSVKVEFLTKENDKLEKSIPKRKKTLLND |
Ga0335052_0088383_13_132 | 3300034279 | Freshwater | MVLELTREVAALSVKVEFLTKENDKLEKSLPKTRKQING |
Ga0335052_0195317_1052_1168 | 3300034279 | Freshwater | VLELTKEVAALGVKVEFLTKENDKLEKALPKTRKQING |
Ga0335007_0241586_1080_1202 | 3300034283 | Freshwater | MVLALTKEVAALSVKVEFLTKENDKLEKALPKTKKQQING |
Ga0335039_0052976_3_110 | 3300034355 | Freshwater | TKQVAALTVKVEFLTKENEKLVKATPKTTKKQLNG |
Ga0335039_0525997_424_543 | 3300034355 | Freshwater | MVLALTKEVAALSVKVEFLTKENDKLEKALPKTKRQING |
⦗Top⦘ |