Metagenome Family F082236

Basic Information
Family ID	F082236
Family Type	Metagenome
Number of Sequences	113
Average Sequence Length	41 residues
Representative Sequence	ILTAWDEMDQRIIDAAIRQWRTRLRACIKAKGGHFEHTLSQ
Number of Associated Samples	27
Number of Associated Scaffolds	113

Quality Assessment
Transcriptomic Evidence	No
Most common taxonomic group	Unclassified
% of genes with valid RBS motifs	6.00 %
% of genes near scaffold ends (potentially truncated)	66.37 %
% of genes from short scaffolds (< 2000 bps)	64.60 %
Associated GOLD sequencing projects	24
AlphaFold2 3D model prediction	Yes
3D model pTM-score	0.48

Most Common Taxonomy
Group	Unclassified (55.752 % of family members)
NCBI Taxonomy ID	N/A
Taxonomy	N/A

Most Common Ecosystem
GOLD Ecosystem	Host-Associated → Annelida → Digestive System → Digestive Tube → Extracellular Symbionts → Marine Gutless Worms Symbiont (43.363 % of family members)
Environment Ontology (ENVO)	Unclassified (100.000 % of family members)
Earth Microbiome Project Ontology (EMPO)	Host-associated → Animal → Animal proximal gut (100.000 % of family members)

Full Alignment
Alignment of all the sequences in the family.

Powered by MSAViewer

Seed Alignment
Alignment of a non-redundant set of sequences, used to build the family's HMM profile.

Powered by MSAViewer

AlphaFold2 Input Alignment
Refined alignment used as input for AlphaFold2.

Powered by MSAViewer

Predicted Topology & Secondary Structure
Classification:	Globular	Signal Peptide:	No	Secondary Structure distribution:	α-helix: 56.52% β-sheet: 0.00% Coil/Unstructured: 43.48%
Feature Viewer

Powered by Feature Viewer

Pfam ID	Name	% Frequency in 113 Family Scaffolds
PF03281	Mab-21	0.88
PF12333	Ipi1_N	0.88
PF01833	TIG	0.88
PF00076	RRM_1	0.88
PF01391	Collagen	0.88
PF13336	AcetylCoA_hyd_C	0.88
PF00055	Laminin_N	0.88
PF00620	RhoGAP	0.88

NCBI Taxonomy

Select NCBI taxonomy Level:

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	55.75 %
All Organisms	root	All Organisms	44.25 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	55.75 %
cellular organisms	root	All Organisms → cellular organisms	44.25 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	55.75 %
Eukaryota	superkingdom	All Organisms → cellular organisms → Eukaryota	43.36 %
Bacteria	superkingdom	All Organisms → cellular organisms → Bacteria	0.88 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	55.75 %
Opisthokonta	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta	43.36 %
FCB group	clade	All Organisms → cellular organisms → Bacteria → FCB group	0.88 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	55.75 %
Metazoa	kingdom	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa	30.09 %
Bacteroidetes/Chlorobi group	clade	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group	0.88 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	55.75 %
Eumetazoa	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa	30.09 %
Bacteroidetes	phylum	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes	0.88 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	55.75 %
Bilateria	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria	30.09 %
Cytophagia	class	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia	0.88 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	55.75 %
Protostomia	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia	23.89 %
Deuterostomia	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia	6.19 %
Cytophagales	order	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales	0.88 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	55.75 %
Ecdysozoa	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa	23.01 %
Chordata	phylum	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata	6.19 %
Cytophagaceae	family	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae	0.88 %
Spiralia	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia	0.88 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	55.75 %
Panarthropoda	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda	23.01 %
Craniata	subphylum	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata	6.19 %
Lophotrochozoa	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Lophotrochozoa	0.88 %
Candidatus Nephrothrix	genus	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix	0.88 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	55.75 %
Arthropoda	phylum	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda	23.01 %
Vertebrata	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata	6.19 %
Annelida	phylum	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Lophotrochozoa → Annelida	0.88 %
unclassified Candidatus Nephrothrix	no rank	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix	0.88 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	55.75 %
Mandibulata	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata	23.01 %
Gnathostomata	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata	6.19 %
Candidatus Nephrothrix sp. EaCA	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	0.88 %
Clitellata	class	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Lophotrochozoa → Annelida → Clitellata	0.88 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	55.75 %
Pancrustacea	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea	23.01 %
Teleostomi	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi	6.19 %
Hirudinea	subclass	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Lophotrochozoa → Annelida → Clitellata → Hirudinea	0.88 %
Candidatus Nephrothrix sp. EaCA	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	0.88 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	55.75 %
Hexapoda	subphylum	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda	23.01 %
Euteleostomi	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi	6.19 %
Rhynchobdellida	order	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Lophotrochozoa → Annelida → Clitellata → Hirudinea → Rhynchobdellida	0.88 %
Candidatus Nephrothrix sp. EaCA	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	0.88 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	55.75 %
Insecta	class	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta	23.01 %
Actinopterygii	superclass	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Actinopterygii	6.19 %
Glossiphoniidae	family	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Lophotrochozoa → Annelida → Clitellata → Hirudinea → Rhynchobdellida → Glossiphoniidae	0.88 %
Candidatus Nephrothrix sp. EaCA	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	0.88 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	55.75 %
Dicondylia	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia	23.01 %
Cladistia	class	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Actinopterygii → Cladistia	6.19 %
Helobdella	genus	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Lophotrochozoa → Annelida → Clitellata → Hirudinea → Rhynchobdellida → Glossiphoniidae → Helobdella	0.88 %
Candidatus Nephrothrix sp. EaCA	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	0.88 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	55.75 %
Pterygota	subclass	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota	23.01 %
Polypteriformes	order	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Actinopterygii → Cladistia → Polypteriformes	6.19 %
Helobdella robusta	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Lophotrochozoa → Annelida → Clitellata → Hirudinea → Rhynchobdellida → Glossiphoniidae → Helobdella → Helobdella robusta	0.88 %
Candidatus Nephrothrix sp. EaCA	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	0.88 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	55.75 %
Neoptera	infraclass	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera	23.01 %
Polypteridae	family	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Actinopterygii → Cladistia → Polypteriformes → Polypteridae	6.19 %
Helobdella robusta	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Lophotrochozoa → Annelida → Clitellata → Hirudinea → Rhynchobdellida → Glossiphoniidae → Helobdella → Helobdella robusta	0.88 %
Candidatus Nephrothrix sp. EaCA	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	0.88 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	55.75 %
Polyneoptera	cohort	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Polyneoptera	22.12 %
Polypterus	genus	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Actinopterygii → Cladistia → Polypteriformes → Polypteridae → Polypterus	6.19 %
Paraneoptera	cohort	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Paraneoptera	0.88 %
Helobdella robusta	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Lophotrochozoa → Annelida → Clitellata → Hirudinea → Rhynchobdellida → Glossiphoniidae → Helobdella → Helobdella robusta	0.88 %
Candidatus Nephrothrix sp. EaCA	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	0.88 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	55.75 %
Dictyoptera	superorder	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Polyneoptera → Dictyoptera	22.12 %
Polypterus senegalus	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Actinopterygii → Cladistia → Polypteriformes → Polypteridae → Polypterus → Polypterus senegalus	6.19 %
Hemiptera	order	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Paraneoptera → Hemiptera	0.88 %
Helobdella robusta	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Lophotrochozoa → Annelida → Clitellata → Hirudinea → Rhynchobdellida → Glossiphoniidae → Helobdella → Helobdella robusta	0.88 %
Candidatus Nephrothrix sp. EaCA	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	0.88 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	55.75 %
Blattodea	order	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Polyneoptera → Dictyoptera → Blattodea	22.12 %
Polypterus senegalus	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Actinopterygii → Cladistia → Polypteriformes → Polypteridae → Polypterus → Polypterus senegalus	6.19 %
Sternorrhyncha	suborder	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Paraneoptera → Hemiptera → Sternorrhyncha	0.88 %
Helobdella robusta	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Lophotrochozoa → Annelida → Clitellata → Hirudinea → Rhynchobdellida → Glossiphoniidae → Helobdella → Helobdella robusta	0.88 %
Candidatus Nephrothrix sp. EaCA	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	0.88 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	55.75 %
Blattoidea	superfamily	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Polyneoptera → Dictyoptera → Blattodea → Blattoidea	22.12 %
Polypterus senegalus	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Actinopterygii → Cladistia → Polypteriformes → Polypteridae → Polypterus → Polypterus senegalus	6.19 %
Aphidomorpha	infraorder	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Paraneoptera → Hemiptera → Sternorrhyncha → Aphidomorpha	0.88 %
Helobdella robusta	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Lophotrochozoa → Annelida → Clitellata → Hirudinea → Rhynchobdellida → Glossiphoniidae → Helobdella → Helobdella robusta	0.88 %
Candidatus Nephrothrix sp. EaCA	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	0.88 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	55.75 %
Termitoidae	no rank	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Polyneoptera → Dictyoptera → Blattodea → Blattoidea → Termitoidae	22.12 %
Polypterus senegalus	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Actinopterygii → Cladistia → Polypteriformes → Polypteridae → Polypterus → Polypterus senegalus	6.19 %
Aphidoidea	superfamily	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Paraneoptera → Hemiptera → Sternorrhyncha → Aphidomorpha → Aphidoidea	0.88 %
Helobdella robusta	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Lophotrochozoa → Annelida → Clitellata → Hirudinea → Rhynchobdellida → Glossiphoniidae → Helobdella → Helobdella robusta	0.88 %
Candidatus Nephrothrix sp. EaCA	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	0.88 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	55.75 %
Rhinotermitidae	family	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Polyneoptera → Dictyoptera → Blattodea → Blattoidea → Termitoidae → Rhinotermitidae	22.12 %
Polypterus senegalus	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Actinopterygii → Cladistia → Polypteriformes → Polypteridae → Polypterus → Polypterus senegalus	6.19 %
Aphididae	family	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Paraneoptera → Hemiptera → Sternorrhyncha → Aphidomorpha → Aphidoidea → Aphididae	0.88 %
Helobdella robusta	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Lophotrochozoa → Annelida → Clitellata → Hirudinea → Rhynchobdellida → Glossiphoniidae → Helobdella → Helobdella robusta	0.88 %
Candidatus Nephrothrix sp. EaCA	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	0.88 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	55.75 %
Coptotermitinae	subfamily	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Polyneoptera → Dictyoptera → Blattodea → Blattoidea → Termitoidae → Rhinotermitidae → Coptotermitinae	22.12 %
Polypterus senegalus	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Actinopterygii → Cladistia → Polypteriformes → Polypteridae → Polypterus → Polypterus senegalus	6.19 %
Aphididae	family	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Paraneoptera → Hemiptera → Sternorrhyncha → Aphidomorpha → Aphidoidea → Aphididae	0.88 %
Helobdella robusta	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Lophotrochozoa → Annelida → Clitellata → Hirudinea → Rhynchobdellida → Glossiphoniidae → Helobdella → Helobdella robusta	0.88 %
Candidatus Nephrothrix sp. EaCA	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	0.88 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	55.75 %
Coptotermes	genus	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Polyneoptera → Dictyoptera → Blattodea → Blattoidea → Termitoidae → Rhinotermitidae → Coptotermitinae → Coptotermes	22.12 %
Polypterus senegalus	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Actinopterygii → Cladistia → Polypteriformes → Polypteridae → Polypterus → Polypterus senegalus	6.19 %
Aphididae	family	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Paraneoptera → Hemiptera → Sternorrhyncha → Aphidomorpha → Aphidoidea → Aphididae	0.88 %
Helobdella robusta	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Lophotrochozoa → Annelida → Clitellata → Hirudinea → Rhynchobdellida → Glossiphoniidae → Helobdella → Helobdella robusta	0.88 %
Candidatus Nephrothrix sp. EaCA	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	0.88 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	55.75 %
Coptotermes formosanus	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Polyneoptera → Dictyoptera → Blattodea → Blattoidea → Termitoidae → Rhinotermitidae → Coptotermitinae → Coptotermes → Coptotermes formosanus	22.12 %
Polypterus senegalus	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Actinopterygii → Cladistia → Polypteriformes → Polypteridae → Polypterus → Polypterus senegalus	6.19 %
Aphididae	family	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Paraneoptera → Hemiptera → Sternorrhyncha → Aphidomorpha → Aphidoidea → Aphididae	0.88 %
Helobdella robusta	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Lophotrochozoa → Annelida → Clitellata → Hirudinea → Rhynchobdellida → Glossiphoniidae → Helobdella → Helobdella robusta	0.88 %
Candidatus Nephrothrix sp. EaCA	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	0.88 %

Visualization

Powered by ApexCharts

Associated Scaffolds

Scaffold	Taxonomy	Length	IMG/M Link
3300001741\|JGI24671J20093_10092741	Not Available	712	Open in IMG/M
3300001742\|JGI24673J20094_10123397	Not Available	706	Open in IMG/M
3300003748\|Ga0049102_10041475	Not Available	774	Open in IMG/M
3300003776\|Ga0049101_10038628	Not Available	1384	Open in IMG/M
3300003776\|Ga0049101_10158896	Not Available	746	Open in IMG/M
3300003776\|Ga0049101_10192453	Not Available	670	Open in IMG/M
3300003776\|Ga0049101_10245352	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Polyneoptera → Dictyoptera → Blattodea → Blattoidea → Termitoidae → Rhinotermitidae → Coptotermitinae → Coptotermes → Coptotermes formosanus	578	Open in IMG/M
3300004626\|Ga0066188_1015762	Not Available	1928	Open in IMG/M
3300004626\|Ga0066188_1024921	Not Available	1690	Open in IMG/M
3300004626\|Ga0066188_1082128	Not Available	1110	Open in IMG/M
3300004626\|Ga0066188_1192749	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Polyneoptera → Dictyoptera → Blattodea → Blattoidea → Termitoidae → Rhinotermitidae → Coptotermitinae → Coptotermes → Coptotermes formosanus	725	Open in IMG/M
3300004626\|Ga0066188_1251379	Not Available	612	Open in IMG/M
3300005968\|Ga0056130_1004747	All Organisms → cellular organisms → Eukaryota → Opisthokonta	4247	Open in IMG/M
3300005968\|Ga0056130_1040464	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Polyneoptera → Dictyoptera → Blattodea → Blattoidea → Termitoidae → Rhinotermitidae → Coptotermitinae → Coptotermes → Coptotermes formosanus	2159	Open in IMG/M
3300005968\|Ga0056130_1050782	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Polyneoptera → Dictyoptera → Blattodea → Blattoidea → Termitoidae → Rhinotermitidae → Coptotermitinae → Coptotermes → Coptotermes formosanus	1956	Open in IMG/M
3300005968\|Ga0056130_1061268	Not Available	1797	Open in IMG/M
3300005968\|Ga0056130_1069426	Not Available	1691	Open in IMG/M
3300005968\|Ga0056130_1127231	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Polyneoptera → Dictyoptera → Blattodea → Blattoidea → Termitoidae → Rhinotermitidae → Coptotermitinae → Coptotermes → Coptotermes formosanus	1196	Open in IMG/M
3300005968\|Ga0056130_1297409	All Organisms → cellular organisms → Eukaryota → Opisthokonta	585	Open in IMG/M
3300005978\|Ga0056129_1002602	Not Available	7071	Open in IMG/M
3300005978\|Ga0056129_1003716	Not Available	6420	Open in IMG/M
3300005978\|Ga0056129_1005586	All Organisms → cellular organisms → Eukaryota → Opisthokonta	5726	Open in IMG/M
3300005978\|Ga0056129_1012141	All Organisms → cellular organisms → Eukaryota → Opisthokonta	4523	Open in IMG/M
3300005978\|Ga0056129_1014858	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Polyneoptera → Dictyoptera → Blattodea → Blattoidea → Termitoidae → Rhinotermitidae → Coptotermitinae → Coptotermes → Coptotermes formosanus	4223	Open in IMG/M
3300005978\|Ga0056129_1016223	Not Available	4094	Open in IMG/M
3300005978\|Ga0056129_1028139	Not Available	3288	Open in IMG/M
3300005978\|Ga0056129_1029258	All Organisms → cellular organisms → Eukaryota → Opisthokonta	3236	Open in IMG/M
3300005978\|Ga0056129_1038728	All Organisms → cellular organisms → Eukaryota → Opisthokonta	2853	Open in IMG/M
3300005978\|Ga0056129_1050990	All Organisms → cellular organisms → Eukaryota → Opisthokonta	2490	Open in IMG/M
3300005978\|Ga0056129_1105555	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Polyneoptera → Dictyoptera → Blattodea → Blattoidea → Termitoidae → Rhinotermitidae → Coptotermitinae → Coptotermes → Coptotermes formosanus	1591	Open in IMG/M
3300005978\|Ga0056129_1121699	All Organisms → cellular organisms → Eukaryota → Opisthokonta	1428	Open in IMG/M
3300005978\|Ga0056129_1122520	Not Available	1420	Open in IMG/M
3300005978\|Ga0056129_1158216	All Organisms → cellular organisms → Eukaryota → Opisthokonta	1143	Open in IMG/M
3300005978\|Ga0056129_1182405	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Paraneoptera → Hemiptera → Sternorrhyncha → Aphidomorpha → Aphidoidea → Aphididae	996	Open in IMG/M
3300005978\|Ga0056129_1184401	Not Available	985	Open in IMG/M
3300005978\|Ga0056129_1251353	Not Available	700	Open in IMG/M
3300005978\|Ga0056129_1307726	Not Available	546	Open in IMG/M
3300006912\|Ga0056114_1008190	Not Available	6685	Open in IMG/M
3300006912\|Ga0056114_1010027	All Organisms → cellular organisms → Eukaryota → Opisthokonta	6243	Open in IMG/M
3300006912\|Ga0056114_1012172	All Organisms → cellular organisms → Eukaryota → Opisthokonta	5836	Open in IMG/M
3300006912\|Ga0056114_1017251	Not Available	5112	Open in IMG/M
3300006912\|Ga0056114_1033250	Not Available	3783	Open in IMG/M
3300006912\|Ga0056114_1035566	All Organisms → cellular organisms → Eukaryota → Opisthokonta	3649	Open in IMG/M
3300006912\|Ga0056114_1082028	Not Available	2131	Open in IMG/M
3300006912\|Ga0056114_1094271	Not Available	1898	Open in IMG/M
3300006912\|Ga0056114_1094638	Not Available	1891	Open in IMG/M
3300006912\|Ga0056114_1099805	Not Available	1805	Open in IMG/M
3300006912\|Ga0056114_1115242	Not Available	1577	Open in IMG/M
3300006912\|Ga0056114_1116288	Not Available	1563	Open in IMG/M
3300006912\|Ga0056114_1133799	Not Available	1352	Open in IMG/M
3300006912\|Ga0056114_1156691	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Polyneoptera → Dictyoptera → Blattodea → Blattoidea → Termitoidae → Rhinotermitidae → Coptotermitinae → Coptotermes → Coptotermes formosanus	1130	Open in IMG/M
3300010290\|Ga0126333_1115425	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Actinopterygii → Cladistia → Polypteriformes → Polypteridae → Polypterus → Polypterus senegalus	1342	Open in IMG/M
3300010290\|Ga0126333_1138178	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Polyneoptera → Dictyoptera → Blattodea → Blattoidea → Termitoidae → Rhinotermitidae → Coptotermitinae → Coptotermes → Coptotermes formosanus	1193	Open in IMG/M
3300010290\|Ga0126333_1311328	Not Available	605	Open in IMG/M
3300010292\|Ga0126326_1045776	Not Available	2108	Open in IMG/M
3300010292\|Ga0126326_1192739	Not Available	949	Open in IMG/M
3300010294\|Ga0126332_10069186	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Actinopterygii → Cladistia → Polypteriformes → Polypteridae → Polypterus → Polypterus senegalus	2039	Open in IMG/M
3300010294\|Ga0126332_10220735	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Actinopterygii → Cladistia → Polypteriformes → Polypteridae → Polypterus → Polypterus senegalus	924	Open in IMG/M
3300010294\|Ga0126332_10275856	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Polyneoptera → Dictyoptera → Blattodea → Blattoidea → Termitoidae → Rhinotermitidae → Coptotermitinae → Coptotermes → Coptotermes formosanus	755	Open in IMG/M
3300010295\|Ga0126334_10171024	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Polyneoptera → Dictyoptera → Blattodea → Blattoidea → Termitoidae → Rhinotermitidae → Coptotermitinae → Coptotermes → Coptotermes formosanus	1123	Open in IMG/M
3300010295\|Ga0126334_10209878	Not Available	959	Open in IMG/M
3300010295\|Ga0126334_10217618	Not Available	931	Open in IMG/M
3300010295\|Ga0126334_10227399	Not Available	897	Open in IMG/M
3300010295\|Ga0126334_10280846	Not Available	747	Open in IMG/M
3300010298\|Ga0126325_10130701	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Lophotrochozoa → Annelida → Clitellata → Hirudinea → Rhynchobdellida → Glossiphoniidae → Helobdella → Helobdella robusta	1340	Open in IMG/M
3300010298\|Ga0126325_10192156	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Polyneoptera → Dictyoptera → Blattodea → Blattoidea → Termitoidae → Rhinotermitidae → Coptotermitinae → Coptotermes → Coptotermes formosanus	1041	Open in IMG/M
3300010298\|Ga0126325_10470210	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Polyneoptera → Dictyoptera → Blattodea → Blattoidea → Termitoidae → Rhinotermitidae → Coptotermitinae → Coptotermes → Coptotermes formosanus	512	Open in IMG/M
3300010314\|Ga0126331_1038210	All Organisms → cellular organisms → Eukaryota → Opisthokonta	2481	Open in IMG/M
3300010314\|Ga0126331_1045560	Not Available	2295	Open in IMG/M
3300010314\|Ga0126331_1080626	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Actinopterygii → Cladistia → Polypteriformes → Polypteridae → Polypterus → Polypterus senegalus	1718	Open in IMG/M
3300010315\|Ga0136654_1004551	All Organisms → cellular organisms → Eukaryota → Opisthokonta	5173	Open in IMG/M
3300010315\|Ga0136654_1205654	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Actinopterygii → Cladistia → Polypteriformes → Polypteridae → Polypterus → Polypterus senegalus	921	Open in IMG/M
3300010377\|Ga0126328_10004729	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Polyneoptera → Dictyoptera → Blattodea → Blattoidea → Termitoidae → Rhinotermitidae → Coptotermitinae → Coptotermes → Coptotermes formosanus	5069	Open in IMG/M
3300010377\|Ga0126328_10269039	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Polyneoptera → Dictyoptera → Blattodea → Blattoidea → Termitoidae → Rhinotermitidae → Coptotermitinae → Coptotermes → Coptotermes formosanus	763	Open in IMG/M
3300010378\|Ga0126330_10133023	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Polyneoptera → Dictyoptera → Blattodea → Blattoidea → Termitoidae → Rhinotermitidae → Coptotermitinae → Coptotermes → Coptotermes formosanus	1314	Open in IMG/M
3300010378\|Ga0126330_10167701	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Polyneoptera → Dictyoptera → Blattodea → Blattoidea → Termitoidae → Rhinotermitidae → Coptotermitinae → Coptotermes → Coptotermes formosanus	1122	Open in IMG/M
3300010378\|Ga0126330_10310689	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Actinopterygii → Cladistia → Polypteriformes → Polypteridae → Polypterus → Polypterus senegalus	672	Open in IMG/M
3300010378\|Ga0126330_10338230	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Polyneoptera → Dictyoptera → Blattodea → Blattoidea → Termitoidae → Rhinotermitidae → Coptotermitinae → Coptotermes → Coptotermes formosanus	621	Open in IMG/M
3300010378\|Ga0126330_10341333	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Polyneoptera → Dictyoptera → Blattodea → Blattoidea → Termitoidae → Rhinotermitidae → Coptotermitinae → Coptotermes → Coptotermes formosanus	616	Open in IMG/M
3300011190\|Ga0126327_10082239	All Organisms → cellular organisms → Eukaryota → Opisthokonta	1660	Open in IMG/M
3300011190\|Ga0126327_10211449	Not Available	916	Open in IMG/M
3300011190\|Ga0126327_10247061	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Polyneoptera → Dictyoptera → Blattodea → Blattoidea → Termitoidae → Rhinotermitidae → Coptotermitinae → Coptotermes → Coptotermes formosanus	809	Open in IMG/M
3300011190\|Ga0126327_10355025	Not Available	590	Open in IMG/M
3300012273\|Ga0126329_10213299	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Polyneoptera → Dictyoptera → Blattodea → Blattoidea → Termitoidae → Rhinotermitidae → Coptotermitinae → Coptotermes → Coptotermes formosanus	947	Open in IMG/M
3300012273\|Ga0126329_10229912	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Actinopterygii → Cladistia → Polypteriformes → Polypteridae → Polypterus → Polypterus senegalus	894	Open in IMG/M
3300012273\|Ga0126329_10269158	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Polyneoptera → Dictyoptera → Blattodea → Blattoidea → Termitoidae → Rhinotermitidae → Coptotermitinae → Coptotermes → Coptotermes formosanus	788	Open in IMG/M
3300012273\|Ga0126329_10420235	Not Available	537	Open in IMG/M
3300012887\|Ga0126335_1216325	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Polyneoptera → Dictyoptera → Blattodea → Blattoidea → Termitoidae → Rhinotermitidae → Coptotermitinae → Coptotermes → Coptotermes formosanus	577	Open in IMG/M
3300027347\|Ga0209366_1073813	Not Available	1649	Open in IMG/M
3300027347\|Ga0209366_1119675	Not Available	1169	Open in IMG/M
3300027347\|Ga0209366_1128016	Not Available	1107	Open in IMG/M
3300027347\|Ga0209366_1134243	Not Available	1065	Open in IMG/M
3300027347\|Ga0209366_1136396	Not Available	1050	Open in IMG/M
3300027347\|Ga0209366_1263482	Not Available	505	Open in IMG/M
3300027392\|Ga0209680_1002607	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Polyneoptera → Dictyoptera → Blattodea → Blattoidea → Termitoidae → Rhinotermitidae → Coptotermitinae → Coptotermes → Coptotermes formosanus	6788	Open in IMG/M
3300027392\|Ga0209680_1065400	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Polyneoptera → Dictyoptera → Blattodea → Blattoidea → Termitoidae → Rhinotermitidae → Coptotermitinae → Coptotermes → Coptotermes formosanus	2037	Open in IMG/M
3300027392\|Ga0209680_1072600	Not Available	1916	Open in IMG/M
3300027392\|Ga0209680_1112085	Not Available	1422	Open in IMG/M
3300027398\|Ga0209782_1152757	Not Available	973	Open in IMG/M
3300027398\|Ga0209782_1180675	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	766	Open in IMG/M

Habitat	Taxonomy	Distribution
Host-Associated	Host-Associated	100.00%

Habitat	Taxonomy	Distribution
Annelida	Host-Associated → Annelida	100.00%

Habitat	Taxonomy	Distribution
Digestive System	Host-Associated → Annelida → Digestive System	100.00%

Habitat	Taxonomy	Distribution
Unclassified	Host-Associated → Annelida → Digestive System → Unclassified	56.64%
Digestive Tube	Host-Associated → Annelida → Digestive System → Digestive Tube	43.36%

Habitat	Taxonomy	Distribution
Unclassified	Host-Associated → Annelida → Digestive System → Unclassified → Unclassified	56.64%
Extracellular Symbionts	Host-Associated → Annelida → Digestive System → Digestive Tube → Extracellular Symbionts	43.36%

Family Sequences

Protein ID	Sample Taxon ID	Habitat	Sequence
JGI24671J20093_100927411	3300001741	Marine Gutless Worms Symbiont	LGPMSAWDALDQRVIDVRQWRTRLRACIKAKGGYFEHSLS*
JGI24673J20094_101233971	3300001742	Marine Gutless Worms Symbiont	TLTSCMSALGPMSAWDALDQRVIDVRQWRTRLRACIKAKGGYFEHSLS*
Ga0049102_100414751	3300003748	Marine Gutless Worms Symbiont	IDELRARILTAWDKMDQRIIDKAVRQWRTRLRARIKAKGGHFKHTLCQ*
Ga0049101_100386283	3300003776	Marine Gutless Worms Symbiont	DELRACILKAWDKMDQRIIDKAVRQWRTRLRACIKAKGGQFKHTLHQ*
Ga0049101_101588961	3300003776	Marine Gutless Worms Symbiont	RILTAWDKMDQRIIDKAVRQWRTRLHACIKAKGRHFEHTLRQ*
Ga0049101_101924531	3300003776	Marine Gutless Worms Symbiont	ILTAWDKMDQRIIDKAVRQWHTRLRACIKAKGGHFKHTFRQ*
Ga0049101_102453521	3300003776	Marine Gutless Worms Symbiont	TAWDKMDQRIIDKAVRQWRTRLRACIKAKGGHFEHTLRQ*
Ga0056122_102126792	3300003817	Marine Gutless Worms Symbiont	MNCGSRILTAWDELDQRVVDTAVRLWRTRLRACVKAKGGHFEHKLN*
Ga0066188_10157623	3300004626	Marine Gutless Worms Symbiont	RILTAWDEMDQRIIDAAIRQWRTRLRTCIKSKGGHFEHTLSQ*
Ga0066188_10249211	3300004626	Marine Gutless Worms Symbiont	RARILTAWDEMDQRIINAEIRQWRTRLRTCIKTKGGHFEHASSQ*
Ga0066188_10821281	3300004626	Marine Gutless Worms Symbiont	LTNILSHTDQRIIDAAIRQWRTCLRACIKAKGGHFEHTLSQ*
Ga0066188_11927492	3300004626	Marine Gutless Worms Symbiont	TAWDEMDQRIIDAAIRQWRTRLRTCIKAKGGHFEHTLSQ*
Ga0066188_12513791	3300004626	Marine Gutless Worms Symbiont	ARILTAWDEMDQRIIDAAIRQWRTRLRTCIKVKGGHFEHTLSQ*
Ga0056135_105672572	3300005652	Marine Gutless Worms Symbiont	LRILTAWDELDQRVIDTTVGQWRTRLRACVKAKGAHFEHKLS*
Ga0056133_104875354	3300005653	Marine Gutless Worms Symbiont	DELDQRVIDTAVKQWRTSLHACIKAKGGYFEHSLP*
Ga0056133_105637522	3300005653	Marine Gutless Worms Symbiont	LRILTAWDELDQRVIDTTVGQWRTRLRACVKAKGAHFEHKLSYYH*
Ga0056130_10047478	3300005968	Marine Gutless Worms Symbiont	LRARILTAWDEMDQRIIDAAIRQWRTRLFTCIKVKGGHFRRTMSQ*
Ga0056130_10404641	3300005968	Marine Gutless Worms Symbiont	ILTAWDEMDQRIIDAAIRQWRTRLRTCIKAKGGHFEHTLSQ*
Ga0056130_10507823	3300005968	Marine Gutless Worms Symbiont	AWDEMDQRIIDAAIRQWRTRLRTCIKAKGGHFEHTLSQ*
Ga0056130_10612684	3300005968	Marine Gutless Worms Symbiont	RILTAWDEMDQRIIDAAIRQWHTRLRAFIKAKGGHFEHTLSQ*
Ga0056130_10694262	3300005968	Marine Gutless Worms Symbiont	MDQRIIDAAIRQWRSRLRACIKAKGGHFEHTLSQ*
Ga0056130_11272311	3300005968	Marine Gutless Worms Symbiont	ILTAWDEMDQRIIDAAIRQWRTRLRTCIKAKGGHFEHTLTQ*
Ga0056130_12974091	3300005968	Marine Gutless Worms Symbiont	MHVSWDVTDQRIIDAAIRQWRTRLRTCIKAKGGHFEHTL
Ga0056129_100260212	3300005978	Marine Gutless Worms Symbiont	MDQRIIDAAIGQRHTRLRACIKAKGGHFEHTLSQ*
Ga0056129_10037168	3300005978	Marine Gutless Worms Symbiont	MDQRIIDAAIRQWRTRLLACIKAKGGHFERTLSQ*
Ga0056129_100558611	3300005978	Marine Gutless Worms Symbiont	MDQRIIDAATDRGACTRFRACIKAKDGHFEHALSQ*
Ga0056129_10121414	3300005978	Marine Gutless Worms Symbiont	MDQRIIDAAIRRWRTRTRLRTCIKDKGGHFEHTLSQ*
Ga0056129_10148581	3300005978	Marine Gutless Worms Symbiont	ARILTAWDEMDQRIIDAAIRQWRTRLRTCIKAKGGHFEHTLSQ*
Ga0056129_10162233	3300005978	Marine Gutless Worms Symbiont	MDQRIIDAAIRQWRTRLRACLKAKGGHLEHTLSQ*
Ga0056129_10281391	3300005978	Marine Gutless Worms Symbiont	LLTYLLTNILSHTDQRIIDAAIRQWRTRLRACIKAKGGHFEHTLSQ*
Ga0056129_10292584	3300005978	Marine Gutless Worms Symbiont	MDQHIIDAVIRQWCTRLRACIKAKGGHFEHTLIQ*
Ga0056129_10387282	3300005978	Marine Gutless Worms Symbiont	MDQRIIDATIRQWRTRLRACIKAKGGHFEHTLSQ*
Ga0056129_10509902	3300005978	Marine Gutless Worms Symbiont	MDQHIIDAAIRQWCTRLRACIKAKGGHFEHTLSQ*
Ga0056129_11055554	3300005978	Marine Gutless Worms Symbiont	RILTAWDEMDQRIIDAAIRQWRTRLRTCIKAKGGHFEHTLSQ*
Ga0056129_11216992	3300005978	Marine Gutless Worms Symbiont	MDQRIIDAAIRPSVNQTEAHSLRACIKAKGGHFEHTLSQ*
Ga0056129_11225201	3300005978	Marine Gutless Worms Symbiont	EMDQRIIDAAIRQWRTRLRTCIKAKGGHFEHTLSQ*
Ga0056129_11582161	3300005978	Marine Gutless Worms Symbiont	VTARDEMDQRIIDAAIRQWRTRLRTCIKAKGGHFEHTLSQ*
Ga0056129_11824051	3300005978	Marine Gutless Worms Symbiont	LLTYLLTNILSHTDQRIIDAAIRQWRTRLRACIKAKGGHYEHTLSQ*
Ga0056129_11844011	3300005978	Marine Gutless Worms Symbiont	ELRARILTAWDEMDQRIIDAAIRQWRTRLRTCIKAKGGHCEHTLSQ*
Ga0056129_12513531	3300005978	Marine Gutless Worms Symbiont	RERILTAWDEMDQRIIDAAIRQWRTRLRTCIKAKGGHIEHTLSQ*
Ga0056129_13077261	3300005978	Marine Gutless Worms Symbiont	YLLTNSLSHTDQRIIGAVIRQWRTRLRACIEAKGGHYEHALSQ*
Ga0056114_10081907	3300006912	Marine Gutless Worms Symbiont	AWDEMDQRIIDAAIRQWRTRLRTCIKAKGGHIEHTLSQ*
Ga0056114_10100276	3300006912	Marine Gutless Worms Symbiont	MDQRIIDAAIRQWRTRLRACIKAKGGHFEHTLSQ*
Ga0056114_10121722	3300006912	Marine Gutless Worms Symbiont	MNQRIIDAAIRQWRTRLRTCIKAKGGHFEPTLSQ*
Ga0056114_10172516	3300006912	Marine Gutless Worms Symbiont	MDQRIIDAATDSGSGARLRTCFKAKGGHFEHTLSQ*
Ga0056114_10332505	3300006912	Marine Gutless Worms Symbiont	MNQRIIDAAIRQWCTRLRTCIKAKGGHFEHTLSQ*
Ga0056114_10355665	3300006912	Marine Gutless Worms Symbiont	VTAWDEIDQRIIDAAIRQRRKRLRTCIKAKGGHFEHTLSQ*
Ga0056114_10820283	3300006912	Marine Gutless Worms Symbiont	MDQRIIDVAIRHWRTRLRVCIKAKGGHFEHTLSQ*
Ga0056114_10942713	3300006912	Marine Gutless Worms Symbiont	MDQRIIDAAIRHWHTRLRACIKAKGGHFEHTLSQ*
Ga0056114_10944551	3300006912	Marine Gutless Worms Symbiont	DEMDQRIIDAAIRQWRTRLCTCIKAKGGHFEHTLSQ*
Ga0056114_10946386	3300006912	Marine Gutless Worms Symbiont	LTALDEMDQRIIDAAIRQWRTRLRTCIKAKGGHFEHTLSQ*
Ga0056114_10998051	3300006912	Marine Gutless Worms Symbiont	MDQRIIDAAIRQWRTRLRACIKAKGGHVEHTLSQYNVFWRT*
Ga0056114_11152421	3300006912	Marine Gutless Worms Symbiont	MDQRIIDAAIRQWRTRLRTCIKAKGGHFEHTLSQ*
Ga0056114_11162881	3300006912	Marine Gutless Worms Symbiont	LRARILTAWDEMDQRIIDAAIRQWRTRLRTCIKAKGGHFERTLS*
Ga0056114_11337995	3300006912	Marine Gutless Worms Symbiont	DELRALILTAWDEMDQRIIDAAITCLHACIKAKGGQCDHTLSQ*
Ga0056114_11566911	3300006912	Marine Gutless Worms Symbiont	LTSWDEMDQRIIDAAIRQWCTRLRTCIKAKGGHFEHTLSQYVFWRT*
Ga0056121_10100841	3300008212	Marine Gutless Worms Symbiont	QGRQRTAFAYPKFLTAWDELDQRVIDTAVRQWRTSLRACVKAKGGHFEHKLSQ*
Ga0126333_11154251	3300010290	Marine Gutless Worms	ARILTAWDEMDQRIIDAAIRQWRTRLRACIKAKGRHFEHTLTQ*
Ga0126333_11381781	3300010290	Marine Gutless Worms	RARILTAWDEMDQRIIDAAIRQWRTRLRACIKAKGGHFEHTLSQ*
Ga0126333_12384271	3300010290	Marine Gutless Worms	LNTLTYLRILTAWDEMDQRIIDAAIRQWRRRLRACMIKAKGGHFEHTLTQ*
Ga0126333_13113281	3300010290	Marine Gutless Worms	EMDQRIIDAAIRQWRTRLRACIKAKGGHFEHTLSQ*
Ga0126326_10457762	3300010292	Marine Gutless Worms	MDQRIIDAAMRQWRTGLRACIKAKGGHFEHTLSQ*
Ga0126326_11077722	3300010292	Marine Gutless Worms	YVLRARILTAWDEMDQRIIDAAIRQWRTRLRACIKAKGGHLNTH*
Ga0126326_11927391	3300010292	Marine Gutless Worms	ILTAWDEMDQRIIDAAIRQWRTRLRACTKAKGGHFEHTLSQ*
Ga0126332_100691861	3300010294	Marine Gutless Worms	RAHILTAWDEMDQRIIDAAIRQWRTRLRACIKAKGGHFEYTLSQ*
Ga0126332_101188591	3300010294	Marine Gutless Worms	DQARILTAWDEMDQRIIDAAIRQWRTRLHACIKAKGGHFEQ*
Ga0126332_102207351	3300010294	Marine Gutless Worms	MLLLTYVLTNIWDEMDQRIIDAAIRQWRTRLRACIKAKGGHFEHTLSQ*
Ga0126332_102758561	3300010294	Marine Gutless Worms	TAWDEMDQRIIDAAIRQWRTRLRACIKAKGGHFEHTLSQ*
Ga0126332_103505811	3300010294	Marine Gutless Worms	DQARILTAWDEMDQRIIDAAIRQWRTRLHACIKAKGGHFEHTLSQ*
Ga0126334_101710241	3300010295	Marine Gutless Worms	LRARILTAWDEMDQRIIDAAIRQWRTRLRACIKAKGGHFEQTLSQ*
Ga0126334_102023932	3300010295	Marine Gutless Worms	NTLTYLRILTAWDEMDQRIIDAAIRQWRTRLRACIKAKGGHFEHTLTQ*
Ga0126334_102098781	3300010295	Marine Gutless Worms	YLDVTRDQRIIDAAIRQWRTRLRACIKAKGGHFEHTLSQ*
Ga0126334_102176182	3300010295	Marine Gutless Worms	MDQRIIDAAIRQWRTRLRACIKAEGGHFEHTLSQ*
Ga0126334_102273991	3300010295	Marine Gutless Worms	LTAWDEMDQRVIGAAIRQWRTRLRACIKAKGGHFEHTLSQ*
Ga0126334_102808461	3300010295	Marine Gutless Worms	DEMDQRIIDAAIRQWRTRLRACIKAKGGHFEHTLSQ*
Ga0126325_100142315	3300010298	Marine Gutless Worms	ARILTAWDEMDQRIIDAAIRQWRTRLRACVKAKGGHFEHTSSQ*
Ga0126325_101307011	3300010298	Marine Gutless Worms	WDEMDQRIIDAAIRQWRTRLRACIKAKGGHFEHTLSQ*
Ga0126325_101921561	3300010298	Marine Gutless Worms	ARILTAWDEMDQRIIDAAIRQWRTRLRACIKAKGGHFEHTLRQ*
Ga0126325_104702101	3300010298	Marine Gutless Worms	MLTAWDEMDQRIIDAAIRQWRTRLRACIKAKGGHFEQTLSQ*
Ga0126331_10382104	3300010314	Marine Gutless Worms	MDQRIIDAAIRQWRTRLPACIKAKGGHFEHTLSQ*
Ga0126331_10455601	3300010314	Marine Gutless Worms	MDQRIIDTAIRQWRTRLRACIKAKGGHFEHTLSQ*
Ga0126331_10806261	3300010314	Marine Gutless Worms	YSYLLTYLLISWDEMDQRIIDAAIRQWRTRLRACIKAKGRHFEHKLSQ*
Ga0126331_12214451	3300010314	Marine Gutless Worms	LNTLTYLRILTASDEMDQRIIDAAIRQWRTRLRACIKAKGGHFEHTLTQ*
Ga0136654_10045515	3300010315	Marine Gutless Worms	AAWDEMDQRIIDAAIRQWRTRLRACIKAKGGQFEHTLSYNVFWLT*
Ga0136654_12056541	3300010315	Marine Gutless Worms	SYLLTYLLISWDEMDQRIIDAAIRQWRTRLRACIKAKGRHFEHKLSQ*
Ga0126328_100047292	3300010377	Marine Gutless Worms	MDQCIIDAAIRQWRTRLRACIKAKGGHFEHTLSQ*
Ga0126328_102690391	3300010377	Marine Gutless Worms	WDEMDQRIIDTAIRQWRTRLRACIKAKGGHFEHTLSQ*
Ga0126330_101330231	3300010378	Marine Gutless Worms	ILTAWDEMDQRIIDAAIRQWRTRLRACIKAKGGHFEHTLSQ*
Ga0126330_101677011	3300010378	Marine Gutless Worms	WDEMDQRIIDAAIRQWRTRLRACIKAKGGHFEHALSQ*
Ga0126330_103106892	3300010378	Marine Gutless Worms	LTAWDEMDQHIIDAAIREWRTRLRACIKAKGRHFEHTLSQ*
Ga0126330_103382301	3300010378	Marine Gutless Worms	EFIHVKYSYLLTYLLISWDEMDQRIIDAEIRQWRTRLRACIKAKGGHFEHTLSQ*
Ga0126330_103413331	3300010378	Marine Gutless Worms	AWDEMDQRIIDAAIRQWRTRLRACIKAKGGHFEHTLSQ*
Ga0126327_100822391	3300011190	Marine Gutless Worms	LLLTYVLRARILTAWDEMDQRIIDAAIRQWRTRLRAYIKAKGGHFEHTLSQ*
Ga0126327_102114491	3300011190	Marine Gutless Worms	EMDQRIIDAAIRQWRTRLRACIKAKGGHFEHTSSQ*
Ga0126327_102470612	3300011190	Marine Gutless Worms	ELRARILTAWDEMDQRIIDAAIRQWRTRLRACIKAKGGHFEYNLSQ*
Ga0126327_103550251	3300011190	Marine Gutless Worms	DEMDQRIIDAAIRQWRTRLRACIKAKGGHFEHTSSQ*
Ga0126329_102132992	3300012273	Marine Gutless Worms	LSYVLTNIWDGMDQRIIDAAIRQWRTRLRACIKARGGHFEHALSQ*
Ga0126329_102299123	3300012273	Marine Gutless Worms	LLTYVLTNIWDEMDQRIIDAAIRQWRTRLRACIKAKGGHFEHTLSQ*
Ga0126329_102691582	3300012273	Marine Gutless Worms	YLLISWDEMDQRIIDAAIRQWRTRLRACIKAKGGHFEHTLSQ*
Ga0126329_104202351	3300012273	Marine Gutless Worms	VTRDQRIIDAAIRQWRTRLRACIKAKGGHFEHTLSQ*
Ga0126335_12163251	3300012887	Marine Gutless Worms	RARILTAWDEMDQRIIDAAIRQWRTRLRACIKAKGGHFEHTSSQ*
Ga0209366_10738131	3300027347	Marine Gutless Worms Symbiont	DKMDQRIIDKAVRQWCTRLRACIKAKDGHFKHTLRQ
Ga0209366_11196751	3300027347	Marine Gutless Worms Symbiont	RILTAWDKMDQRIIDKAVRQWRTRLRACIKAKGGHFKHTLRQ
Ga0209366_11280161	3300027347	Marine Gutless Worms Symbiont	DQLSACILTVWDKMDQRIIDIVRQWRTRLRACTKAKGGHFKHTLRQ
Ga0209366_11342432	3300027347	Marine Gutless Worms Symbiont	LRARILTAWDKMDQRIIDKAVRQWCTRLHACIKAKGGHFKHTFCQ
Ga0209366_11363961	3300027347	Marine Gutless Worms Symbiont	ILTAWDKMDQRIIDKAVRQWRTRLRACSKAKGGHFKHTLRQ
Ga0209366_12634821	3300027347	Marine Gutless Worms Symbiont	EELRARILTAWDKMDQRIIDKAVRQWRRRLRACIKAKGGQFEHTLRQ
Ga0209680_10026071	3300027392	Marine Gutless Worms Symbiont	NYELRARILTAWDEMDQRIIDAAIRQWRTRLRTCIKAKGGHFEHTLSQ
Ga0209680_10654002	3300027392	Marine Gutless Worms Symbiont	LTAWDEMDQRIIDAAIRQWRTRLRTCIKAKGGHFEHTLSQ
Ga0209680_10726001	3300027392	Marine Gutless Worms Symbiont	RARILTAWDEMDQRIIDAAIRQGHTRLRACIKAKGGHFKHTLSQ
Ga0209680_11120851	3300027392	Marine Gutless Worms Symbiont	EMDQRIIDAAIRQWRTRLRTCIKAKGGHFEHTLSQ
Ga0209782_11527571	3300027398	Marine Gutless Worms Symbiont	EQHARILTTWDKMDQRIIDKAVRQWRTRLRACIKAKDKHFQHTLRQ
Ga0209782_11806752	3300027398	Marine Gutless Worms Symbiont	FLTAWDKMDQHIIDKAVRQWHTRLHACIKAKVGYFKHTLRQ

Structure Viewer


Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100	pTM-score: 0.48
Secondary Structure: α-helix β-sheet Coil Turn	pTM-score: 0.48
Powered by PDBe Molstar

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

Metagenome Family F082236

Overview

Multiple Sequence Alignments

Structure & Topology

Predicted Secondary Structure and Topology

Predicted 3D Structure

Low Quality Model:

Gene Neighborhood

Neighboring Pfam domains

Phylogeny

NCBI Taxonomy

Associated Scaffolds

Environmental Properties

Associated Habitat Types

Associated Samples

Family Sequences

Taxon OID	Sample Name	Habitat Type	IMG/M Link
3300001741	Olavius algarvensis symbiont microbial communities from Tuscany, Italy - Type G ELBA extract 1	Host-Associated	Open in IMG/M
3300001742	Olavius algarvensis symbiont microbial communities from Tuscany, Italy - Type G ELBA extract 3	Host-Associated	Open in IMG/M
3300003748	Marine gutless worms symbiont microbial communities from Max Planck institute for Marine Microbiology, Germany - Inanidrilus makropetalos BAHAMAS.2	Host-Associated	Open in IMG/M
3300003776	Marine gutless worms symbiont microbial communities from Max Planck institute for Marine Microbiology, Germany - Inanidrilus makropetalos BAHAMAS.1	Host-Associated	Open in IMG/M
3300003817	Marine gutless worms symbiont microbial communities from Max Planck institute for Marine Microbiology, Germany - Olavius sp. 2 HERON ISLAND	Host-Associated	Open in IMG/M
3300004626	Marine gutless worms symbiont microbial communities from Max Planck institute for Marine Microbiology, Germany - Olavius loisae HERON ISLAND.2	Host-Associated	Open in IMG/M
3300005652	Marine gutless worms symbiont microbial communities from Max Planck institute for Marine Microbiology, Germany - Inanidrilus leukodermatus Group 1a BELIZE.1	Host-Associated	Open in IMG/M
3300005653	Marine gutless worms symbiont microbial communities from Max Planck institute for Marine Microbiology, Germany - Inanidrilus leukodermatus Group 2 BELIZE.1	Host-Associated	Open in IMG/M
3300005968	Marine gutless worms symbiont microbial communities from Max Planck institute for Marine Microbiology, Germany - Olavius loisae LIZARD ISLAND.2	Host-Associated	Open in IMG/M
3300005978	Marine gutless worms symbiont microbial communities from Max Planck institute for Marine Microbiology, Germany - Olavius loisae LIZARD ISLAND.1	Host-Associated	Open in IMG/M
3300006912	Marine gutless worms symbiont microbial communities from Max Planck institute for Marine Microbiology, Germany - Olavius loisae HERON ISLAND.1	Host-Associated	Open in IMG/M
3300008212	Marine gutless worms symbiont microbial communities from Max Planck institute for Marine Microbiology, Germany - Olavius sp. 1 HERON ISLAND	Host-Associated	Open in IMG/M
3300010290	Marine gutless worms symbiont microbial communities from Oahu, Hawaii - Inanidrilus sp. 2 OAHU.JWI-54 metaG	Host-Associated	Open in IMG/M
3300010292	Marine gutless worms symbiont microbial communities from Oahu, Hawaii - Inanidrilus sp. 1 OAHU.JWI-67 metaG	Host-Associated	Open in IMG/M
3300010294	Marine gutless worms symbiont microbial communities from Oahu, Hawaii - Inanidrilus sp. 2 OAHU.JWI-42 metaG	Host-Associated	Open in IMG/M
3300010295	Marine gutless worms symbiont microbial communities from Oahu, Hawaii - Inanidrilus sp. 2 OAHU.JWI-49 metaG	Host-Associated	Open in IMG/M
3300010298	Marine gutless worms symbiont microbial communities from Oahu, Hawaii - Inanidrilus sp. 1 OAHU.JWI-14 metaG	Host-Associated	Open in IMG/M
3300010314	Marine gutless worms symbiont microbial communities from Oahu, Hawaii - Inanidrilus sp. 2 OAHU.JWI-98 metaG	Host-Associated	Open in IMG/M
3300010315	Marine gutless worms symbiont microbial communities from Oahu, Hawaii - Inanidrilus sp. 1 OAHU.JWI-70 metaG	Host-Associated	Open in IMG/M
3300010377	Marine gutless worms symbiont microbial communities from Oahu, Hawaii - Inanidrilus sp. 1 OAHU.JWI-13 metaG	Host-Associated	Open in IMG/M
3300010378	Marine gutless worms symbiont microbial communities from Oahu, Hawaii - Inanidrilus sp. 2 OAHU.JWI-91 metaG	Host-Associated	Open in IMG/M
3300011190	Marine gutless worms symbiont microbial communities from Oahu, Hawaii - Inanidrilus sp. 1 OAHU.JWI-30 metaG	Host-Associated	Open in IMG/M
3300012273	Marine gutless worms symbiont microbial communities from Oahu, Hawaii - Inanidrilus sp. 2 OAHU.JWI-85 metaG	Host-Associated	Open in IMG/M
3300012887	Marine gutless worms symbiont microbial communities from Oahu, Hawaii - Olavius sp. 1 OAHU.JWI-45 metaG	Host-Associated	Open in IMG/M
3300027347	Marine gutless worms symbiont microbial communities from Max Planck institute for Marine Microbiology, Germany - Inanidrilus makropetalos BAHAMAS.2 (SPAdes)	Host-Associated	Open in IMG/M
3300027392	Marine gutless worms symbiont microbial communities from Max Planck institute for Marine Microbiology, Germany - Olavius loisae LIZARD ISLAND.1 (SPAdes)	Host-Associated	Open in IMG/M
3300027398	Marine gutless worms symbiont microbial communities from Max Planck institute for Marine Microbiology, Germany - Inanidrilus makropetalos BAHAMAS.1 (SPAdes)	Host-Associated	Open in IMG/M

Hidden Markov Model


Click on a Sequence Logo column to get its information.
Powered by Skylign