NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F082234

Metagenome / Metatranscriptome Family F082234

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F082234
Family Type Metagenome / Metatranscriptome
Number of Sequences 113
Average Sequence Length 73 residues
Representative Sequence MFINKDKDHFKYGINQWTGEPNKPVFYTEEMKKAVHQVKKPSMLLMDIVMYPDFLALRLYEDNFLQFEGT
Number of Associated Samples 97
Number of Associated Scaffolds 113

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 92.04 %
% of genes near scaffold ends (potentially truncated) 99.12 %
% of genes from short scaffolds (< 2000 bps) 89.38 %
Associated GOLD sequencing projects 94
AlphaFold2 3D model prediction Yes
3D model pTM-score0.32

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (86.726 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Aquatic → Freshwater → River → Unclassified → Freshwater
(15.929 % of family members)
Environment Ontology (ENVO) Unclassified
(50.442 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Water (non-saline)
(66.372 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 26.53%    β-sheet: 2.04%    Coil/Unstructured: 71.43%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  		pTM-score: 0.32
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 113 Family Scaffolds
PF02467Whib 93.81
PF05257CHAP 4.42
PF02945Endonuclease_7 0.88


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms96.46 %
UnclassifiedrootN/A3.54 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300000756|JGI12421J11937_10137037All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Methylophilaceae → unclassified Methylophilaceae → Methylophilaceae bacterium619Open in IMG/M
3300002383|B570J29604_1005700All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Methylophilaceae → unclassified Methylophilaceae → Methylophilaceae bacterium778Open in IMG/M
3300002408|B570J29032_109569882All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Methylophilaceae → unclassified Methylophilaceae → Methylophilaceae bacterium884Open in IMG/M
3300002835|B570J40625_101460421All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Methylophilaceae → unclassified Methylophilaceae → Methylophilaceae bacterium562Open in IMG/M
3300004054|Ga0063232_10122424All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Methylophilaceae → unclassified Methylophilaceae → Methylophilaceae bacterium745Open in IMG/M
3300004112|Ga0065166_10172530All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Methylophilaceae → unclassified Methylophilaceae → Methylophilaceae bacterium838Open in IMG/M
3300004112|Ga0065166_10231776All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Methylophilaceae → unclassified Methylophilaceae → Methylophilaceae bacterium737Open in IMG/M
3300004112|Ga0065166_10355562All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Methylophilaceae → unclassified Methylophilaceae → Methylophilaceae bacterium606Open in IMG/M
3300004112|Ga0065166_10433148All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Methylophilaceae → unclassified Methylophilaceae → Methylophilaceae bacterium552Open in IMG/M
3300004112|Ga0065166_10457471All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Methylophilaceae → unclassified Methylophilaceae → Methylophilaceae bacterium538Open in IMG/M
3300005069|Ga0071350_1073226All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Methylophilaceae → unclassified Methylophilaceae → Methylophilaceae bacterium1017Open in IMG/M
3300005517|Ga0070374_10686746All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Methylophilaceae → unclassified Methylophilaceae → Methylophilaceae bacterium506Open in IMG/M
3300005528|Ga0068872_10598622All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Methylophilaceae → unclassified Methylophilaceae → Methylophilaceae bacterium584Open in IMG/M
3300005662|Ga0078894_10124635All Organisms → cellular organisms → Bacteria2296Open in IMG/M
3300005662|Ga0078894_11317589All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Methylophilaceae → unclassified Methylophilaceae → Methylophilaceae bacterium607Open in IMG/M
3300006917|Ga0075472_10345613All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Methylophilaceae → unclassified Methylophilaceae → Methylophilaceae bacterium734Open in IMG/M
3300007169|Ga0102976_1042427All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Methylophilaceae → unclassified Methylophilaceae → Methylophilaceae bacterium1110Open in IMG/M
3300007992|Ga0105748_10328399All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Methylophilaceae → unclassified Methylophilaceae → Methylophilaceae bacterium652Open in IMG/M
3300008055|Ga0108970_11483590All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Methylophilaceae → unclassified Methylophilaceae → Methylophilaceae bacterium907Open in IMG/M
3300008108|Ga0114341_10294436All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Methylophilaceae → unclassified Methylophilaceae → Methylophilaceae bacterium847Open in IMG/M
3300008110|Ga0114343_1080240All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Methylophilaceae → unclassified Methylophilaceae → Methylophilaceae bacterium1174Open in IMG/M
3300008111|Ga0114344_1101523All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Methylophilaceae → unclassified Methylophilaceae → Methylophilaceae bacterium1432Open in IMG/M
3300008113|Ga0114346_1180803All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Methylophilaceae → unclassified Methylophilaceae → Methylophilaceae bacterium865Open in IMG/M
3300008114|Ga0114347_1105617All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Methylophilaceae → unclassified Methylophilaceae → Methylophilaceae bacterium1081Open in IMG/M
3300008116|Ga0114350_1023340Not Available3834Open in IMG/M
3300008259|Ga0114841_1100655All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Methylophilaceae → unclassified Methylophilaceae → Methylophilaceae bacterium1875Open in IMG/M
3300008261|Ga0114336_1152861All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Methylophilaceae → unclassified Methylophilaceae → Methylophilaceae bacterium1020Open in IMG/M
3300008263|Ga0114349_1113714All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Methylophilaceae → unclassified Methylophilaceae → Methylophilaceae bacterium1153Open in IMG/M
3300008266|Ga0114363_1165203All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Methylophilaceae → unclassified Methylophilaceae → Methylophilaceae bacterium719Open in IMG/M
3300008996|Ga0102831_1296578All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Methylophilaceae → unclassified Methylophilaceae → Methylophilaceae bacterium534Open in IMG/M
3300009183|Ga0114974_10715174All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Methylophilaceae → unclassified Methylophilaceae → Methylophilaceae bacterium543Open in IMG/M
3300009419|Ga0114982_1037428All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Methylophilaceae → unclassified Methylophilaceae → Methylophilaceae bacterium1559Open in IMG/M
3300011011|Ga0139556_1033763All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Methylophilaceae → unclassified Methylophilaceae → Methylophilaceae bacterium751Open in IMG/M
3300012000|Ga0119951_1051762All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Methylophilaceae → unclassified Methylophilaceae → Methylophilaceae bacterium1169Open in IMG/M
3300012000|Ga0119951_1059453All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Methylophilaceae → unclassified Methylophilaceae → Methylophilaceae bacterium1047Open in IMG/M
3300013004|Ga0164293_10120832Not Available1983Open in IMG/M
3300013004|Ga0164293_10505888All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Methylophilaceae → unclassified Methylophilaceae → Methylophilaceae bacterium797Open in IMG/M
3300013005|Ga0164292_10078744All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage2523Open in IMG/M
3300013372|Ga0177922_10072632All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes2005Open in IMG/M
3300013372|Ga0177922_10167799All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Methylophilaceae → unclassified Methylophilaceae → Methylophilaceae bacterium693Open in IMG/M
3300013372|Ga0177922_11096081All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Methylophilaceae → unclassified Methylophilaceae → Methylophilaceae bacterium583Open in IMG/M
3300014819|Ga0119954_1084209All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Methylophilaceae → unclassified Methylophilaceae → Methylophilaceae bacterium511Open in IMG/M
3300017761|Ga0181356_1199223All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Methylophilaceae → unclassified Methylophilaceae → Methylophilaceae bacterium594Open in IMG/M
3300017766|Ga0181343_1074578All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Methylophilaceae → unclassified Methylophilaceae → Methylophilaceae bacterium977Open in IMG/M
3300017780|Ga0181346_1161068All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Methylophilaceae → unclassified Methylophilaceae → Methylophilaceae bacterium833Open in IMG/M
3300017785|Ga0181355_1043156All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Methylophilaceae → unclassified Methylophilaceae → Methylophilaceae bacterium1928Open in IMG/M
3300020074|Ga0194113_10049489All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage4093Open in IMG/M
3300020151|Ga0211736_10683567All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Methylophilaceae → unclassified Methylophilaceae → Methylophilaceae bacterium713Open in IMG/M
3300020159|Ga0211734_10848093All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Methylophilaceae → unclassified Methylophilaceae → Methylophilaceae bacterium689Open in IMG/M
3300020159|Ga0211734_11087298All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Methylophilaceae → unclassified Methylophilaceae → Methylophilaceae bacterium532Open in IMG/M
3300020161|Ga0211726_10020337All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Methylophilaceae → unclassified Methylophilaceae → Methylophilaceae bacterium660Open in IMG/M
3300020221|Ga0194127_10997986All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Methylophilaceae → unclassified Methylophilaceae → Methylophilaceae bacterium502Open in IMG/M
3300020486|Ga0208698_105298All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Methylophilaceae → unclassified Methylophilaceae → Methylophilaceae bacterium1101Open in IMG/M
3300020572|Ga0207909_1053686All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Methylophilaceae → unclassified Methylophilaceae → Methylophilaceae bacterium622Open in IMG/M
3300021962|Ga0222713_10035157All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage3982Open in IMG/M
3300021962|Ga0222713_10352920All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Methylophilaceae → unclassified Methylophilaceae → Methylophilaceae bacterium919Open in IMG/M
3300021962|Ga0222713_10447158All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Methylophilaceae → unclassified Methylophilaceae → Methylophilaceae bacterium784Open in IMG/M
3300021963|Ga0222712_10563515All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Methylophilaceae → unclassified Methylophilaceae → Methylophilaceae bacterium663Open in IMG/M
3300023174|Ga0214921_10116347All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Methylophilaceae → unclassified Methylophilaceae → Methylophilaceae bacterium1939Open in IMG/M
3300023174|Ga0214921_10505918All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Methylophilaceae → unclassified Methylophilaceae → Methylophilaceae bacterium572Open in IMG/M
3300023184|Ga0214919_10384784All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Methylophilaceae → unclassified Methylophilaceae → Methylophilaceae bacterium918Open in IMG/M
3300024346|Ga0244775_10263842All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Methylophilaceae → unclassified Methylophilaceae → Methylophilaceae bacterium1433Open in IMG/M
3300024350|Ga0255167_1027416All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Methylophilaceae → unclassified Methylophilaceae → Methylophilaceae bacterium1071Open in IMG/M
3300024496|Ga0255151_1038988All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Methylophilaceae → unclassified Methylophilaceae → Methylophilaceae bacterium797Open in IMG/M
3300024504|Ga0255179_1053995All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Methylophilaceae → unclassified Methylophilaceae → Methylophilaceae bacterium537Open in IMG/M
3300024537|Ga0255225_1049015All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Methylophilaceae → unclassified Methylophilaceae → Methylophilaceae bacterium713Open in IMG/M
3300024539|Ga0255231_1038447All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Methylophilaceae → unclassified Methylophilaceae → Methylophilaceae bacterium763Open in IMG/M
3300024571|Ga0256302_1084319All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Methylophilaceae → unclassified Methylophilaceae → Methylophilaceae bacterium747Open in IMG/M
3300024857|Ga0256339_1081528All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Methylophilaceae → unclassified Methylophilaceae → Methylophilaceae bacterium671Open in IMG/M
3300025585|Ga0208546_1010379Not Available2459Open in IMG/M
3300026415|Ga0256298_1006378All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Methylophilaceae → unclassified Methylophilaceae → Methylophilaceae bacterium1456Open in IMG/M
3300026425|Ga0256300_1068369All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Methylophilaceae → unclassified Methylophilaceae → Methylophilaceae bacterium513Open in IMG/M
3300026455|Ga0255155_1074181All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Methylophilaceae → unclassified Methylophilaceae → Methylophilaceae bacterium558Open in IMG/M
3300026473|Ga0255166_1085498All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Methylophilaceae → unclassified Methylophilaceae → Methylophilaceae bacterium580Open in IMG/M
3300026478|Ga0255156_1015679All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Methylophilaceae → unclassified Methylophilaceae → Methylophilaceae bacterium1498Open in IMG/M
3300027123|Ga0255090_1054922All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Methylophilaceae → unclassified Methylophilaceae → Methylophilaceae bacterium590Open in IMG/M
3300027127|Ga0255071_1010611All Organisms → Viruses → Predicted Viral1520Open in IMG/M
3300027133|Ga0255070_1033875All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Methylophilaceae → unclassified Methylophilaceae → Methylophilaceae bacterium811Open in IMG/M
3300027145|Ga0255114_1076740All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Methylophilaceae → unclassified Methylophilaceae → Methylophilaceae bacterium574Open in IMG/M
3300027193|Ga0208800_1013371All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Methylophilaceae → unclassified Methylophilaceae → Methylophilaceae bacterium1058Open in IMG/M
3300027586|Ga0208966_1141875All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Methylophilaceae → unclassified Methylophilaceae → Methylophilaceae bacterium640Open in IMG/M
3300027644|Ga0209356_1211129All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Methylophilaceae → unclassified Methylophilaceae → Methylophilaceae bacterium521Open in IMG/M
3300027710|Ga0209599_10146465All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Methylophilaceae → unclassified Methylophilaceae → Methylophilaceae bacterium628Open in IMG/M
3300027720|Ga0209617_10044004All Organisms → Viruses → Predicted Viral1895Open in IMG/M
3300027808|Ga0209354_10221055All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Methylophilaceae → unclassified Methylophilaceae → Methylophilaceae bacterium765Open in IMG/M
3300027816|Ga0209990_10313589All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Methylophilaceae → unclassified Methylophilaceae → Methylophilaceae bacterium700Open in IMG/M
3300027974|Ga0209299_1113758All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Methylophilaceae → unclassified Methylophilaceae → Methylophilaceae bacterium1049Open in IMG/M
3300028073|Ga0255180_1099592All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Methylophilaceae → unclassified Methylophilaceae → Methylophilaceae bacterium512Open in IMG/M
3300028112|Ga0256335_1109558All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Methylophilaceae → unclassified Methylophilaceae → Methylophilaceae bacterium726Open in IMG/M
3300029933|Ga0119945_1007882All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Methylophilaceae → unclassified Methylophilaceae → Methylophilaceae bacterium1428Open in IMG/M
3300031758|Ga0315907_11106590All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Methylophilaceae → unclassified Methylophilaceae → Methylophilaceae bacterium562Open in IMG/M
3300031784|Ga0315899_10189568All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage2078Open in IMG/M
3300031787|Ga0315900_11067452All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Methylophilaceae → unclassified Methylophilaceae → Methylophilaceae bacterium523Open in IMG/M
3300031951|Ga0315904_11163985All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Methylophilaceae → unclassified Methylophilaceae → Methylophilaceae bacterium595Open in IMG/M
3300031963|Ga0315901_10266796All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Methylophilaceae → unclassified Methylophilaceae → Methylophilaceae bacterium1438Open in IMG/M
3300032050|Ga0315906_10059708All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage3930Open in IMG/M
3300032050|Ga0315906_10096669Not Available2945Open in IMG/M
3300032050|Ga0315906_11235947All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Methylophilaceae → unclassified Methylophilaceae → Methylophilaceae bacterium538Open in IMG/M
3300032093|Ga0315902_11088912All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Methylophilaceae → unclassified Methylophilaceae → Methylophilaceae bacterium588Open in IMG/M
3300032116|Ga0315903_11229931All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Methylophilaceae → unclassified Methylophilaceae → Methylophilaceae bacterium502Open in IMG/M
3300033521|Ga0316616_102589631All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Methylophilaceae → unclassified Methylophilaceae → Methylophilaceae bacterium681Open in IMG/M
3300033978|Ga0334977_0527986All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Methylophilaceae → unclassified Methylophilaceae → Methylophilaceae bacterium535Open in IMG/M
3300033980|Ga0334981_0274529All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Methylophilaceae → unclassified Methylophilaceae → Methylophilaceae bacterium755Open in IMG/M
3300034063|Ga0335000_0772898All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Methylophilaceae → unclassified Methylophilaceae → Methylophilaceae bacterium519Open in IMG/M
3300034071|Ga0335028_0041853All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage3133Open in IMG/M
3300034092|Ga0335010_0277930All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Methylophilaceae → unclassified Methylophilaceae → Methylophilaceae bacterium973Open in IMG/M
3300034117|Ga0335033_0119736All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Methylophilaceae → unclassified Methylophilaceae → Methylophilaceae bacterium1499Open in IMG/M
3300034118|Ga0335053_0022719All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage4540Open in IMG/M
3300034118|Ga0335053_0370457All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Methylophilaceae → unclassified Methylophilaceae → Methylophilaceae bacterium877Open in IMG/M
3300034122|Ga0335060_0369599All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Methylophilaceae → unclassified Methylophilaceae → Methylophilaceae bacterium766Open in IMG/M
3300034168|Ga0335061_0636871All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Methylophilaceae → unclassified Methylophilaceae → Methylophilaceae bacterium533Open in IMG/M
3300034280|Ga0334997_0640585All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Methylophilaceae → unclassified Methylophilaceae → Methylophilaceae bacterium652Open in IMG/M
3300034356|Ga0335048_0197934All Organisms → Viruses → Predicted Viral1109Open in IMG/M


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
FreshwaterEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater15.93%
FreshwaterEnvironmental → Aquatic → Freshwater → River → Unclassified → Freshwater15.93%
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake15.04%
FreshwaterEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater9.73%
Freshwater, PlanktonEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton8.85%
FreshwaterEnvironmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater8.85%
Estuarine WaterEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water3.54%
FreshwaterEnvironmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater2.65%
FreshwaterEnvironmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater2.65%
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake2.65%
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake1.77%
AqueousEnvironmental → Aquatic → Marine → Coastal → Unclassified → Aqueous1.77%
EstuarineEnvironmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine1.77%
Deep SubsurfaceEnvironmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface1.77%
Freshwater And SedimentEnvironmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater And Sediment0.89%
Freshwater LenticEnvironmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lentic0.89%
Freshwater And SedimentEnvironmental → Aquatic → Freshwater → Lentic → Hypolimnion → Freshwater And Sediment0.89%
AquaticEnvironmental → Aquatic → Freshwater → Drinking Water → Unclassified → Aquatic0.89%
Estuary WaterEnvironmental → Aquatic → Marine → Coastal → Unclassified → Estuary Water0.89%
EstuarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine0.89%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil0.89%
EstuaryHost-Associated → Plants → Leaf → Unclassified → Unclassified → Estuary0.89%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300000756Freshwater microbial communities from dead zone in Lake Erie, Canada - CCB hypolimnion July 2011EnvironmentalOpen in IMG/M
3300002383Freshwater microbial communities from Lake Mendota, WI - 15JUN2012 deep hole epilimnionEnvironmentalOpen in IMG/M
3300002408Freshwater microbial communities from Lake Mendota, WI, sample - 15JUL2010 deep hole epilimnion (Lake Mendota Combined assembly, ASSEMBLY_DATE=20140123)EnvironmentalOpen in IMG/M
3300002835Freshwater microbial communities from Lake Mendota, WI - (Lake Mendota Combined Ray assembly, ASSEMBLY_DATE=20140605)EnvironmentalOpen in IMG/M
3300004054Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.SN (v2)EnvironmentalOpen in IMG/M
3300004112Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.SD (version 2)EnvironmentalOpen in IMG/M
3300005069Metagenomes from Harmful Algal Blooms in Lake Erie, HABS-E2014-0024EnvironmentalOpen in IMG/M
3300005517Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.SN (version 4)EnvironmentalOpen in IMG/M
3300005528Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel1S_2200h metaGEnvironmentalOpen in IMG/M
3300005662Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.SD (version 4)EnvironmentalOpen in IMG/M
3300006917Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_N_<0.8_DNAEnvironmentalOpen in IMG/M
3300007169Combined Assembly of cyanobacterial bloom in Marina Bay water reservoir, Singapore (Diel cycle-Bottom layer) 8 sequencing projectsEnvironmentalOpen in IMG/M
3300007992Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1461AB_0.2umEnvironmentalOpen in IMG/M
3300008055Metatranscriptomes of the Eelgrass leaves and roots. Combined Assembly of Gp0128390, Gp0128391, Gp0128392, and Gp0128393Host-AssociatedOpen in IMG/M
3300008108Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0048-C-NAEnvironmentalOpen in IMG/M
3300008110Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0048-3-NAEnvironmentalOpen in IMG/M
3300008111Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE4, Sample E2014-0050-C-NAEnvironmentalOpen in IMG/M
3300008113Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE4, Sample E2014-0050-3-NAEnvironmentalOpen in IMG/M
3300008114Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0106-C-NAEnvironmentalOpen in IMG/M
3300008116Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0106-3-NAEnvironmentalOpen in IMG/M
3300008259Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, sample HABS-E2014-0132-C-NAEnvironmentalOpen in IMG/M
3300008261Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, sample HABS-E2014-0024-C-NAEnvironmentalOpen in IMG/M
3300008263Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0106-53-LTREnvironmentalOpen in IMG/M
3300008266Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample HABS-E2014-0108-C-NAEnvironmentalOpen in IMG/M
3300008996Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.747EnvironmentalOpen in IMG/M
3300009183Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130206_EF_MetaGEnvironmentalOpen in IMG/M
3300009419Subsurface microbial communities from deep shales in Ohio, USA - Utica-3 well 1 S input2 FTEnvironmentalOpen in IMG/M
3300011011Freshwater microbial communities from Western Basin Lake Erie, Ontario, Canada - Station 970 - Top - Depth 1mEnvironmentalOpen in IMG/M
3300012000Freshwater microbial communities from Lake Lanier in Georgia, USA - LL_1007AEnvironmentalOpen in IMG/M
3300013004Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES118 metaGEnvironmentalOpen in IMG/M
3300013005Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES117 metaGEnvironmentalOpen in IMG/M
3300013372Freshwater microbial communities from Lake Erie, Ontario, Canada. Combined Assembly of 10 SPsEnvironmentalOpen in IMG/M
3300014819Freshwater microbial communities from Lake Lanier in Georgia, USA - LL_1011AEnvironmentalOpen in IMG/M
3300017761Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.S.NEnvironmentalOpen in IMG/M
3300017766Freshwater viral communities from Lake Michigan, USA - Su13.VD.MLB.S.DEnvironmentalOpen in IMG/M
3300017780Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM15.D.NEnvironmentalOpen in IMG/M
3300017785Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.D.NEnvironmentalOpen in IMG/M
3300020074Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015017 Mahale Deep Cast 200mEnvironmentalOpen in IMG/M
3300020151Freshwater lake microbial communities from Lake Erken, Sweden - P4710_202 megahit1EnvironmentalOpen in IMG/M
3300020159Freshwater lake microbial communities from Lake Erken, Sweden - P4710_108 megahit1EnvironmentalOpen in IMG/M
3300020161Freshwater lake microbial communities from Lake Erken, Sweden - P4710_101 megahit1EnvironmentalOpen in IMG/M
3300020221Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015036 Kigoma Deep Cast 100mEnvironmentalOpen in IMG/M
3300020486Freshwater microbial communities from Lake Mendota, WI - 20AUG2008 deep hole epilimnion (SPAdes)EnvironmentalOpen in IMG/M
3300020572Freshwater microbial communities from Lake Mendota, WI - 05MAY2010 deep hole epilimnion (SPAdes)EnvironmentalOpen in IMG/M
3300021962Estuarine water microbial communities from San Francisco Bay, California, United States - C33_649DEnvironmentalOpen in IMG/M
3300021963Estuarine water microbial communities from San Francisco Bay, California, United States - C33_657DEnvironmentalOpen in IMG/M
3300023174Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL-1505EnvironmentalOpen in IMG/M
3300023184Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL-1503EnvironmentalOpen in IMG/M
3300024346Whole water sample coassemblyEnvironmentalOpen in IMG/M
3300024350Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Miss_RepA_8dEnvironmentalOpen in IMG/M
3300024496Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Yuk_RepB_8hEnvironmentalOpen in IMG/M
3300024504Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Colum_RepA_8dEnvironmentalOpen in IMG/M
3300024537Metatranscriptome of freshwater microbial communities from Columbia River, Oregon, United States - Colum_Cont_RepC_8h (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300024539Metatranscriptome of freshwater microbial communities from Columbia River, Oregon, United States - Colum_Atlam_RepB_8h (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300024571Metatranscriptome of freshwater microbial communities from Columbia River, Oregon, United States - Colum_Colum_RepA_8h (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300024857Metatranscriptome of freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Colum_RepA_8h (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300025585Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_D_<0.8_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300026415Metatranscriptome of freshwater microbial communities from Columbia River, Oregon, United States - Colum_Miss_RepA_8h (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300026425Metatranscriptome of freshwater microbial communities from Columbia River, Oregon, United States - Colum_Yuk_RepA_8h (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300026455Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Atl_RepC_8hEnvironmentalOpen in IMG/M
3300026473Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Cont_RepC_8dEnvironmentalOpen in IMG/M
3300026478Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Atlam_RepA_8hEnvironmentalOpen in IMG/M
3300027123Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Yuk_RepA_8dEnvironmentalOpen in IMG/M
3300027127Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Miss_RepC_8hEnvironmentalOpen in IMG/M
3300027133Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Miss_RepB_8hEnvironmentalOpen in IMG/M
3300027145Freshwater microbial communities from St. Lawrence River, New York, United States - Law_Law_RepA_8hEnvironmentalOpen in IMG/M
3300027193Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.541 (SPAdes)EnvironmentalOpen in IMG/M
3300027586Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG HU45MSRF (SPAdes)EnvironmentalOpen in IMG/M
3300027644Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM15.SN (SPAdes)EnvironmentalOpen in IMG/M
3300027710Subsurface microbial communities from deep shales in Ohio, USA - Utica-3 well 1 S input2 FT (SPAdes)EnvironmentalOpen in IMG/M
3300027720Freshwater microbial communities from dead zone in Lake Erie, Canada - CCB epilimnion July 2011 (SPAdes)EnvironmentalOpen in IMG/M
3300027808Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.DD (SPAdes)EnvironmentalOpen in IMG/M
3300027816Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel5S_2200h metaG (SPAdes)EnvironmentalOpen in IMG/M
3300027974Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140806_MF_MetaG (SPAdes)EnvironmentalOpen in IMG/M
3300028073Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Colum_RepB_8dEnvironmentalOpen in IMG/M
3300028112Metatranscriptome of freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Miss_RepB_8h (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300029933Aquatic microbial communities from drinking water treatment plant in Pearl River Delta area, China - influent_20120727_2EnvironmentalOpen in IMG/M
3300031758Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA123EnvironmentalOpen in IMG/M
3300031784Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 4 MA112EnvironmentalOpen in IMG/M
3300031787Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA114EnvironmentalOpen in IMG/M
3300031951Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA120EnvironmentalOpen in IMG/M
3300031963Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA116EnvironmentalOpen in IMG/M
3300032050Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA122EnvironmentalOpen in IMG/M
3300032093Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA117EnvironmentalOpen in IMG/M
3300032116Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA119EnvironmentalOpen in IMG/M
3300033521Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M1_C1_D1_BEnvironmentalOpen in IMG/M
3300033978Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME28Sep2014-rr0002EnvironmentalOpen in IMG/M
3300033980Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME09Aug2015-rr0007EnvironmentalOpen in IMG/M
3300034063Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME02Oct2008D10-rr0053EnvironmentalOpen in IMG/M
3300034071Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME17Oct2008D10-rr0110EnvironmentalOpen in IMG/M
3300034092Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME03Aug2012-rr0069EnvironmentalOpen in IMG/M
3300034117Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME18Jun2014-rr0124EnvironmentalOpen in IMG/M
3300034118Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME05Aug2017-rr0165EnvironmentalOpen in IMG/M
3300034122Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME03Aug2014-rr0181EnvironmentalOpen in IMG/M
3300034168Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME06Apr2016-rr0183EnvironmentalOpen in IMG/M
3300034280Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME10Aug2009-rr0048EnvironmentalOpen in IMG/M
3300034356Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME17Jun2014-rr0152EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
JGI12421J11937_1013703713300000756Freshwater And SedimentLAKDKKQKWYLTVEFINKDKDHFKYGVNEWTGEPNKPVFYTTEMAKKVREIKKPDMGLQMDIVKYPQFLAIRLYEDNFLKYEGVKKE
B570J29604_100570013300002383FreshwaterMFINKDKDHFKYGINQWTGEPNKPVFYTEEMKKAVHQVKKPSMLLMDIVMYPDFLAL
B570J29032_10956988243300002408FreshwaterMYIDKSQDKLKEHFKYGINHWTGEPAKPVFYTEEMKKKVHEIKKPQLLLMDVVMYPDFLALRLYEDNFL
B570J40625_10146042113300002835FreshwaterMFIDKSNDKLKEHFKHGINQWTGEPNKPVFYTEEMKKAVHQVKKPSMLLMDIVMYPDFLALRLYEDNFLQFEGTKKEMVIDYV
Ga0063232_1012242433300004054Freshwater LakeMFIDKGQDRLKEHFKYGVNEWTGEPNKPVFYTPEMKKAVHQIKKPSMLLMDIVMYPQFLALRLYEDNFLQFDGTKKEMVIDYVT
Ga0065166_1017253013300004112Freshwater LakeMFIDKSADKQREHFKYGINHWTGEPNKPVFYTEEMKKKVHQIKKPSLLLMDVVMYPDFLALRLYEDNFLQFEGIKKEM
Ga0065166_1023177613300004112Freshwater LakeMFIDKSEEALRKHFKYGINQWTGEPNKPVFYNEEMKKAVHQVKKPSMLLMDVVMYPDFLALRLYEDNFLQF
Ga0065166_1035556213300004112Freshwater LakeMFIDKSADKQAEHFKYGINHWTGEPNKPVFYTEEMKKKVHEIQKPSMLLMDVVKYPDFLALRLYEDNFLQFDG
Ga0065166_1043314823300004112Freshwater LakeMFIDKSQDRLKEHFKYGVNEWTGEPNKPVFYTPEMKKAVHQIKKPSMLLMDIVMYPQFLALRLYEDNFLQFEGTKKEMVIDY
Ga0065166_1045747113300004112Freshwater LakeMFIDKSNDKLKEHFKYGINQWTGEPNKPVFYTEEMKKAVHQVKRPSMLLMDIVMYPDFLALRLYEDNFLQFEGTKKE
Ga0071350_107322643300005069FreshwaterMFINKKDINEHFKYGVNEWTGEPNKPVFYTEEMKKAVHQVKKPPMLLMDIVMYPQFLALRLYEDNFLQFEGAKKEMV
Ga0070374_1068674623300005517Freshwater LakeMFIDKSNDKLKEHFKYGINEWTGEPNKPVFYTPEMKKAVHQVKKPPMLLMDIVMYPEFLALRLYEDNFLQFEGTKKEMVIDYVTKVK
Ga0068872_1059862223300005528Freshwater LakeMFINKDKDHFKYGINQWTGEPNKPVFYTEEMKKAVHQVKKPSMLLMDIVMYPDFLALRLYEDNFLQFE
Ga0078894_1012463513300005662Freshwater LakeMFIDKSQDRLKEHFKYGVNEWTGEPNKPVFYTPEMKKAVHQIKKPSMLLMDIVMYPQFLALRLYEDNFLQFEGTKKEM
Ga0078894_1131758933300005662Freshwater LakeMFINKKDPKEHFKYGINQWTGEPNKPVFYTEEMKKAVHQVKKPSMLLMDIVMYPEFLALRLYED
Ga0075472_1034561333300006917AqueousVSSSHFYDDKHFKYGINQWTGEPNKPVFYNEEMKKKIRELKKPGMLIMDIAMYPDFLAIRLYEDNFLQFDGIKKE
Ga0102976_104242713300007169Freshwater LakeMFLNKKDPNEHFKYGINQWTGEPNKPVFYTEEMKKKVHAIKKPQMLLMDVVMYPEFLALRLYE
Ga0105748_1032839923300007992Estuary WaterMFIDKGQDRLKEHFKYGVNEWTGEPNKPVFYTPEMKKAVHQIKKPSMLLMDIVMYPQFLALRLYEDNFL*
Ga0108970_1148359043300008055EstuaryMFINKKDINEHFKYGVNEWTGEPNKPVFYTEEMRKAVHQVKKPPMLLMDIVMYPEFLALR
Ga0114341_1029443633300008108Freshwater, PlanktonMYIDKSNDRLKEHFKYGINQWTGEPNKPVFYTEEMKKKVREIKKPHLLLMDVVMYPEFLALRL
Ga0114343_108024013300008110Freshwater, PlanktonMFIDKSSDKQAEHFKYGINQWTGEPNKPVFYTKEMSSKIREIQKPVHDLMLDVVQYPEFLALRLYEDNFIQYEGTKKEMVIHYVDK
Ga0114344_110152313300008111Freshwater, PlanktonMFINKDKDHFKYGINQWTGEPNKPVFYTEEMKKAVHQVKKPSMLLMDIVMYPDFLALRL
Ga0114346_118080333300008113Freshwater, PlanktonMFINKKDINEHFKYGINEWTGEPNKPVFYTEEMKKAVHQVKKPPMLLMDIVMYPEFLALRLYEDNFLQFEGTKKEMVIDYVG
Ga0114347_110561743300008114Freshwater, PlanktonMFIDKGLDKQKEHFKYGINQWTGEPNKPVFYTIEMQKKVHAIQKPPTFMMDIVKYPEFLA
Ga0114350_102334093300008116Freshwater, PlanktonMTFIDRSKNHFKFGVNEWTGDPNKPVFYTDEMRKKVREIPKPTYDLLIDIVMYPEFLAIRLYEDNFLQFSGNKKEMVIDYVSKVKK
Ga0114841_110065513300008259Freshwater, PlanktonMFIDKNKDHFKHGINWWTGEPAKPVFYTDEMKKRVYEIPKPAMLLMDIVKYPDFLALRLYEDNFIQFDGTKKER
Ga0114336_115286113300008261Freshwater, PlanktonMASDHFKFGINHWTGEPAKPVFYTEEMKKAIRQISKPQMLLLDVVRYPDFLALRLY
Ga0114349_111371413300008263Freshwater, PlanktonMFIDKSADKQKQHFKYGINQWTGEPNKPVFYTPEMKKRVHEIQKPPSFLMDVVKYPEFLALRLYEDNFLQFEGS
Ga0114363_116520333300008266Freshwater, PlanktonMFINKKDINEHFKYGINEWTGEPNKPVFYTEEMRKAVHQVKKPSMLLMDIVMYPEFLALRLYEDNFLQFEGTKKEMVIDY
Ga0102831_129657813300008996EstuarineMFIDKSNDKLKEHFKYGINQWTGEPNKPVFYTEEMKKAVHQIKKPSMLLMDIVMYPDFLALRL
Ga0114974_1071517423300009183Freshwater LakeMFIDKGQDRLKEHFKYGVNEWTGEPNKPVFYTPEMKKAVHQIKKPSMLLMDIVMYPQFLALRLYEDNFLQFEGTKK
Ga0114982_103742813300009419Deep SubsurfaceMENNHFKYGVNEWTGEPNKPVFYTQEMAKKIKEIPSPGMLLMDIVKYPDFLAIRLYEDNFIQFDGSAKERVIDYVGKVKKLIE
Ga0139556_103376323300011011FreshwaterMFIDKGQDRLKEHFKYGVNEWTGEPNKPVFYTPEMKKAVHQIKKPSMLLMDIVMYPQFLALR
Ga0119951_105176213300012000FreshwaterMEFINKDKDHFKYGVNEWTGEPNKPVFYTPEMAKRIRDIKKPDIHLQMDIVRYPDFLTIRLYEDNFLQYEGIKKEMVIDYVG
Ga0119951_105945313300012000FreshwaterMFIDKSADKLKEHFKYGINQWTGEPNKPVFYTEEMKKRVHEIQKPSMLLMDIVMYPDFLALRL
Ga0164293_1012083253300013004FreshwaterMSDKNFFKYGINQWTGEPNKPVFYTEEMKKAVHSIKRPSMLLMDIVKYPDFLALRLYEDNFLQFDG
Ga0164293_1050588833300013004FreshwaterMFIDKSQDRLKEHFKYGVNEWTGEPNKPVFYTPEMKKAVHQIKKPSMLLMDIVMYPQFLALRLYEDNFLQFEGTKKEMVIDYVGK
Ga0164292_1007874413300013005FreshwaterMFIDKSQDRLKEHFKYGVNEWTGEPNKPVFYTPEMKKAVHQIKKPSMLLMDIVMYPQFLALRLYEDNFLQFEGTKKEMVIDYVGKV
Ga0177922_1007263263300013372FreshwaterMFIDKSAEKQAEHFKYGINHWNGEPMKPVFYTKEMAQKVREIKKPVPDLLMDIVLYPDFLTIRLY
Ga0177922_1016779933300013372FreshwaterMFIDKGQDRLKEHFKYGVNEWTGEPNKPVFYTPEMKKAVHQIKKPSMLLMDIVMYPQFLALRLYEDNFLQFEGTKKEM
Ga0177922_1109608123300013372FreshwaterMFINKKDINEHFKYGINEWTGEPNKPVFYTEEMRKAVHQVKKPPMLLMDIVMYPEFLALRLYEDNFLQFEGTKKEMVIDYVGKI
Ga0119954_108420923300014819FreshwaterMASDKNHFKYGINQWTGEPAKPVFYTPEMAKRVREIPQPVLLLMDVAMYPDFIGIKLYEDNFMQFDGSS
Ga0181356_119922313300017761Freshwater LakeMEFINKDRDHFKHGVNEWTGEPNKPVFYTQEMAKKIREIKKPVMSLQMDIVQYPEFLAIRLYEDNFLQYECIKKEIVIDYVGK
Ga0181343_107457843300017766Freshwater LakeMFIDKSSDKQKEHFKYGINHWTGEPAKPVFYTEEMKKKVHQIKKPSLLLMDVVMYPDFL
Ga0181346_116106823300017780Freshwater LakeMFIDKGQDRLKEHFKYGVNEWTGEPNKPVFYTPEMKKAVHQIKKPSMLLMDIVMYPQFLALRLYEDNFLQFEGTK
Ga0181355_104315663300017785Freshwater LakeMFIDKGQDRLKEHFKYGVNEWTGEPNKPVFYTPEMKKAVHQIKKPSMLLMDIVMYPQFLALRLYEDNFLQFDGT
Ga0194113_10049489103300020074Freshwater LakeMFINKKDIKEHFKYGINHWTGEPNKPVFYTKEMKKAVHQVKKPSGLLMDIVMYPEFLALRLYEDNFLQFEGTKKEMVIDYVG
Ga0211736_1068356733300020151FreshwaterMFISKKDISEHFKYGINEWTGEPNKPVFYTEEMRKAVHQVKKPPMLLMDIVMYPEFLALRLYEDNFLQFEGTKKEMVIDYVGKIK
Ga0211734_1084809313300020159FreshwaterMFINKKDINEHFKYGINEWTGEPNKPVFYTEEMRKAVHQVKKPPMLLMDIVMYPEFLALRLYEDNFLQFEGTKKEMV
Ga0211734_1108729823300020159FreshwaterMFINKKDINEHFKYGVNEWTGEPNKPVFYTEEMRKAVHQVKKPSMLLMDIVMYPEFLA
Ga0211726_1002033733300020161FreshwaterMADKDFFKYGINQWTGEPNKPVFYTEEMKKAVHGIKKPAMLMMDIVKYPDFLALRL
Ga0194127_1099798613300020221Freshwater LakeVSLNDSQHFYDNNHFKYGINQWTGEPNKPVFYTEEMKKRVREIKKPMLLLMDVAIYPDFLALRLYEDNFLQFDGSKKEEVIDYV
Ga0208698_10529843300020486FreshwaterMFIDKSLDKQKEHFKYGINQWTGEPNKPVFYNKEMAQKVREIKKPVTDLMMDIVQYPDFLAIRLYEDNFVMYDGIKKEMVVDY
Ga0207909_105368613300020572FreshwaterMFIDKDKNHFKHGINQWTGEPNKPVFYTKDMAQKVREINKPVFDLLMDIVMYPDFLAIRLYEDNFLQYEGTKKEMVIDYVNKV
Ga0222713_1003515713300021962Estuarine WaterMFIDKSNDKLKEHFKYGINQWTGEPNKPVFYTEEMKKAVHQVKKPSMLLMDIVMYPDFLALRLYEDNFLQFEGTKKEMVIDY
Ga0222713_1035292043300021962Estuarine WaterMFIDKSIDKQNEHFKYGINQWTGEPNKPVFYTDEMKKKVRELKQPMFLLMDIVMYPDFLAIRLYEDNFVQFDGIEKEKVIDYVA
Ga0222713_1044715813300021962Estuarine WaterMFINKKDINEHFKYGVNEWTGEPNKPVFYTEEMRKAVHQVKKPHMLLMDIVMYPEFLALRLYEDNFLQFEGT
Ga0222712_1056351513300021963Estuarine WaterMYIDKSQDKLREHFKYGINQWTGEPNKPVFYTEEMKKRVHQIKKPSMLLMDVVMYPEFLALRLYEDNFLQFEGTKKEIVID
Ga0214921_1011634783300023174FreshwaterMEFINKDKDHFKYGVNEWTGEPNKPVFYTPEMAKRIREIKKPDMSLQMDIARYPEFLAIRLYEDNFLKYEGIKKEMVID
Ga0214921_1050591813300023174FreshwaterMEFINKDKDHFKYGVNEWTGEPNKPVFYTPEMAKRIRDIKKPDMSLQMDIARYPEFLAIRLYEDNFLQYQGIKKEMIIDYVG
Ga0214919_1038478413300023184FreshwaterMEFINKDKDHFKYGVNEWTGEPNKPVFYTPEMAKRIREIKKPDMSLQMDIARYPEFLAIRLYEDNFLQYEGIKKEMVIDYVGK
Ga0244775_1026384213300024346EstuarineMDSNHFKYGVNEWTGEPNKPVFYTQEMAKAIRQISKPSGNLLMDIVRYPDFLVIRLYEDNFIQFEGIKKEMVID
Ga0255167_102741613300024350FreshwaterMFIDKSSDKIKEHFKYGINQWTGEPNKPVFYNEEMKKKVHQIQKPSMLLMDIVKYPDFLALRLYEDNFIQFEGTKKEM
Ga0255151_103898813300024496FreshwaterMFIDKNKDHFKHGINWWTGEPAKPVFYTDEMKKRVHEIPKPAMLLMDIVKYPDFLALRLYEDNFIQFDGT
Ga0255179_105399513300024504FreshwaterMFIDKNKNHFKHGINWWTGEPNKPVFYTDEMKKRVHEIPKPAMLLMDIVKYPDFLALRLYEDNFIQFDGTKKERVIDYVTKVK
Ga0255225_104901513300024537FreshwaterMFIDKSSDKQREHFKYGINHWTGEPAKPVFYTEEMKKKVHQIKKPSLLLMDVVMYPDFLALRLYEDNFLQF
Ga0255231_103844733300024539FreshwaterMFIDKSQDRLKEHFKYGVNEWTGEPNKPVFYTPEMKKAVHQIKKPSMLLMDIVMYPQFLALRLYEDNFLQFEGTKKEMVIDYV
Ga0256302_108431933300024571FreshwaterMFIDKSSDKQREHFKYGINHWTGEPAKPVFYTEEMKKKVHQIKKPSMLLMDIVMYPDFLALRLYEDNFLQF
Ga0256339_108152813300024857FreshwaterMFIDKNKNHFKHGINWWTGEPAKPVFYTDEMKKRVHEIPKPAMLLMDIVKYPDFLALRLYEDNFIQFDGTKKER
Ga0208546_101037973300025585AqueousMFIDKSQDKLKEHFKYGINQWTGEPNKPVFYTPDMAKRIREIKKPDMNLQMDIARYPEFLAI
Ga0256298_100637813300026415FreshwaterMFIDKSQDRLKEHFKYGVNEWTGEPNKPVFYTPEMKKAVHQIKKPSMLLMDIVMYPQFLALRLYE
Ga0256300_106836923300026425FreshwaterMFIDKSQDRLKEHFKYRVNEWTGEPNKPVFYTPEMKKAVHQIKKPSMLLMDIVMYPQFLALRLYEDNFLQFEG
Ga0255155_107418123300026455FreshwaterMFIDKNKNHFKHGINWWTGEPAKPVFYTDEMKKRVHEIPKPAMLLMDIVKYPDFLALRLYEDNFIQFDGTKKERVID
Ga0255166_108549813300026473FreshwaterMFIDKNKNHFKHGINWWTGEPAKPVFYTDEMKKRVHEIPKPAMLLMDIVKYPDFLALRLYEDNFIQFDGTKKERVIDYVTKVKK
Ga0255156_101567913300026478FreshwaterMFIDKSSDKIKEHFKYGINQWTGEPNKPVFYNEEMKKKVHQIQKPSMLLMDIVKYPDFLALRLYEDNFI
Ga0255090_105492223300027123FreshwaterMFIDKSSDKQKEHFKYGINHWTGEPAKPVFYTEEMKKKVHQIKKPSLLLMDVVMYPDFLALRLYEDNFL
Ga0255071_101061143300027127FreshwaterMFIDKSSDKQKEHFKYGINHWTGEPAKPVFYTEEMKKKVHQIKKPSLLLMDVVMYPDFLALR
Ga0255070_103387533300027133FreshwaterMFIDKSSDKQREHFKYGINHWTGEPAKPVFYTEEMKKKVHQIKKPSMLLMDIVMYPDFLALRLYEDNFLQFEGTKKEMVIDY
Ga0255114_107674013300027145FreshwaterMFIDKSQDRLKEHFKYGVNEWTGEPNKPVFYTPEMKKAVHQIKKPSMLLMDIVMYPQFLALRLYEDNFLQFDGT
Ga0208800_101337143300027193EstuarineMDSNHFKYGVNEWTGEPNKPVFYTQEMAKAIRQISKPSGNLLMDIVRYPDFLVIRLYEDNFIQFEGIKKE
Ga0208966_114187513300027586Freshwater LenticMFIDKSADKQREHFKYGINQWTGEPNKPVFYTEEMRKKVHQMQKPSMLLMDVVMYPDFLALRLYEDNFLQFEGIKKEMVIDYVGKV
Ga0209356_121112913300027644Freshwater LakeMFIDKSAEKQAEHFKYGINHWNGEPMKPVFYTKEMAQKVREIKKPVPDLLMDIVLYPDFLTIRLYEDNFVMYDGIKKEMV
Ga0209599_1014646523300027710Deep SubsurfaceVIFINKDKDHFKHGINMWNGEPAKPVFYNADMKKRLWELDKPILLLMDVVMYPDFLALRLYED
Ga0209617_1004400453300027720Freshwater And SedimentMFIDKGQDRLKEHFKYGVNEWTGEPNKPVFYTPEMKKAVHQINKPSMLLMDIVMYPQFLALRLYE
Ga0209354_1022105533300027808Freshwater LakeMFIDKSAEKQAEHFKYGINHWNGEPMKPVFYTKEMAQKVREIKKPVPDLLMDIVLYPDFLTIRLYEDNFVMYDG
Ga0209990_1031358933300027816Freshwater LakeMFIDKSNDKLKEHFKYGINQWTGEPNKPVFYTEEMKKAVHQVKKPSMLLMDIVMYPDFLALRLYEDNFLQFEGTKKEMVIDYVT
Ga0209299_111375843300027974Freshwater LakeMSDKNFFKYGINQWTGEPNKPVFYTEEMKKAVHGIKRPSMLLMDIVKYPDFLALRLYEDNFLQFDGIKK
Ga0255180_109959213300028073FreshwaterMFIDKNKDHFKHGINWWTGEPNKPVFYTDEMKKRVHEIPKPAMLLMDIVKYPDFLALRLYEDNFIQFDGTKKERVIDY
Ga0256335_110955813300028112FreshwaterMFIDKNKDHFKHGINWWTGEPAKPVFYTDEMKKRVYEIPKPTMLLMDIVKYPDFLALRLYEDNFIQFD
Ga0119945_100788213300029933AquaticMFINKKDINEHFKYGVNEWTGEPNKPVFYTEEMRKAVHQVKKPSMLLMDIVMYPEFLALR
Ga0315907_1110659023300031758FreshwaterMFIDKNKDHFKHGINWWTGEPAKPVFYTDEMKKRVYEIPKPAMLLMDIVKYPDFLALRLYEDNFIQFDGT
Ga0315899_1018956813300031784FreshwaterMFIDKSADKQREHFKYGINQWTGEPNKPVFYTEAMKKAVHQVKKPSMLLMDIVMYPNFLALRL
Ga0315900_1106745213300031787FreshwaterMFINKDKDHFKYGINQWTGEPNKPVFYTEEMKKAVHQVKKPSMLLMDIVMYPDFLALRLYEDNFLQFEGT
Ga0315904_1116398533300031951FreshwaterMFINKKDINEHFKYGINEWTGEPNKPVFYTEEMRKAVHQVKKPSMLLMDIVMYPEFLALRLYEDNFLQFE
Ga0315901_1026679613300031963FreshwaterMFINKKDINEHFKYGVNEWTGEPNKPVFYTEEMRKAVHQVKKPPMLLMDIVMYPQFLALRLYEDNFLQFEGTN
Ga0315906_10059708103300032050FreshwaterMFINKDKDHFKYGINQWTGEPNKPVFYTEEMKKAVHQVKKPSMLLMDIVMYPDFLALRLYEDNFL
Ga0315906_1009666983300032050FreshwaterMFINKKDINEHFKYGINEWTGEPNKPVFYTEEMRKAVHQVKKPSMLLMDIVMYPEFLALRLYEDNFLQFEGTKKEMVIDYVGKIK
Ga0315906_1123594713300032050FreshwaterMFINKDKDHFKYGINQWTGEPNKPVFYTEEMKKAVHQVKKPSMLLMDIVMYPDFLALRLYEDNFLQFEGTKKEMVIDYVT
Ga0315902_1108891223300032093FreshwaterMFINKKDINEHFKYGVNEWTGEPNKPVFYTEEMRKAVHQVKKPHMLLMDIVMYPEFLALRLYEDNFL
Ga0315903_1122993113300032116FreshwaterMFINKDKDHFKYGINQWTGEPNKPVFYTEEMKKAVHQVKKPSMLLMDIVMYPDFLALRLYEDNFLQFEGTKKEMV
Ga0316616_10258963133300033521SoilMFIDKSADKQKEHFKYGINQWTGEPNKPVFYTEEMKKRVHEIQKPSMLLMDIVMYPDFLALRLYEDNFLQFDGIKKEMVI
Ga0334977_0527986_276_5333300033978FreshwaterMFINKKDINEHFKYGINEWTGEPNKPVFYTEEMRKAVHQVKKPPMLLMDIVMYPEFLALRLYEDNFLQFEGTKKEMVIDYVGKIKR
Ga0334981_0274529_3_2363300033980FreshwaterMSDKNFFKYGINQWTGEPNKPVFYTEEMKKAVHSIKRPSMLLMDIVKYPDFLALRLYEDNFLQFDGIKKEIVIDYVSK
Ga0335000_0772898_339_5183300034063FreshwaterMFIDKSNDRLKQHFKYGINEWTGEPKKPVFYTPEMKKAVHQVKKPPMLLMDIVMYPEFLA
Ga0335028_0041853_3_2453300034071FreshwaterMFIDKSNDRLKQHFKYGINEWTGEPKKPVFYTPEMKKAVHQVKKPPMLLMDIVMYPEFLALRLYEDNFLQFEGTKKEMVID
Ga0335010_0277930_775_9723300034092FreshwaterMFINKKDINEHFKYGVNEWTGEPNKPVFYTEEMRKAVHQVKKPPMLLMDIVMYPEFLALRLYEDNF
Ga0335033_0119736_1_1683300034117FreshwaterMANDHFKYGINHWNGEPNKPVFYTEEMKKAIRQIQKPQMLLLDIAKYPDFLALRLY
Ga0335053_0022719_4316_45403300034118FreshwaterMSDKNFFKYGINQWTGEPNKPVFYTEEMKKAVHSIKRPSMLLMDIVKYPDFLALRLYEDNFLQFDGIKKEIVIDY
Ga0335053_0370457_1_2313300034118FreshwaterMFINKKDPKEHFKYGINQWTGEPNKPVFYTEEMKKAVHQVKKPSMLLMDIVMYPDFLALRLYEDNFLQFEGTKKEMV
Ga0335060_0369599_1_2013300034122FreshwaterMFIDKSLDKQKEHFKYGINQWTGEPNKPVFYNKEMAQKVREIKRPVTDLMMDIVQYPDFLAIRLYED
Ga0335061_0636871_322_5313300034168FreshwaterMSDKNFFKYGINQWTGEPNKPVFYTEEMKKAVHSIKRPSMLLMDIVKYPDFLALRLYEDNFLQFDGIKKE
Ga0334997_0640585_450_6503300034280FreshwaterMFINKKDINEHFKYGINEWTGEPNKPVFYTEEMRKAVHQVKKPPMLLMDIVMYPEFLALRLYEDNFL
Ga0335048_0197934_1_1983300034356FreshwaterMFIDKSQDRLKEHFKYGVNEWTGEPNKPVFYTPEMKKAVHQIKKPSMLLMDIVMYPQFLALRLYED

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.