NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F082415

Metagenome / Metatranscriptome Family F082415

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F082415
Family Type Metagenome / Metatranscriptome
Number of Sequences 113
Average Sequence Length 46 residues
Representative Sequence KNGNPAGRLNKIILADGSELHDTQLGGDAGGKTRYDPDADVKK
Number of Associated Samples 101
Number of Associated Scaffolds 113

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 2.68 %
% of genes near scaffold ends (potentially truncated) 95.58 %
% of genes from short scaffolds (< 2000 bps) 92.92 %
Associated GOLD sequencing projects 97
AlphaFold2 3D model prediction Yes
3D model pTM-score0.26

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (99.115 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil
(9.735 % of family members)
Environment Ontology (ENVO) Unclassified
(32.743 % of family members)
Earth Microbiome Project Ontology (EMPO) Host-associated → Plant → Plant rhizosphere
(38.938 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 0.00%    β-sheet: 8.45%    Coil/Unstructured: 91.55%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  		pTM-score: 0.26
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 113 Family Scaffolds
PF13531SBP_bac_11 7.96
PF13620CarboxypepD_reg 0.88
PF01799Fer2_2 0.88
PF00005ABC_tran 0.88
PF06594HCBP_related 0.88
PF02276CytoC_RC 0.88
PF02738MoCoBD_1 0.88

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 113 Family Scaffolds
COG2931Ca2+-binding protein, RTX toxin-relatedSecondary metabolites biosynthesis, transport and catabolism [Q] 0.88

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms99.12 %
UnclassifiedrootN/A0.88 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300000550|F24TB_11629275All Organisms → cellular organisms → Bacteria634Open in IMG/M
3300000559|F14TC_101039783All Organisms → cellular organisms → Bacteria554Open in IMG/M
3300000559|F14TC_101039861All Organisms → cellular organisms → Bacteria572Open in IMG/M
3300000956|JGI10216J12902_106262157All Organisms → cellular organisms → Bacteria934Open in IMG/M
3300000956|JGI10216J12902_120550170All Organisms → cellular organisms → Bacteria875Open in IMG/M
3300004157|Ga0062590_102322788All Organisms → cellular organisms → Bacteria564Open in IMG/M
3300004479|Ga0062595_101844402All Organisms → cellular organisms → Bacteria577Open in IMG/M
3300004635|Ga0062388_101187051All Organisms → cellular organisms → Bacteria754Open in IMG/M
3300004803|Ga0058862_12541210All Organisms → cellular organisms → Bacteria524Open in IMG/M
3300005328|Ga0070676_10712063All Organisms → cellular organisms → Bacteria734Open in IMG/M
3300005331|Ga0070670_101246603All Organisms → cellular organisms → Bacteria680Open in IMG/M
3300005365|Ga0070688_100212128All Organisms → cellular organisms → Bacteria1360Open in IMG/M
3300005406|Ga0070703_10022293All Organisms → cellular organisms → Bacteria1858Open in IMG/M
3300005440|Ga0070705_100006513All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Novosphingobium → unclassified Novosphingobium → Novosphingobium sp. Rr 2-175731Open in IMG/M
3300005440|Ga0070705_100027434All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium3109Open in IMG/M
3300005445|Ga0070708_100218702All Organisms → cellular organisms → Bacteria1786Open in IMG/M
3300005518|Ga0070699_101356771All Organisms → cellular organisms → Bacteria652Open in IMG/M
3300005529|Ga0070741_11370725All Organisms → cellular organisms → Bacteria589Open in IMG/M
3300005535|Ga0070684_100366639All Organisms → cellular organisms → Bacteria1326Open in IMG/M
3300005545|Ga0070695_100664212All Organisms → cellular organisms → Bacteria824Open in IMG/M
3300005545|Ga0070695_100866371All Organisms → cellular organisms → Bacteria728Open in IMG/M
3300005546|Ga0070696_100332886All Organisms → cellular organisms → Bacteria → Proteobacteria1171Open in IMG/M
3300005546|Ga0070696_101201798All Organisms → cellular organisms → Bacteria641Open in IMG/M
3300005555|Ga0066692_10987851All Organisms → cellular organisms → Bacteria515Open in IMG/M
3300005556|Ga0066707_10671911All Organisms → cellular organisms → Bacteria652Open in IMG/M
3300005564|Ga0070664_100139125All Organisms → cellular organisms → Bacteria2137Open in IMG/M
3300005713|Ga0066905_100718869All Organisms → cellular organisms → Bacteria859Open in IMG/M
3300005713|Ga0066905_101656613All Organisms → cellular organisms → Bacteria587Open in IMG/M
3300005764|Ga0066903_103888953All Organisms → cellular organisms → Bacteria802Open in IMG/M
3300005842|Ga0068858_101535330All Organisms → cellular organisms → Bacteria657Open in IMG/M
3300006049|Ga0075417_10742590All Organisms → cellular organisms → Bacteria506Open in IMG/M
3300006797|Ga0066659_10244114All Organisms → cellular organisms → Bacteria1341Open in IMG/M
3300006806|Ga0079220_10604963All Organisms → cellular organisms → Bacteria780Open in IMG/M
3300006852|Ga0075433_11253803All Organisms → cellular organisms → Bacteria643Open in IMG/M
3300006853|Ga0075420_100007580All Organisms → cellular organisms → Bacteria9584Open in IMG/M
3300006903|Ga0075426_10378549All Organisms → cellular organisms → Bacteria1043Open in IMG/M
3300007004|Ga0079218_11193342All Organisms → cellular organisms → Bacteria788Open in IMG/M
3300009012|Ga0066710_103061910All Organisms → cellular organisms → Bacteria648Open in IMG/M
3300009090|Ga0099827_10127580All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria2056Open in IMG/M
3300009100|Ga0075418_10661521All Organisms → cellular organisms → Bacteria1125Open in IMG/M
3300009100|Ga0075418_12718330All Organisms → cellular organisms → Bacteria540Open in IMG/M
3300009100|Ga0075418_13105891All Organisms → cellular organisms → Bacteria506Open in IMG/M
3300009156|Ga0111538_10643905All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1344Open in IMG/M
3300009162|Ga0075423_11733144All Organisms → cellular organisms → Bacteria673Open in IMG/M
3300009409|Ga0114993_10523879All Organisms → cellular organisms → Bacteria879Open in IMG/M
3300009609|Ga0105347_1387395All Organisms → cellular organisms → Bacteria600Open in IMG/M
3300009610|Ga0105340_1558884All Organisms → cellular organisms → Bacteria511Open in IMG/M
3300009804|Ga0105063_1054373All Organisms → cellular organisms → Bacteria582Open in IMG/M
3300010358|Ga0126370_11373299All Organisms → cellular organisms → Bacteria666Open in IMG/M
3300010362|Ga0126377_12388733All Organisms → cellular organisms → Bacteria605Open in IMG/M
3300010373|Ga0134128_12292358All Organisms → cellular organisms → Bacteria595Open in IMG/M
3300010400|Ga0134122_11673912All Organisms → cellular organisms → Bacteria663Open in IMG/M
3300010401|Ga0134121_12117876All Organisms → cellular organisms → Bacteria597Open in IMG/M
3300010403|Ga0134123_11025323All Organisms → cellular organisms → Bacteria843Open in IMG/M
3300010403|Ga0134123_12693347All Organisms → cellular organisms → Bacteria565Open in IMG/M
3300011405|Ga0137340_1065685All Organisms → cellular organisms → Bacteria699Open in IMG/M
3300011434|Ga0137464_1120301All Organisms → cellular organisms → Bacteria782Open in IMG/M
3300012189|Ga0137388_11884596All Organisms → cellular organisms → Bacteria528Open in IMG/M
3300012228|Ga0137459_1167019All Organisms → cellular organisms → Bacteria649Open in IMG/M
3300012672|Ga0137317_1025742All Organisms → cellular organisms → Bacteria575Open in IMG/M
3300012907|Ga0157283_10284700All Organisms → cellular organisms → Bacteria566Open in IMG/M
3300012922|Ga0137394_10234802All Organisms → cellular organisms → Bacteria1567Open in IMG/M
3300012922|Ga0137394_10901476All Organisms → cellular organisms → Bacteria738Open in IMG/M
3300012944|Ga0137410_10633981All Organisms → cellular organisms → Bacteria886Open in IMG/M
3300013297|Ga0157378_11208855All Organisms → cellular organisms → Bacteria795Open in IMG/M
3300014166|Ga0134079_10176347All Organisms → cellular organisms → Bacteria880Open in IMG/M
3300014864|Ga0180068_1067240All Organisms → cellular organisms → Bacteria598Open in IMG/M
3300014875|Ga0180083_1017810All Organisms → cellular organisms → Bacteria1313Open in IMG/M
3300014878|Ga0180065_1122547All Organisms → cellular organisms → Bacteria597Open in IMG/M
3300014880|Ga0180082_1005003All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria2598Open in IMG/M
3300015373|Ga0132257_102745791All Organisms → cellular organisms → Bacteria641Open in IMG/M
3300015374|Ga0132255_101267856All Organisms → cellular organisms → Bacteria1111Open in IMG/M
3300017822|Ga0187802_10436975All Organisms → cellular organisms → Bacteria519Open in IMG/M
3300018071|Ga0184618_10229643All Organisms → cellular organisms → Bacteria782Open in IMG/M
3300018429|Ga0190272_12509570All Organisms → cellular organisms → Bacteria561Open in IMG/M
3300018468|Ga0066662_12024404All Organisms → cellular organisms → Bacteria603Open in IMG/M
3300018469|Ga0190270_11440985All Organisms → cellular organisms → Bacteria736Open in IMG/M
3300019229|Ga0180116_1335423All Organisms → cellular organisms → Bacteria1017Open in IMG/M
3300020065|Ga0180113_1206225All Organisms → cellular organisms → Bacteria1015Open in IMG/M
3300020583|Ga0210401_11253251All Organisms → cellular organisms → Bacteria600Open in IMG/M
3300021081|Ga0210379_10135449All Organisms → cellular organisms → Bacteria1041Open in IMG/M
3300021082|Ga0210380_10518179All Organisms → cellular organisms → Bacteria547Open in IMG/M
(restricted) 3300024059|Ga0255040_10474706All Organisms → cellular organisms → Bacteria535Open in IMG/M
3300025917|Ga0207660_11341605All Organisms → cellular organisms → Bacteria580Open in IMG/M
3300025922|Ga0207646_10201468All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas1798Open in IMG/M
3300025925|Ga0207650_11854029All Organisms → cellular organisms → Bacteria510Open in IMG/M
3300025936|Ga0207670_10900931All Organisms → cellular organisms → Bacteria741Open in IMG/M
3300025945|Ga0207679_10121928All Organisms → cellular organisms → Bacteria2077Open in IMG/M
3300025949|Ga0207667_12144846All Organisms → cellular organisms → Bacteria517Open in IMG/M
3300027533|Ga0208185_1095429All Organisms → cellular organisms → Bacteria699Open in IMG/M
3300027835|Ga0209515_10284963All Organisms → cellular organisms → Bacteria932Open in IMG/M
3300027835|Ga0209515_10288359All Organisms → cellular organisms → Bacteria924Open in IMG/M
3300027842|Ga0209580_10200717All Organisms → cellular organisms → Bacteria989Open in IMG/M
3300027880|Ga0209481_10208089All Organisms → cellular organisms → Bacteria978Open in IMG/M
3300028381|Ga0268264_12054527All Organisms → cellular organisms → Bacteria580Open in IMG/M
3300028713|Ga0307303_10195545All Organisms → cellular organisms → Bacteria500Open in IMG/M
3300028784|Ga0307282_10519406All Organisms → cellular organisms → Bacteria578Open in IMG/M
3300028863|Ga0302218_10119097All Organisms → cellular organisms → Bacteria833Open in IMG/M
3300029944|Ga0311352_10648267All Organisms → cellular organisms → Bacteria839Open in IMG/M
3300031236|Ga0302324_101570852All Organisms → cellular organisms → Bacteria850Open in IMG/M
3300031548|Ga0307408_100670932All Organisms → cellular organisms → Bacteria929Open in IMG/M
3300031719|Ga0306917_11483103All Organisms → cellular organisms → Bacteria522Open in IMG/M
3300031824|Ga0307413_11371455All Organisms → cellular organisms → Bacteria621Open in IMG/M
3300031912|Ga0306921_11430568All Organisms → cellular organisms → Bacteria759Open in IMG/M
3300031940|Ga0310901_10140721All Organisms → cellular organisms → Bacteria915Open in IMG/M
3300031949|Ga0214473_11236996All Organisms → cellular organisms → Bacteria770Open in IMG/M
3300031954|Ga0306926_12821276All Organisms → cellular organisms → Bacteria524Open in IMG/M
3300032119|Ga0316051_1006747All Organisms → cellular organisms → Bacteria884Open in IMG/M
3300032126|Ga0307415_101118425All Organisms → cellular organisms → Bacteria738Open in IMG/M
3300032205|Ga0307472_102395598All Organisms → cellular organisms → Bacteria535Open in IMG/M
3300033004|Ga0335084_12324131All Organisms → cellular organisms → Bacteria517Open in IMG/M
3300033433|Ga0326726_11812594All Organisms → cellular organisms → Bacteria594Open in IMG/M

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Soil9.73%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere8.85%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere8.85%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil5.31%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil5.31%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil4.42%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil4.42%
Groundwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment3.54%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil2.65%
SoilEnvironmental → Terrestrial → Soil → Loam → Grasslands → Soil2.65%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil2.65%
PalsaEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa2.65%
RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere2.65%
GroundwaterEnvironmental → Aquatic → Freshwater → Groundwater → Contaminated → Groundwater1.77%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil1.77%
Surface SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil1.77%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil1.77%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil1.77%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil1.77%
Corn RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere1.77%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere1.77%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere1.77%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere1.77%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere1.77%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere1.77%
Bog Forest SoilEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil0.89%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment0.89%
MarineEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Marine0.89%
SeawaterEnvironmental → Aquatic → Marine → Strait → Unclassified → Seawater0.89%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment0.89%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil0.89%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil0.89%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil0.89%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil0.89%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Uranium Contaminated → Soil0.89%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil0.89%
Groundwater SandEnvironmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand0.89%
Peat SoilEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil0.89%
Host-AssociatedHost-Associated → Human → Digestive System → Large Intestine → Fecal → Host-Associated0.89%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere0.89%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.89%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere0.89%

Visualization
Powered by ApexCharts



Associated Samples

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Taxon OIDSample NameHabitat TypeIMG/M Link
3300000550Amended soil microbial communities from Kansas Great Prairies, USA - BrdU amended with acetate total DNA F2.4 TB clc assemlyEnvironmentalOpen in IMG/M
3300000559Amended soil microbial communities from Kansas Great Prairies, USA - control no BrdU total DNA F1.4 TC clc assemlyEnvironmentalOpen in IMG/M
3300000956Soil microbial communities from Great Prairies - Kansas, Native Prairie soilEnvironmentalOpen in IMG/M
3300004157Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - - Combined assembly of AARS Block 2EnvironmentalOpen in IMG/M
3300004479Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAsEnvironmentalOpen in IMG/M
3300004635Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3EnvironmentalOpen in IMG/M
3300004803Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300005328Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaGHost-AssociatedOpen in IMG/M
3300005331Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaGHost-AssociatedOpen in IMG/M
3300005365Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaGEnvironmentalOpen in IMG/M
3300005406Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaGEnvironmentalOpen in IMG/M
3300005440Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaGEnvironmentalOpen in IMG/M
3300005445Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaGEnvironmentalOpen in IMG/M
3300005518Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaGEnvironmentalOpen in IMG/M
3300005529Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen16_06102014_R1EnvironmentalOpen in IMG/M
3300005535Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaGEnvironmentalOpen in IMG/M
3300005545Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaGEnvironmentalOpen in IMG/M
3300005546Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaGEnvironmentalOpen in IMG/M
3300005555Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141EnvironmentalOpen in IMG/M
3300005556Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156EnvironmentalOpen in IMG/M
3300005564Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaGHost-AssociatedOpen in IMG/M
3300005713Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2)EnvironmentalOpen in IMG/M
3300005764Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)EnvironmentalOpen in IMG/M
3300005842Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2Host-AssociatedOpen in IMG/M
3300006049Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1Host-AssociatedOpen in IMG/M
3300006797Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108EnvironmentalOpen in IMG/M
3300006806Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100EnvironmentalOpen in IMG/M
3300006852Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2Host-AssociatedOpen in IMG/M
3300006853Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD4Host-AssociatedOpen in IMG/M
3300006903Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD5Host-AssociatedOpen in IMG/M
3300007004Agricultural soil microbial communities from Utah to study Nitrogen management - NC CompostEnvironmentalOpen in IMG/M
3300009012Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159EnvironmentalOpen in IMG/M
3300009090Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaGEnvironmentalOpen in IMG/M
3300009100Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2Host-AssociatedOpen in IMG/M
3300009156Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2)Host-AssociatedOpen in IMG/M
3300009162Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2Host-AssociatedOpen in IMG/M
3300009409Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB2_150EnvironmentalOpen in IMG/M
3300009609Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT890EnvironmentalOpen in IMG/M
3300009610Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT700EnvironmentalOpen in IMG/M
3300009804Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N3_30_40EnvironmentalOpen in IMG/M
3300010358Tropical forest soil microbial communities from Panama - MetaG Plot_3EnvironmentalOpen in IMG/M
3300010362Tropical forest soil microbial communities from Panama - MetaG Plot_22EnvironmentalOpen in IMG/M
3300010373Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4EnvironmentalOpen in IMG/M
3300010400Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2EnvironmentalOpen in IMG/M
3300010401Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1EnvironmentalOpen in IMG/M
3300010403Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3EnvironmentalOpen in IMG/M
3300011405Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT400_2EnvironmentalOpen in IMG/M
3300011434Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT814_2EnvironmentalOpen in IMG/M
3300012189Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaGEnvironmentalOpen in IMG/M
3300012228Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT700_2EnvironmentalOpen in IMG/M
3300012672Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT266_2EnvironmentalOpen in IMG/M
3300012907Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S044-104R-1EnvironmentalOpen in IMG/M
3300012922Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaGEnvironmentalOpen in IMG/M
3300012944Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300013297Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaGHost-AssociatedOpen in IMG/M
3300014166Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09182015EnvironmentalOpen in IMG/M
3300014864Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT231A'_16_10DEnvironmentalOpen in IMG/M
3300014875Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT660_1_16_10DEnvironmentalOpen in IMG/M
3300014878Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT200A_16_10DEnvironmentalOpen in IMG/M
3300014880Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT660_16_10DEnvironmentalOpen in IMG/M
3300015373Combined assembly of cpr5 rhizosphereHost-AssociatedOpen in IMG/M
3300015374Col-0 rhizosphere combined assemblyHost-AssociatedOpen in IMG/M
3300017822Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_2EnvironmentalOpen in IMG/M
3300018071Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30_b1EnvironmentalOpen in IMG/M
3300018429Populus adjacent soil microbial communities from riparian zone of Shoshone River, Wyoming, USA - 504 TEnvironmentalOpen in IMG/M
3300018468Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111EnvironmentalOpen in IMG/M
3300018469Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 320 TEnvironmentalOpen in IMG/M
3300019229Metatranscriptome of soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaT ERMLT660_1_16_1Ra (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300020065Metatranscriptome of soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaT ERMLT499_16_1Ra (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300020583Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-MEnvironmentalOpen in IMG/M
3300021081Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_32_coex redoEnvironmentalOpen in IMG/M
3300021082Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_5_coex redoEnvironmentalOpen in IMG/M
3300024059 (restricted)Seawater microbial communities from Strait of Georgia, British Columbia, Canada - BC1_12_2EnvironmentalOpen in IMG/M
3300025917Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025922Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025925Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025936Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025945Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025949Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300027533Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT700 (SPAdes)EnvironmentalOpen in IMG/M
3300027835Subsurface groundwater microbial communities from S. Glens Falls, New York, USA - GMW60B uncontaminated upgradient, 5.4 m (SPAdes)EnvironmentalOpen in IMG/M
3300027842Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 (SPAdes)EnvironmentalOpen in IMG/M
3300027880Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3 (SPAdes)Host-AssociatedOpen in IMG/M
3300028381Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300028713Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_184EnvironmentalOpen in IMG/M
3300028784Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_121EnvironmentalOpen in IMG/M
3300028863Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E1_1EnvironmentalOpen in IMG/M
3300029944II_Palsa_E1 coassemblyEnvironmentalOpen in IMG/M
3300031236Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_1EnvironmentalOpen in IMG/M
3300031548Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3Host-AssociatedOpen in IMG/M
3300031719Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 (v2)EnvironmentalOpen in IMG/M
3300031824Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2Host-AssociatedOpen in IMG/M
3300031912Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2)EnvironmentalOpen in IMG/M
3300031940Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24D2EnvironmentalOpen in IMG/M
3300031949Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT98D197EnvironmentalOpen in IMG/M
3300031954Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2)EnvironmentalOpen in IMG/M
3300032119Metatranscriptome of soil microbial communities from Bohemian Forest, Czech Republic ? CSE5 (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300032126Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2Host-AssociatedOpen in IMG/M
3300032205Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05EnvironmentalOpen in IMG/M
3300033004Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.4EnvironmentalOpen in IMG/M
3300033433Lab enriched peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF15MNEnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Protein ID Sample Taxon ID Habitat Sequence
F24TB_1162927513300000550SoilAKNGNPAGRLQKIILADGSELRDTQLGGDAPKTRFDPEAGR*
F14TC_10103978313300000559SoilYVAKNGNPAGRLNKIILADGSELHDTQLGGDAGGKTRYDPDADTSKK*
F14TC_10103986123300000559SoilVAKNGNPAGRLQKIILADGSELRDTQLGGDAPKTRFDPEAGR*
JGI10216J12902_10626215723300000956SoilPGDVITVRMYVAKNGNPAGRLQKIILADGSELHDTQLGGDEGGKSRYDPFAGK*
JGI10216J12902_12055017023300000956SoilVRMYVAKNGNPAGRLQKIVLADGSELRDTQLGGDAPKTRYDPFAEPEKK*
Ga0062590_10232278823300004157SoilVTISMYATTNGNPVGRLNKITLADGTVLHDTQLGGDAGNKTSYDPNAEPTKK*
Ga0062595_10184440223300004479SoilTVRMYLAKNGNPAGRLNKIILADGSELHDTQLGGDSGGKSRYDPDAK*
Ga0062388_10118705113300004635Bog Forest SoilSVFLYPSKSGSPAGRLNKLVLADGTILHDTQLGGDGGGKTRYDPNADKAAPKQ*
Ga0058862_1254121013300004803Host-AssociatedAAGDKITVRMYLAKNGNPAGRLQKIVLADGSELHDTQLGGDEGGKSRYDPDAAPKK*
Ga0070676_1071206313300005328Miscanthus RhizosphereAGDKITVRMYLAKNGNPAGRLQKIVLADGSELHDTQLGGDEGGKSRYDPDAAPKK*
Ga0070670_10124660323300005331Switchgrass RhizosphereRMYVAKNGNPAGRLNKIILADGSELHDTQLGGDAGGKTRYDPDADTSKK*
Ga0070688_10021212833300005365Switchgrass RhizosphereMYLAKNGNPAGRLNKIVLADGSELHDTQLGGDAGGKSRYDPDADVKK*
Ga0070703_1002229313300005406Corn, Switchgrass And Miscanthus RhizosphereITVRMYVAKNGNAAGRLQKIILADGSELHDTQLGGDEGGKSRYDPDAAPKK*
Ga0070705_10000651393300005440Corn, Switchgrass And Miscanthus RhizosphereRMYVSKNGNPAGRLNKIILADGTELHDTQLGGDEGGKTRYDPDAKK*
Ga0070705_10002743443300005440Corn, Switchgrass And Miscanthus RhizosphereRMYVAKNGNPAGRLNKFILADGSELHDTQLGGDAGGKSRYDPDADTKK*
Ga0070708_10021870233300005445Corn, Switchgrass And Miscanthus RhizosphereGDVVTVRMYVAKNGNPAGRLNKIILADGSELHDTQLGGDAGGKSRYDPDAESGKK*
Ga0070699_10135677113300005518Corn, Switchgrass And Miscanthus RhizosphereVTVRMYVAKNGNPAGRLNKIIFADGSELHDTQLGGDAGGKTRYDPDAK*
Ga0070741_1137072513300005529Surface SoilRLNKIIMKDGTELHDTQLGGDAGGKTRYDPDAAK*
Ga0070684_10036663933300005535Corn RhizosphereMYLAKNGNPAGRLNKIILADGSELHDTQLGGDAGGKSRYDPDAEKK*
Ga0070695_10066421213300005545Corn, Switchgrass And Miscanthus RhizosphereSLAPGDEVTLRVYMAKTGNPAGRLNKIILKDGTELHDTQLGGDADGKTSYTIPSQ*
Ga0070695_10086637113300005545Corn, Switchgrass And Miscanthus RhizosphereNPAGRLKKIVLADSSELHDMQLGGDTGGKTRYDPDPDVTK*
Ga0070696_10033288613300005546Corn, Switchgrass And Miscanthus RhizosphereMTGNRRVTFVAKNRNPAGRLKKIVLADSSELHDMQLGGDTGGKTRYDPDPDVKK*
Ga0070696_10120179823300005546Corn, Switchgrass And Miscanthus RhizosphereRMYVAKNGNPAGRLQKIILADGSELHDTQLGGDAGGKTRYDPDVK*
Ga0066692_1098785113300005555SoilAAKNGNPAGRLNKIVLADGTVLHDTQLGGDAGNKTGYDPNADPKNK*
Ga0066707_1067191113300005556SoilMPGDVITVRMYVAKNGNPAGRLQKIILADGSELHDTQLGGDAGGKTRYDPDADTGKK*
Ga0070664_10013912543300005564Corn RhizosphereLQKIILADGSELHDTQLGGDEGGKTRYDPDAAPKK*
Ga0066905_10071886913300005713Tropical Forest SoilTVRMYVAKNGNPAGRLNKIILADGSELHDTQLGGDEGGKTRYDPDAAKK*
Ga0066905_10165661313300005713Tropical Forest SoilITVRMYVAKNGNPAGRLNKIILADGSELHDTQLGGDAGGKSRYDPDAESTKK*
Ga0066903_10388895323300005764Tropical Forest SoilGRLNKIVLSDGSELHDTQLGGDGGNKSGYGPDAGPRNR*
Ga0068858_10153533023300005842Switchgrass RhizosphereSVAPGDMITVRMYLAKNGNPAGRLNKIVLADGSELHDTQLGGDAGGKSRYDPDADVKK*
Ga0075417_1074259013300006049Populus RhizosphereITVRMYVSKNGNPAGRLNKIILADGSELHDTQLGGDAGGKTRYDPDAGK*
Ga0066659_1024411413300006797SoilKNGNPAGRLQKIILADGTELHDTQLGGDAGGKTRFDPDADSGKK*
Ga0079220_1060496313300006806Agricultural SoilTPGDVVSVTMYAAKNGNPAGRLNKIILADGSVLHDTQLGGDEGNKTGYGPDAGSRNR*
Ga0075433_1125380323300006852Populus RhizosphereMITVRMYVAKNGNPAGRLNKIILADGSELHDTQLGGDEGGKSRYDPDAAKK*
Ga0075420_100007580113300006853Populus RhizosphereNGNPAGRLQKIILADGSELRDTQLGGEAPKTRFDPEAGK*
Ga0075426_1037854913300006903Populus RhizosphereRMYVAKTGNPVGRLNKIILADRSELHDTQLGGDAGGKSRYDPDADVKK*
Ga0079218_1119334223300007004Agricultural SoilITVFMYVAKNGNPAGRLQKLVLADGSELRDTQLGGDAPKTRYDPDAGK*
Ga0066710_10306191013300009012Grasslands SoilVRMYVAKNGNPAGRLQKIILADGSELHDTQLGGDAGGKTRFDPDADSGKK
Ga0099827_1012758013300009090Vadose Zone SoilDAIAPGDVITVRMYVAKNGNPAGRLNKIILADGSELHDTQLGGDAGGKSRYDPDAK*
Ga0075418_1066152113300009100Populus RhizospherePGDVITVRMYVSKNGNPAGRLQKIILADGSELHDTQLGGDEGGKSRYDPDAESGKK*
Ga0075418_1271833013300009100Populus RhizosphereAKNGNPAGRLQKIILADGSELHDTQLGGDEGGKTRYDPDAAPKK*
Ga0075418_1310589123300009100Populus RhizosphereNKIILADGSELHDTQLGGDAGGKTRYDPDADTGKK*
Ga0111538_1064390513300009156Populus RhizospherePAGRLNKIILADGSELHDTQLGGDAGGKSRYDPDAETGKK*
Ga0075423_1173314423300009162Populus RhizosphereGNPAGRLQKIILADGSELHDTQLGGDAGGKTRFNPDADSGKK*
Ga0114993_1052387913300009409MarineVITVRMYVAKNGNPAGRLQKVVFADGTELHDTQLGGDEGGKSRYDPYGFRG*
Ga0105347_138739523300009609SoilAGRLNKIILADGSELHDTQLGGDAGGKTRYDPDADVKK*
Ga0105340_155888413300009610SoilGNPAGRLNKIVLKDGTVLRDTQLGGEAGNKTGYDPNADPTKK*
Ga0105063_105437313300009804Groundwater SandKNGNPAGRLQKIILADGSELRDTQLGGDAPKTRFDPEAGR*
Ga0126370_1137329923300010358Tropical Forest SoilKNGNPAGRLNKIVLSDGSELHDTQLGGDGGNKTGYGPDAGQRNR*
Ga0126377_1238873323300010362Tropical Forest SoilGRLNKIILKDGTELHDTQLGGDADGKTSYDPPSQ*
Ga0134128_1229235823300010373Terrestrial SoilMHRSIAAPGRLNKIILADGSELHDTQLGGDAGGKTRYDPDADVKK*
Ga0134122_1167391223300010400Terrestrial SoilGRLNKIIMADGSELHDTQLGGDSGGKSRYDPDAK*
Ga0134121_1211787613300010401Terrestrial SoilKNGNPAGRLQKIILADGSELHDTQLGGDEGGKTRFVPGAESGQK*
Ga0134123_1102532323300010403Terrestrial SoilMYVSKNGNPAGRLNKIILADGSELHDTQLGGDAGGKTRYDPDVK*
Ga0134123_1269334713300010403Terrestrial SoilMYLAKNGNPAGRLQKIILADGSELHDTQLGGDEGGKTRYDPDAAPKK*
Ga0137340_106568523300011405SoilWRLPKIILADGSELNDTQLGGDAAGKTRYDPDADVKK*
Ga0137464_112030113300011434SoilKNGNPAGRLNKIILADGSELHDTQLGGDAGGKTRYDPDADVKK*
Ga0137388_1043061513300012189Vadose Zone SoilIYAAKTGNPAGRLNRVVLADGTTLHDTQLGGDAGNKTGYGHDTGANRGNEGK*
Ga0137388_1188459613300012189Vadose Zone SoilGNPAGRLQKIILADGSELHDTQLGGDAGGKTRYDPDADTGKK*
Ga0137459_116701923300012228SoilITVRMYVSKNGNPAGRLNKIILADGSELHDTQLGGDAGGKTRYDPDADVKK*
Ga0137317_102574213300012672SoilRMYVSKNGNPAGRLQKIIFADGTDLHDTQLGGDEGGKTRYDPLAGK*
Ga0157283_1028470013300012907SoilRLQKIVLADGSELHDTQLGGDEGGKSRYDPDAAPKK*
Ga0137394_1023480233300012922Vadose Zone SoilTVMPGDVITVRMYVAKNGNPAGRLQKIILADGSELHDTQLGGDAGGKTRFDPDADSGKK*
Ga0137394_1090147613300012922Vadose Zone SoilNPAGRLNKIILADGSELHDTQLGGDEGGKTRYDPDAKK*
Ga0137410_1063398123300012944Vadose Zone SoilPGDVVTVRMYLAKNGNPAGRLNKIILADGSELHDTQLGGDAGGKTRYDPDAEPKK*
Ga0157378_1120885523300013297Miscanthus RhizosphereVVTVRMYVAKNGNPAGRLNKIILKDGSELHDTQLGGDEGGKTRYDPDAVKK*
Ga0134079_1017634723300014166Grasslands SoilVTVRMYVAKNGNPAGRLNKIILADGSELHDTQLGGDAGGKTRYDPDAK*
Ga0180068_106724013300014864SoilTVRMYVSKNGNPAGRLQKIIFADGTDLHDTQLGGDEGGKTRYDPLAGK*
Ga0180083_101781013300014875SoilGRLNKIILADGSELHDTQLGGDAGGKTRYNPDADVKK*
Ga0180065_112254723300014878SoilIILADGSDLHDTQLGGDAGGKTRYDPEADPDNKK*
Ga0180082_100500343300014880SoilNKIILADGSELHDTQLGGDAGGKTRYDPDADVKK*
Ga0132257_10274579113300015373Arabidopsis RhizosphereNPAGRLNKIILEDGSELHDTQLGGDKGGKSRYDPDAESKK*
Ga0132255_10126785623300015374Arabidopsis RhizosphereYVSKNGNPAGRLNKIILADGTELHDTQLGGDEGGKTRYDPDAKK*
Ga0187802_1043697523300017822Freshwater SedimentPAGRMNKIVLPDGTTLHDTQLGGDGGKSRYNPDADSKSQKPNQ
Ga0184618_1022964313300018071Groundwater SedimentKNGNPAGRLQKIILADGSELHDTQLGGDAGGKTRYDPDADIGKK
Ga0190272_1250957023300018429SoilVVKNGNNAGRLQKIVLADGSELRDTQLGGDAPKTRFDPFAEKEKK
Ga0066662_1202440413300018468Grasslands SoilNGNPAGRLNKVVLSDGSVLHDTQLGGDAGNKSDYRPDDYSKEKK
Ga0190270_1144098513300018469SoilPGDVITVRMYVAKNGNPAGRLQKIILADGSELRDTQLGGDAPKTRFDPEAVK
Ga0180116_133542313300019229Groundwater SedimentWRLQKIILADGSELNDTQLGGDAAGKTRYDPDADVKK
Ga0180113_120622513300020065Groundwater SedimentPAGRLNKIILADGSELHDTQLGGDAGGKTRYDPDADVKK
Ga0210401_1125325113300020583SoilIYPAKSGNPAGRLNRIVLPDGTTLHDTQLGGEGGKGRYNPGGDADSKKAKP
Ga0210379_1013544913300021081Groundwater SedimentSKNGNPAGRLNKIILADGSELHDTQLGGDAGGKTRYDPDADVKK
Ga0210380_1051817923300021082Groundwater SedimentMYVAKNGNPAGRLNKITLADGTELRDTQLGGEEGGKTRYDPFAESGK
(restricted) Ga0255040_1047470613300024059SeawaterGRLNKIIFADGTELHDTQLGGDEGGKSRYDPHGFRN
Ga0207660_1134160513300025917Corn RhizosphereITVRMYVSKNDNPAGRLQKIVLADGSELRDTQLGGDAPKSRYDPDAGK
Ga0207646_1020146823300025922Corn, Switchgrass And Miscanthus RhizosphereMTGNRRVTFVAKNRNPAGRLKKIVLADSSELHDMQLGGDTGGKTRYDPDPDVKK
Ga0207650_1185402923300025925Switchgrass RhizosphereLAKNGNPAGRLQKIILADGSELHDTQLGGDEGGKTRYDPDAAPKK
Ga0207670_1090093113300025936Switchgrass RhizosphereASVAPGDMITVRMYLAKNGNPAGRLNKIVLADGSELHDTQLGGDAGGKSRYDPDADVKK
Ga0207679_1012192843300025945Corn RhizosphereAGRLQKIILADGSELHDTQLGGDEGGKTRYDPDAAPKK
Ga0207667_1214484623300025949Corn RhizosphereKNGNPAGRLQKIVLADGSELHDTQLGGDEGGKSRYDPDAAPKK
Ga0208185_109542913300027533SoilVITVRMYVSKNGNPAGRLNKIILADGSELHDTQLGGDAGGKTRYDPDADVKK
Ga0209515_1028496323300027835GroundwaterMYAAKNGNPAGRLNKIVLADGTVLHDTQLGGDAGGKTGYDPDADPKKK
Ga0209515_1028835923300027835GroundwaterAKNGNPAGRLNKIILADGNELHDTQLGGDAGGKSRYDPDAK
Ga0209580_1020071723300027842Surface SoilMYCSKNGNPAGRLNKIVLADGTELHDTVLGGESGGKTGYRPDDEPNGKK
Ga0209481_1020808923300027880Populus RhizosphereNGNPAGRLNKIILADGSELHDTQLGGDAGGKSRYDPDAETGKK
Ga0268264_1205452723300028381Switchgrass RhizosphereAGRLNKIILADGTELHDTQLGGDEGGKTRYDPDAKK
Ga0307303_1019554513300028713SoilGRLQKIILADGSELHDTQLGGDAGGKTRFDPDADSGKK
Ga0307282_1051940613300028784SoilDVVTVRMYVAKNGNPAGRLNKIILADGSELHDTQLGGDAGGKSRYDPDAK
Ga0302218_1011909723300028863PalsaDVITVDMYVAKNGNPVGRLQKIVRADGTELHDTLLGGDAGGKTKYDPDGGK
Ga0311352_1064826713300029944PalsaPGDVITVDMYVAKNGNPVGRLQKIVRADGTELHDTLLGGDAGGKTKYDPDGGK
Ga0302324_10157085223300031236PalsaNKIVRADGTELHDTILGGDAGGKTKYDPDAGKTDGGK
Ga0307408_10067093223300031548RhizospherePGDVITVRMYVSKNGNPAGRLQKIILADGSELHDTQLGGDEGGKSRYDPDADSGKK
Ga0306917_1148310313300031719SoilAYMSKNGNPAGRLNKIVLSDGTELHDTQLGGDGGNKTGYGPDAGQRNR
Ga0307413_1137145523300031824RhizosphereKNGNNAGRLQKIVLADGTELRDTQLGGEAGGKTRFDPFAEKEKK
Ga0306921_1143056813300031912SoilGNPAGRLNKVVLADGTVLHDTQLGGDSGGKTRYDPDAEPKKR
Ga0310901_1014072113300031940SoilRMYLAKNGNPAGRLQKIILADGSELHDTQLGGDEGGKTRYDPDAAPKK
Ga0214473_1123699623300031949SoilGNPAGRLNRIVLADGTILRDTQLGGDAGGKTRYDPDAEPSGQK
Ga0306926_1282127613300031954SoilNGNPAGRLNKIVLADGTVLHDTQLGGDSGGKTRYDPDAEPKKK
Ga0316051_100674713300032119SoilLNKIVLTDGTTLHDTQLGGESGKARYNPDADSKSQKNNQ
Ga0307415_10111842523300032126RhizosphereGDVITVRMYVAKNGNPAGRLQKIVLADGSELRDTQLGGDAPKTRFDPDAGK
Ga0307472_10239559813300032205Hardwood Forest SoilGNPAGRLNKIILSDGSELHDTQLGGDAGGKSRYDPDAETGKK
Ga0335084_1232413113300033004SoilKNGNPAGRLNKIIMKDGTELHDTQLGGDAGGKTRYDPDAAK
Ga0326726_1181259423300033433Peat SoilKNGNPAGRLNKIILADGSELHDTQLGGDEGGKTGYGPDAK

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.