Metagenome Family F082225

Basic Information
Family ID	F082225
Family Type	Metagenome
Number of Sequences	113
Average Sequence Length	37 residues
Representative Sequence	MLDGDKKIFMTITLNFYIVVNKSYLYNYSEKITV
Number of Associated Samples	8
Number of Associated Scaffolds	113

Quality Assessment
Transcriptomic Evidence	No
Most common taxonomic group	Unclassified
% of genes with valid RBS motifs	2.80 %
% of genes near scaffold ends (potentially truncated)	23.01 %
% of genes from short scaffolds (< 2000 bps)	46.02 %
Associated GOLD sequencing projects	6
AlphaFold2 3D model prediction	Yes
3D model pTM-score	0.49

Most Common Taxonomy
Group	Unclassified (53.097 % of family members)
NCBI Taxonomy ID	N/A
Taxonomy	N/A

Most Common Ecosystem
GOLD Ecosystem	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Root Nodules (83.186 % of family members)
Environment Ontology (ENVO)	Unclassified (100.000 % of family members)
Earth Microbiome Project Ontology (EMPO)	Host-associated → Plant → Plant rhizosphere (100.000 % of family members)

Full Alignment
Alignment of all the sequences in the family.

Powered by MSAViewer

Seed Alignment
Alignment of a non-redundant set of sequences, used to build the family's HMM profile.

Powered by MSAViewer

AlphaFold2 Input Alignment
Refined alignment used as input for AlphaFold2.

Powered by MSAViewer

Predicted Topology & Secondary Structure
Classification:	Globular	Signal Peptide:	No	Secondary Structure distribution:	α-helix: 51.61% β-sheet: 0.00% Coil/Unstructured: 48.39%
Feature Viewer

Powered by Feature Viewer

Pfam ID	Name	% Frequency in 113 Family Scaffolds
PF07727	RVT_2	2.65
PF00078	RVT_1	1.77
PF00400	WD40	1.77
PF13963	Transpos_assoc	1.77
PF08284	RVP_2	0.88
PF03108	DBD_Tnp_Mut	0.88
PF00514	Arm	0.88
PF16561	AMPK1_CBM	0.88
PF02892	zf-BED	0.88
PF00665	rve	0.88
PF03514	GRAS	0.88
PF01504	PIP5K	0.88
PF13456	RVT_3	0.88
PF06426	SATase_N	0.88
PF00348	polyprenyl_synt	0.88
PF01490	Aa_trans	0.88
PF00150	Cellulase	0.88

COG ID	Name	Functional Category	% Frequency in 113 Family Scaffolds
COG0142	Geranylgeranyl pyrophosphate synthase	Coenzyme transport and metabolism [H]	0.88
COG0531	Serine transporter YbeC, amino acid:H+ symporter family	Amino acid transport and metabolism [E]	0.88
COG0814	Amino acid permease	Amino acid transport and metabolism [E]	0.88
COG1045	Serine acetyltransferase	Amino acid transport and metabolism [E]	0.88
COG2730	Aryl-phospho-beta-D-glucosidase BglC, GH1 family	Carbohydrate transport and metabolism [G]	0.88
COG2801	Transposase InsO and inactivated derivatives	Mobilome: prophages, transposons [X]	0.88
COG2826	Transposase and inactivated derivatives, IS30 family	Mobilome: prophages, transposons [X]	0.88
COG3316	Transposase (or an inactivated derivative), DDE domain	Mobilome: prophages, transposons [X]	0.88
COG3934	Endo-1,4-beta-mannosidase	Carbohydrate transport and metabolism [G]	0.88
COG4584	Transposase	Mobilome: prophages, transposons [X]	0.88

NCBI Taxonomy

Select NCBI taxonomy Level:

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	53.10 %
All Organisms	root	All Organisms	46.90 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	53.10 %
cellular organisms	root	All Organisms → cellular organisms	44.25 %
Viruses	superkingdom	All Organisms → Viruses	2.65 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	53.10 %
Eukaryota	superkingdom	All Organisms → cellular organisms → Eukaryota	44.25 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	2.65 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	53.10 %
Viridiplantae	kingdom	All Organisms → cellular organisms → Eukaryota → Viridiplantae	44.25 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	2.65 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	53.10 %
Streptophyta	phylum	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta	44.25 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	2.65 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	53.10 %
Streptophytina	subphylum	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina	43.36 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	2.65 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	53.10 %
Embryophyta	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	42.48 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	2.65 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	53.10 %
Tracheophyta	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta	29.20 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	2.65 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	53.10 %
Euphyllophyta	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta	29.20 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	2.65 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	53.10 %
Spermatophyta	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta	29.20 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	2.65 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	53.10 %
Magnoliopsida	class	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida	29.20 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	2.65 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	53.10 %
Mesangiospermae	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae	28.32 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	2.65 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	53.10 %
eudicotyledons	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons	28.32 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	2.65 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	53.10 %
Gunneridae	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae	28.32 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	2.65 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	53.10 %
Pentapetalae	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae	28.32 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	2.65 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	53.10 %
rosids	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids	28.32 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	2.65 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	53.10 %
fabids	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids	28.32 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	2.65 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	53.10 %
Fabales	order	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales	28.32 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	2.65 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	53.10 %
Fabaceae	family	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae	28.32 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	2.65 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	53.10 %
Papilionoideae	subfamily	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae	27.43 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	2.65 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	53.10 %
50 kb inversion clade	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade	27.43 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	2.65 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	53.10 %
NPAAA clade	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade	27.43 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	2.65 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	53.10 %
indigoferoid/millettioid clade	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade	27.43 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	2.65 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	53.10 %
Phaseoleae	tribe	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae	27.43 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	2.65 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	53.10 %
Vigna	genus	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae → Vigna	23.01 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	2.65 %
Mucuna	genus	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae → Mucuna	0.88 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	53.10 %
Vigna unguiculata	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae → Vigna → Vigna unguiculata	22.12 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	2.65 %
Mucuna pruriens	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae → Mucuna → Mucuna pruriens	0.88 %

Visualization

Powered by ApexCharts

Associated Scaffolds

Scaffold	Taxonomy	Length	IMG/M Link
3300006943\|Ga0099822_1000165	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae	47464	Open in IMG/M
3300006943\|Ga0099822_1000321	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae → Vigna	41131	Open in IMG/M
3300006943\|Ga0099822_1000375	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	39327	Open in IMG/M
3300006943\|Ga0099822_1002270	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	23798	Open in IMG/M
3300006943\|Ga0099822_1003091	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae → Vigna → Vigna unguiculata	21184	Open in IMG/M
3300006943\|Ga0099822_1004041	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	19001	Open in IMG/M
3300006943\|Ga0099822_1005534	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae	16499	Open in IMG/M
3300006943\|Ga0099822_1007856	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae → Vigna → Vigna unguiculata	13716	Open in IMG/M
3300006943\|Ga0099822_1011192	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	10984	Open in IMG/M
3300006943\|Ga0099822_1011506	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae → Vigna → Vigna unguiculata	10768	Open in IMG/M
3300006943\|Ga0099822_1011561	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae → Vigna → Vigna unguiculata	10740	Open in IMG/M
3300006943\|Ga0099822_1014186	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	9207	Open in IMG/M
3300006943\|Ga0099822_1015036	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	8767	Open in IMG/M
3300006943\|Ga0099822_1016227	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	8213	Open in IMG/M
3300006943\|Ga0099822_1017198	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae → Vigna → Vigna unguiculata	7777	Open in IMG/M
3300006943\|Ga0099822_1017475	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae → Mucuna → Mucuna pruriens	7655	Open in IMG/M
3300006943\|Ga0099822_1017896	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	7479	Open in IMG/M
3300006943\|Ga0099822_1019080	Not Available	7040	Open in IMG/M
3300006943\|Ga0099822_1024103	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae → Vigna → Vigna unguiculata	5500	Open in IMG/M
3300006943\|Ga0099822_1025716	Not Available	5075	Open in IMG/M
3300006943\|Ga0099822_1032590	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae → Vigna → Vigna unguiculata	3688	Open in IMG/M
3300006943\|Ga0099822_1032614	All Organisms → Viruses → Predicted Viral	3684	Open in IMG/M
3300006943\|Ga0099822_1032686	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida	3673	Open in IMG/M
3300006943\|Ga0099822_1033364	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	3555	Open in IMG/M
3300006943\|Ga0099822_1034090	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae → Vigna → Vigna unguiculata	3436	Open in IMG/M
3300006943\|Ga0099822_1035310	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae → Vigna → Vigna unguiculata	3248	Open in IMG/M
3300006943\|Ga0099822_1036250	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae → Vigna → Vigna unguiculata	3111	Open in IMG/M
3300006943\|Ga0099822_1039028	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae → Vigna → Vigna unguiculata	2754	Open in IMG/M
3300006943\|Ga0099822_1040636	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	2570	Open in IMG/M
3300006943\|Ga0099822_1041079	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae → Vigna → Vigna unguiculata	2518	Open in IMG/M
3300006943\|Ga0099822_1043883	Not Available	2246	Open in IMG/M
3300006943\|Ga0099822_1045711	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae → Vigna → Vigna unguiculata	2087	Open in IMG/M
3300006943\|Ga0099822_1047826	Not Available	1926	Open in IMG/M
3300006943\|Ga0099822_1050739	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae → Vigna → Vigna unguiculata	1727	Open in IMG/M
3300006943\|Ga0099822_1054412	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae → Vigna → Vigna unguiculata	1521	Open in IMG/M
3300006943\|Ga0099822_1055481	Not Available	1471	Open in IMG/M
3300006943\|Ga0099822_1058325	Not Available	1349	Open in IMG/M
3300006943\|Ga0099822_1059487	Not Available	1301	Open in IMG/M
3300006943\|Ga0099822_1060433	Not Available	1267	Open in IMG/M
3300006943\|Ga0099822_1061190	Not Available	1240	Open in IMG/M
3300006943\|Ga0099822_1065539	Not Available	1105	Open in IMG/M
3300006943\|Ga0099822_1066081	Not Available	1090	Open in IMG/M
3300006943\|Ga0099822_1067705	Not Available	1047	Open in IMG/M
3300006943\|Ga0099822_1068259	All Organisms → Viruses → Predicted Viral	1034	Open in IMG/M
3300006943\|Ga0099822_1068591	All Organisms → Viruses → Predicted Viral	1026	Open in IMG/M
3300006943\|Ga0099822_1068994	Not Available	1017	Open in IMG/M
3300006943\|Ga0099822_1072315	Not Available	944	Open in IMG/M
3300006943\|Ga0099822_1077079	Not Available	857	Open in IMG/M
3300006943\|Ga0099822_1079564	Not Available	817	Open in IMG/M
3300006943\|Ga0099822_1081822	Not Available	785	Open in IMG/M
3300006943\|Ga0099822_1083485	Not Available	763	Open in IMG/M
3300006943\|Ga0099822_1086014	Not Available	732	Open in IMG/M
3300006943\|Ga0099822_1086176	Not Available	730	Open in IMG/M
3300006943\|Ga0099822_1086567	Not Available	725	Open in IMG/M
3300006943\|Ga0099822_1088226	Not Available	707	Open in IMG/M
3300006943\|Ga0099822_1089062	Not Available	698	Open in IMG/M
3300006943\|Ga0099822_1089987	Not Available	688	Open in IMG/M
3300006943\|Ga0099822_1090072	Not Available	687	Open in IMG/M
3300006943\|Ga0099822_1090905	Not Available	678	Open in IMG/M
3300006943\|Ga0099822_1091911	Not Available	669	Open in IMG/M
3300006943\|Ga0099822_1094163	Not Available	648	Open in IMG/M
3300006943\|Ga0099822_1095480	Not Available	637	Open in IMG/M
3300006943\|Ga0099822_1109419	Not Available	542	Open in IMG/M
3300006943\|Ga0099822_1113031	Not Available	523	Open in IMG/M
3300006943\|Ga0099822_1114568	Not Available	515	Open in IMG/M
3300006944\|Ga0099823_1049133	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae → Vigna → Vigna unguiculata	2652	Open in IMG/M
3300006944\|Ga0099823_1051268	Not Available	2507	Open in IMG/M
3300006944\|Ga0099823_1065561	Not Available	1752	Open in IMG/M
3300006944\|Ga0099823_1075534	Not Available	1401	Open in IMG/M
3300006944\|Ga0099823_1090599	Not Available	1047	Open in IMG/M
3300006944\|Ga0099823_1097077	Not Available	936	Open in IMG/M
3300006944\|Ga0099823_1113804	Not Available	734	Open in IMG/M
3300006944\|Ga0099823_1130904	Not Available	604	Open in IMG/M
3300006944\|Ga0099823_1131932	Not Available	598	Open in IMG/M
3300006944\|Ga0099823_1136049	Not Available	575	Open in IMG/M
3300006944\|Ga0099823_1137646	Not Available	566	Open in IMG/M
3300006944\|Ga0099823_1137943	Not Available	565	Open in IMG/M
3300006944\|Ga0099823_1144992	Not Available	531	Open in IMG/M
3300021320\|Ga0214544_1000091	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae	117959	Open in IMG/M
3300021320\|Ga0214544_1001758	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae	45425	Open in IMG/M
3300021320\|Ga0214544_1002127	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae → Vigna → Vigna unguiculata	41760	Open in IMG/M
3300021320\|Ga0214544_1012350	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	11169	Open in IMG/M
3300021320\|Ga0214544_1012803	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	10648	Open in IMG/M
3300021320\|Ga0214544_1013597	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae → Vigna → Vigna unguiculata	9749	Open in IMG/M
3300021320\|Ga0214544_1018182	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae → Vigna → Vigna unguiculata	5948	Open in IMG/M
3300021320\|Ga0214544_1036608	Not Available	1253	Open in IMG/M
3300021321\|Ga0214542_1000966	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina	56840	Open in IMG/M
3300021321\|Ga0214542_1001775	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae	44656	Open in IMG/M
3300021321\|Ga0214542_1004087	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae → Vigna → Vigna unguiculata	29179	Open in IMG/M
3300021321\|Ga0214542_1006602	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae → Vigna → Vigna unguiculata	20978	Open in IMG/M
3300021321\|Ga0214542_1025039	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae → Vigna → Vigna unguiculata	3205	Open in IMG/M
3300021324\|Ga0214545_1010905	Not Available	12870	Open in IMG/M
3300021324\|Ga0214545_1020568	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae → Vigna → Vigna unguiculata	5230	Open in IMG/M
3300021324\|Ga0214545_1061633	Not Available	589	Open in IMG/M
3300021327\|Ga0214543_1017104	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae → Vigna → Vigna unguiculata	7247	Open in IMG/M
3300021327\|Ga0214543_1067520	Not Available	517	Open in IMG/M
3300027296\|Ga0209389_1017465	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae → Vigna → Vigna unguiculata	6478	Open in IMG/M
3300027296\|Ga0209389_1026046	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta	5078	Open in IMG/M
3300027296\|Ga0209389_1026430	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	5030	Open in IMG/M
3300027296\|Ga0209389_1058466	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	2448	Open in IMG/M
3300027296\|Ga0209389_1075178	Not Available	1752	Open in IMG/M
3300027296\|Ga0209389_1119376	Not Available	746	Open in IMG/M
3300027296\|Ga0209389_1121383	Not Available	720	Open in IMG/M
3300027296\|Ga0209389_1122275	Not Available	709	Open in IMG/M
3300027296\|Ga0209389_1125435	Not Available	669	Open in IMG/M
3300027357\|Ga0209589_1001281	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	40890	Open in IMG/M
3300027357\|Ga0209589_1034444	Not Available	2262	Open in IMG/M

Structure Viewer


Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100	pTM-score: 0.49
Secondary Structure: α-helix β-sheet Coil Turn	pTM-score: 0.49
Powered by PDBe Molstar

Protein ID	Sample Taxon ID	Habitat	Sequence
Ga0099822_100016517	3300006943	Root Nodules	MLDSDKKIFMAITLNFYIVVNKSYLYNYSEKITV*
Ga0099822_100032136	3300006943	Root Nodules	MLDGDTKILMTITLNFYIIMYKRYLYNYSEKLRYD*
Ga0099822_100037542	3300006943	Root Nodules	MLDGDKKIFMAITLNFDIVVNKNYLYNYSEKITV*
Ga0099822_10022709	3300006943	Root Nodules	MLDSDKKIFITITLNFYIVINKNYLYNYSEKIKV*
Ga0099822_100309136	3300006943	Root Nodules	MLDGDKQIFMTITLNFDIVVNKSYLYNYSEKFIV*
Ga0099822_100404124	3300006943	Root Nodules	MLDGDKKKFNAIILNFYIIVKKIYLYNYSKKITV*
Ga0099822_10055344	3300006943	Root Nodules	VSFELVYMLDGDKKLFMAITLNKSYLYNYSEKITV*
Ga0099822_10078561	3300006943	Root Nodules	MLDGDKIIFMTITLNFYIVVNKSYLYNYSEKITV*
Ga0099822_101119212	3300006943	Root Nodules	MLNGDKKKFMAITFNFYIIVNKSYLYNYSEKVTV*
Ga0099822_10115062	3300006943	Root Nodules	MLDDDKKNIHDNYIKFYIVVNKCHLYNYSEKITV**
Ga0099822_101156121	3300006943	Root Nodules	MLDGDRKIFMTITLNFDIVVNKSYLYNYSEKLQYD*
Ga0099822_10141869	3300006943	Root Nodules	MFDGDKKIMNITLNFYIIVKKIYLYNYSKKLHYDW*
Ga0099822_101503610	3300006943	Root Nodules	MLDGDKKIFMTMTLNLYIVVNKSYLYNYREKITS*
Ga0099822_10162273	3300006943	Root Nodules	MLDGDKKIFIAITLNFYIIVNKSYLYNYSEKIIV*
Ga0099822_101719812	3300006943	Root Nodules	MMLDSDKKIFMTITLKFYIVVNKGYLYNYSEKITV*
Ga0099822_101747512	3300006943	Root Nodules	MLDGDKKKFMAITLNFFIIVNKSYLYNYSKKITLLIMS
Ga0099822_101789610	3300006943	Root Nodules	MLNGDKKIFTKITLNFYILVNKSYLYNYSEKITV*
Ga0099822_10190803	3300006943	Root Nodules	MLGGDKKKIITITFNYYIIVNKFYLYNYSDKITHMIMG*
Ga0099822_10218462	3300006943	Root Nodules	MLDGDKKIMAITLNFYTIVNKIDLDNYSDKITVD*
Ga0099822_10237382	3300006943	Root Nodules	MLDGDKKIFMAITLKFYIVVIKIYLYSYSEKITV*
Ga0099822_10241032	3300006943	Root Nodules	MLDGDKKIFMTITLNFYIVVNKICLYNCSEKITV*
Ga0099822_10257163	3300006943	Root Nodules	MLDDDKRIFMAITLNFYIIVNKSYLFNYSEKITVLIMS
Ga0099822_10325905	3300006943	Root Nodules	MLHILDGDKKIFIGITFHFYMVVNRSYLYNYSEKIIV*
Ga0099822_10326142	3300006943	Root Nodules	MLDGDKKKFMTITINFYIVVNKSYLYNYSKKITV*
Ga0099822_10326862	3300006943	Root Nodules	MLDGDKKIFIIITLNFYIVVNKSYLYNYSEKIIV*
Ga0099822_10333647	3300006943	Root Nodules	MLDGDKKIFMAITLNFDIVVNESYSYNYSEKITI*
Ga0099822_10340902	3300006943	Root Nodules	MLDGDKKIFMTITLNFDIVVNKSYLYNYSEKITVLI
Ga0099822_10353101	3300006943	Root Nodules	MLDGDKKIFMKITLNFDIVVNKSYLYNYSEKITVLI
Ga0099822_10362503	3300006943	Root Nodules	MLDGDKKIFMTITLNLYIVVNKSYLYNYSEKVTV*
Ga0099822_10365014	3300006943	Root Nodules	VLDVDKKRIFMTITLNFYIVVNKNYLYNYSEKITVWLIMS*
Ga0099822_10390285	3300006943	Root Nodules	MLDGDKKIFMTITLNFYIVVNKSCYLYNYSEKIMV*
Ga0099822_10406362	3300006943	Root Nodules	MLDGDKKIFMTITLNFYIVVNKSYLYKYSEKIIV*
Ga0099822_10410797	3300006943	Root Nodules	MLDGDKKIFMTITLNFYIVVNKIYLYNYSKKITV*
Ga0099822_10438833	3300006943	Root Nodules	MLDGDKKIFIAITLNFYIVVNKSYLYNYSEKITVLIIS
Ga0099822_10457116	3300006943	Root Nodules	MLDSDKKKIHAITLNFYIIVNKSYLYNYSEKIIV*
Ga0099822_10478264	3300006943	Root Nodules	MLDGGKMKFMAITLNFYIIVNKFYLYNYSDKIIV*
Ga0099822_10507394	3300006943	Root Nodules	MLDGDKTKLIAITLNFYIIVNKIYLYSYSDKITV*
Ga0099822_10544121	3300006943	Root Nodules	FTSIMLDGDKKIVMTITLKFYIVVNKSYLYNYSEKIIVLIMS*
Ga0099822_10554811	3300006943	Root Nodules	MLDGDKQIFMTITLNFDIVVNKSYLYNYSEKITV*
Ga0099822_10583251	3300006943	Root Nodules	MLDGDKKILMTITLNFYIVVNKSYLYNYSDKITVLIMS
Ga0099822_10594871	3300006943	Root Nodules	MLDGDKKILITITLNFYIEVNKSYLYNCIGKITV*
Ga0099822_10604331	3300006943	Root Nodules	MLDGDKKILMTTTLNFYIVVNKSYLYNYSEKIIV*
Ga0099822_10611901	3300006943	Root Nodules	MLDGDKKILMTITLNLYIVVNKSYLYNYSDKITV*
Ga0099822_10655391	3300006943	Root Nodules	MLDGDKKIFMTITLNFYIVVNKSYLYNYSENITV*
Ga0099822_10660811	3300006943	Root Nodules	MLDGDKKILMTITLNFYIVVNKSYLYNYSEKLTV*
Ga0099822_10677051	3300006943	Root Nodules	KKILMTITLNFYIVVNKSYLYNYSEKITVLIMS
Ga0099822_10682591	3300006943	Root Nodules	MLDGDEKIFMTITLKFYIVVNKSYLYNYSSKITV*
Ga0099822_10685911	3300006943	Root Nodules	MLDGDKKILLTITLNFYIVVNKSYLYNYSDKITV*
Ga0099822_10686191	3300006943	Root Nodules	MLDGDKKLFMTITLNFYIAVNKSYLYNYSEKIII*
Ga0099822_10689941	3300006943	Root Nodules	SCIFTSIMLDGDKKILMTITLNFYIVVNKSYLYNYSEKVTVLIMS*
Ga0099822_10723151	3300006943	Root Nodules	MLDGDKTIFMTITLNFYIVVNKSYLYNYSKKITV*
Ga0099822_10770791	3300006943	Root Nodules	MLDGDKKIFMKITLNFYIVVNKSYLYNYSEKITI*
Ga0099822_10795641	3300006943	Root Nodules	MLDGDKKIFMTITLNFYIVVNKSYLYNYSEKITV*
Ga0099822_10818221	3300006943	Root Nodules	QYMLDGDKKIFMAITLNFYIVVNKSYLYNYSEKITILIMS
Ga0099822_10834852	3300006943	Root Nodules	DLVSFEPIMLDGDKKIFMTITLNFYIVVNKSYLYNYSEKITI*
Ga0099822_10860141	3300006943	Root Nodules	MLDGDKKILMTITLNYYIVVNKSYLYNYSEKITV*
Ga0099822_10861761	3300006943	Root Nodules	MLDGNKKILMTITLNFYIIVNKSYLYNYSDKIAV*
Ga0099822_10865672	3300006943	Root Nodules	MLDGDKKILMTITLNFYIVVNKSYLYNYSEKITV*
Ga0099822_10882262	3300006943	Root Nodules	MLDGDKKIFMTIILDFYIVVNKSYLYNYSEKITV*
Ga0099822_10890621	3300006943	Root Nodules	MLDGDKKILMTIILNFYIVVNKSYLYNYSEKVTV*
Ga0099822_10899871	3300006943	Root Nodules	MLDGDKKILMTITLNFYIIVNKSYLYNYSEKITV*
Ga0099822_10900721	3300006943	Root Nodules	MLDGDKKILMTITLNLYIVVSKSYLYNYSDKITV*
Ga0099822_10909051	3300006943	Root Nodules	SYIFTSIMLDGDKKIFMTITLDFYIVVNKSYLYNYSEKITI
Ga0099822_10919111	3300006943	Root Nodules	MLDDDKKILITITLNFYIVVNKSYLYNYSEKIIV*
Ga0099822_10941631	3300006943	Root Nodules	FTSIMLDGDKKIFMTITLDFYIVVNKSYLYNYSEKITV
Ga0099822_10954801	3300006943	Root Nodules	MLDGDKKILMTITLNFYIVVNKSFLYNYSEKIIV*
Ga0099822_11094191	3300006943	Root Nodules	MLDSDKKILMTITLNFYIVVNKSYLYNYSEKMTV*
Ga0099822_11130311	3300006943	Root Nodules	MLDDDKKIFMTITLNFYIVVNKSYLYNYSEKITV*
Ga0099822_11145681	3300006943	Root Nodules	MLDGDKKLLMTIILNFYIVVNKSYLYNYSEKITV*
Ga0099823_10491335	3300006944	Root Nodules	SIMLDGDKKIFMTITLNFYIVVNKNYLYNYSEKITVLIMS
Ga0099823_10512684	3300006944	Root Nodules	MLDGDKNNSWKITLNFYIIVNKIYLYNYSEKIIV*
Ga0099823_10655613	3300006944	Root Nodules	YMLDGDKKIFLTITLNFYIVVNKSYLFNYNKKVTVLIMS
Ga0099823_10755342	3300006944	Root Nodules	MLDGDKKILMTITLNFYIVVNKSYLYNYSEKVTV*
Ga0099823_10905992	3300006944	Root Nodules	MLDGDKKIFMTITLNFDIVVNKSYLYNYSEKITV*
Ga0099823_10970772	3300006944	Root Nodules	MLDGDKKIFMAIILNFDIVLNKSYLYNYSEKITLLI
Ga0099823_11138041	3300006944	Root Nodules	NFNIDLVSFEPIMLDDDTKIFMTIILNFYIVLSKSCLYNYSEKLQYD*
Ga0099823_11309042	3300006944	Root Nodules	SYIFTSIMLDGDKKIFMTITLDFYIVVNKSYLYNYSEKITV
Ga0099823_11319321	3300006944	Root Nodules	NIDLVSFEPIMLDGDKKILMTITLNFYIVVNKSYLYNYSEKITV*
Ga0099823_11349801	3300006944	Root Nodules	MLDGDKKILMTITLNFYIVVNKNDLYNYSEKIKV*
Ga0099823_11360491	3300006944	Root Nodules	IFTSIMLDGDKKILLTITLNFYIVVNKSYLYNYSDKITV*
Ga0099823_11376462	3300006944	Root Nodules	MLDGDKKIFMTITLDFYIVVNKSYLYNYSEKITI*
Ga0099823_11379431	3300006944	Root Nodules	KKILMTITLNFYIVVNKSYLYNYSEKVTVLIMN
Ga0099823_11449921	3300006944	Root Nodules	MLDGDKKIFMIITLNFYIVVNKSYLYNYSEKITV*
Ga0214544_100009166	3300021320	Root Nodules	MLDGDTKILMTITLNFYIIMYKRYLYNYSEKLRYD
Ga0214544_100175816	3300021320	Root Nodules	MLDGDKKIFMSITLNLYIVVNKSYLYNYSEKIIYD
Ga0214544_100212711	3300021320	Root Nodules	MLDGDRKIFMTITLNFDIVVNKSYLYNYSEKLQYD
Ga0214544_10052666	3300021320	Root Nodules	MLDVDKKKLMAVTLKFYIIVNQIYLYNYSDKITVX
Ga0214544_10123507	3300021320	Root Nodules	MFDGDKKIMNITLNFYIIVKKIYLYNYSKKLHYDW
Ga0214544_10128031	3300021320	Root Nodules	MLDGDKQIFMTITLNFDIVVNKSYLYNYSEKITVXLI
Ga0214544_10135978	3300021320	Root Nodules	MMLDSDKKIFMTITLKFYIVVNKGYLYNYSEKITV
Ga0214544_10181825	3300021320	Root Nodules	MLDGDKKILMTITLNFYIVVNKSYLYNYSEKITVXLIMS
Ga0214544_10366081	3300021320	Root Nodules	MLDGDKKILMTITLNFYIVVNKSYLYNYSDKITVXLIMS
Ga0214542_10009661	3300021321	Root Nodules	SIMLDGDKKILMTITLNFYIVVNKSYLYNYSDKITV
Ga0214542_100177527	3300021321	Root Nodules	MLDGDKKIFMSITLNLYIVVNKSYLYNYSEKIIYDX
Ga0214542_10040872	3300021321	Root Nodules	MLDGDKKIFMTITLNFDIVVNKSYLYNYSEKITVXLI
Ga0214542_10066021	3300021321	Root Nodules	MLDGNKKILMTITLNFYIIVNKSYLYNYSDKIAVXLIIS
Ga0214542_10250391	3300021321	Root Nodules	MLDGDKKIFMKITLNFDIVVNKSYLYNYSEKITVXLI
Ga0214545_10109051	3300021324	Root Nodules	MLDDDKRIFMAITLNFYIIVNKSYLFNYSEKITVXLIMS
Ga0214545_10205682	3300021324	Root Nodules	MLHILDGDKKIFIGITFHFYMVVNRSYLYNYSEKIIVXLIMS
Ga0214545_10616331	3300021324	Root Nodules	XTSIMLDGDKKILMTITLNFYIVVNKSYLYNYSEKITVXLIIS
Ga0214543_10171044	3300021327	Root Nodules	TSIMLDGDKKIVMTITLKFYIVVNKSYLYNYSEKIIVXLIMS
Ga0214543_10675201	3300021327	Root Nodules	RSYIFXTSIMLDGDKKIFMTITLDFYIVVNKSYLYNYSEKITV
Ga0209389_10174654	3300027296	Root Nodules	MLDVDKKIFMVIILNFSIIANKSYLYNYSEKITVXLIMS
Ga0209389_10260466	3300027296	Root Nodules	MLDGDNKNFMAITLNFYIVVNKSYLYNYSKKITIXLTMS
Ga0209389_10264303	3300027296	Root Nodules	MLDGDKNIFIAITSNFYIVVNKSCLYNYSEKIIVXLIMS
Ga0209389_10584662	3300027296	Root Nodules	MLDGDKKIFIAITLNFYIIVNKSYLYNYSEKIIVXLIMS
Ga0209389_10751782	3300027296	Root Nodules	YMLDGDKKIFLTITLNFYIVVNKSYLFNYNKKVTVXLIMS
Ga0209389_11193761	3300027296	Root Nodules	TSIMLDGDKKIFMTITLNFYIVVNKFYLYNYSKKITL
Ga0209389_11213831	3300027296	Root Nodules	GDKKIVMTITLKFYIVVNKSYLYNYSEKIIVXLIMS
Ga0209389_11222751	3300027296	Root Nodules	TSIMLDGDKKILMTITLNFYIVVNKSYLYNYSEKITVXLIMS
Ga0209389_11254351	3300027296	Root Nodules	TSIMLNGDKKILMTITLNFYIVVNKSYLYNYSEKNKK
Ga0209589_10012811	3300027357	Root Nodules	MLDGDKKIFMAIILNFDIVLNKSYLYNYSEKITLXLI
Ga0209589_10344441	3300027357	Root Nodules	IFXTSIMLDGDKKIFMTITLDFYIVVNKSYLYNYSEKITV

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

Metagenome Family F082225

Overview

Multiple Sequence Alignments

Structure & Topology

Predicted Secondary Structure and Topology

Predicted 3D Structure

Low Quality Model:

Gene Neighborhood

Neighboring Pfam domains

Neighboring Clusters of Orthologous Genes (COGs)

Phylogeny

NCBI Taxonomy

Associated Scaffolds

Environmental Properties

Associated Habitat Types

Associated Samples

Family Sequences

Taxon OID	Sample Name	Habitat Type	IMG/M Link
3300006943	Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW	Host-Associated	Open in IMG/M
3300006944	Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW	Host-Associated	Open in IMG/M
3300021320	Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3	Host-Associated	Open in IMG/M
3300021321	Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1	Host-Associated	Open in IMG/M
3300021324	Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS4	Host-Associated	Open in IMG/M
3300021327	Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2	Host-Associated	Open in IMG/M
3300027296	Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes)	Host-Associated	Open in IMG/M
3300027357	Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes)	Host-Associated	Open in IMG/M

Hidden Markov Model


Click on a Sequence Logo column to get its information.
Powered by Skylign