NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F082541

Metagenome / Metatranscriptome Family F082541

Go to section:
Overview Alignments Structure & Topology Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F082541
Family Type Metagenome / Metatranscriptome
Number of Sequences 113
Average Sequence Length 76 residues
Representative Sequence MTGTSVTFDFSFDGSTWVDVVETDGTEVTYTVTAGDVVRVDPSGWAFASAGFIRVTSNGTEAADRNIQLIFKQS
Number of Associated Samples 102
Number of Associated Scaffolds 113

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 0.00 %
% of genes near scaffold ends (potentially truncated) 92.04 %
% of genes from short scaffolds (< 2000 bps) 86.73 %
Associated GOLD sequencing projects 93
AlphaFold2 3D model prediction Yes
3D model pTM-score0.59

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (72.566 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh
(24.779 % of family members)
Environment Ontology (ENVO) Unclassified
(61.947 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Saline → Water (saline)
(91.150 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 0.00%    β-sheet: 21.57%    Coil/Unstructured: 78.43%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.59
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms94.69 %
UnclassifiedrootN/A5.31 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300000101|DelMOSum2010_c10282545All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium505Open in IMG/M
3300000117|DelMOWin2010_c10064143All Organisms → Viruses → Predicted Viral1520Open in IMG/M
3300000949|BBAY94_10203757All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium533Open in IMG/M
3300001355|JGI20158J14315_10046394All Organisms → Viruses → Predicted Viral1877Open in IMG/M
3300001830|ACM40_1056156All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium548Open in IMG/M
3300001958|GOS2232_1000871All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1561Open in IMG/M
3300001969|GOS2233_1058571All Organisms → Viruses → Predicted Viral1782Open in IMG/M
3300002518|JGI25134J35505_10132754All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium518Open in IMG/M
3300005510|Ga0066825_10308680All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium582Open in IMG/M
3300006027|Ga0075462_10180053All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium640Open in IMG/M
3300006735|Ga0098038_1151817All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium771Open in IMG/M
3300006868|Ga0075481_10229155All Organisms → cellular organisms → Bacteria659Open in IMG/M
3300006916|Ga0070750_10126959All Organisms → Viruses → Predicted Viral1166Open in IMG/M
3300006920|Ga0070748_1037580All Organisms → Viruses → Predicted Viral1963Open in IMG/M
3300007133|Ga0101671_1028867All Organisms → cellular organisms → Bacteria798Open in IMG/M
3300007236|Ga0075463_10203452All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium638Open in IMG/M
3300007778|Ga0102954_1040933All Organisms → Viruses → Predicted Viral1288Open in IMG/M
3300007778|Ga0102954_1257576All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium524Open in IMG/M
3300007963|Ga0110931_1113195All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium817Open in IMG/M
3300007963|Ga0110931_1212142All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium577Open in IMG/M
3300009079|Ga0102814_10197354All Organisms → Viruses → Predicted Viral1097Open in IMG/M
3300009418|Ga0114908_1067509All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1246Open in IMG/M
3300009433|Ga0115545_1276675All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium560Open in IMG/M
3300009481|Ga0114932_10540848All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium684Open in IMG/M
3300009507|Ga0115572_10802919All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium505Open in IMG/M
3300010368|Ga0129324_10256561All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium696Open in IMG/M
3300010368|Ga0129324_10414237All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium519Open in IMG/M
3300012920|Ga0160423_11173372All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium513Open in IMG/M
3300012952|Ga0163180_10605624All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium834Open in IMG/M
3300016736|Ga0182049_1153642All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium521Open in IMG/M
3300016747|Ga0182078_10480152All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium738Open in IMG/M
3300016749|Ga0182053_1406483All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium567Open in IMG/M
3300016754|Ga0182072_1090507All Organisms → Viruses → Predicted Viral2254Open in IMG/M
3300016771|Ga0182082_1274691All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium543Open in IMG/M
3300017710|Ga0181403_1001212All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium6166Open in IMG/M
3300017729|Ga0181396_1025269All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1181Open in IMG/M
3300017739|Ga0181433_1115717All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium644Open in IMG/M
3300017760|Ga0181408_1072592All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium905Open in IMG/M
3300017762|Ga0181422_1181391All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium640Open in IMG/M
3300017765|Ga0181413_1109184All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium841Open in IMG/M
3300017771|Ga0181425_1094211All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium961Open in IMG/M
3300017776|Ga0181394_1142080All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium749Open in IMG/M
3300017786|Ga0181424_10210061All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium823Open in IMG/M
3300017824|Ga0181552_10527360All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium554Open in IMG/M
3300017949|Ga0181584_10295652All Organisms → Viruses → Predicted Viral1037Open in IMG/M
3300017956|Ga0181580_10534962All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium762Open in IMG/M
3300017968|Ga0181587_10884237All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium554Open in IMG/M
3300017968|Ga0181587_10884467All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium554Open in IMG/M
3300017969|Ga0181585_10653670All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium691Open in IMG/M
3300017969|Ga0181585_10887673All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium573Open in IMG/M
3300018418|Ga0181567_10804011All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium595Open in IMG/M
3300018420|Ga0181563_10132525All Organisms → Viruses → Predicted Viral1588Open in IMG/M
3300018428|Ga0181568_10377020All Organisms → Viruses → Predicted Viral1146Open in IMG/M
3300019266|Ga0182061_1015411All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium544Open in IMG/M
3300019267|Ga0182069_1443265All Organisms → Viruses → Predicted Viral1373Open in IMG/M
3300019280|Ga0182068_1335755All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium596Open in IMG/M
3300019280|Ga0182068_1466155All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium611Open in IMG/M
3300019283|Ga0182058_1304633All Organisms → Viruses → Predicted Viral1054Open in IMG/M
3300020175|Ga0206124_10287631All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium629Open in IMG/M
3300020189|Ga0181578_10051422All Organisms → Viruses → Predicted Viral2596Open in IMG/M
3300020312|Ga0211542_1011805All Organisms → Viruses → Predicted Viral2050Open in IMG/M
3300020345|Ga0211706_1050188All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium875Open in IMG/M
3300020378|Ga0211527_10189418All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium577Open in IMG/M
3300020380|Ga0211498_10101288All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1083Open in IMG/M
3300020395|Ga0211705_10027156All Organisms → Viruses → Predicted Viral2082Open in IMG/M
3300020401|Ga0211617_10024653All Organisms → Viruses → Predicted Viral2569Open in IMG/M
3300020401|Ga0211617_10383377All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium583Open in IMG/M
3300020403|Ga0211532_10206928All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium780Open in IMG/M
3300020417|Ga0211528_10189018All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium795Open in IMG/M
3300020430|Ga0211622_10045469All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1965Open in IMG/M
3300020431|Ga0211554_10168657All Organisms → Viruses → Predicted Viral1070Open in IMG/M
3300020457|Ga0211643_10014448All Organisms → Viruses → Predicted Viral4119Open in IMG/M
3300020468|Ga0211475_10414661All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium652Open in IMG/M
3300020469|Ga0211577_10704915All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium591Open in IMG/M
3300020471|Ga0211614_10409207All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium600Open in IMG/M
3300021368|Ga0213860_10115815All Organisms → Viruses → Predicted Viral1175Open in IMG/M
3300021379|Ga0213864_10142698All Organisms → Viruses → Predicted Viral1207Open in IMG/M
3300022050|Ga0196883_1050748All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium500Open in IMG/M
3300022064|Ga0224899_100905All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium595Open in IMG/M
3300022065|Ga0212024_1044366All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium774Open in IMG/M
3300022069|Ga0212026_1071286All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium528Open in IMG/M
3300022167|Ga0212020_1072815All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium578Open in IMG/M
3300022925|Ga0255773_10172221All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1015Open in IMG/M
3300022935|Ga0255780_10297179All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium768Open in IMG/M
3300023116|Ga0255751_10484904All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium588Open in IMG/M
3300023170|Ga0255761_10303662All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium834Open in IMG/M
3300023180|Ga0255768_10641832All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium506Open in IMG/M
3300024346|Ga0244775_10744783All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium787Open in IMG/M
3300025083|Ga0208791_1028481All Organisms → Viruses → Predicted Viral1072Open in IMG/M
3300025110|Ga0208158_1140804All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium551Open in IMG/M
3300025674|Ga0208162_1098902All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium872Open in IMG/M
3300025712|Ga0209305_1195184All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium596Open in IMG/M
3300025759|Ga0208899_1190747All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium660Open in IMG/M
3300025803|Ga0208425_1095853All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium696Open in IMG/M
3300025803|Ga0208425_1110126All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium636Open in IMG/M
3300025818|Ga0208542_1003882All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium5761Open in IMG/M
3300025853|Ga0208645_1051284All Organisms → Viruses → Predicted Viral1964Open in IMG/M
3300026125|Ga0209962_1080137All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium525Open in IMG/M
3300026138|Ga0209951_1113815All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium550Open in IMG/M
3300026260|Ga0208408_1157970All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium629Open in IMG/M
(restricted) 3300027861|Ga0233415_10092720All Organisms → Viruses → Predicted Viral1320Open in IMG/M
(restricted) 3300027861|Ga0233415_10238971All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium846Open in IMG/M
3300027917|Ga0209536_102622335All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium592Open in IMG/M
3300028196|Ga0257114_1235693All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium658Open in IMG/M
3300028197|Ga0257110_1175086All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium847Open in IMG/M
3300029319|Ga0183748_1048832All Organisms → Viruses → Predicted Viral1213Open in IMG/M
3300032011|Ga0315316_10005999All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium8976Open in IMG/M

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
Salt MarshEnvironmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh24.78%
AqueousEnvironmental → Aquatic → Marine → Coastal → Unclassified → Aqueous15.04%
MarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Marine14.16%
SeawaterEnvironmental → Aquatic → Marine → Strait → Unclassified → Seawater9.73%
MarineEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Marine8.85%
Pelagic MarineEnvironmental → Aquatic → Marine → Pelagic → Unclassified → Pelagic Marine2.65%
WaterEnvironmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Water2.65%
SeawaterEnvironmental → Aquatic → Marine → Inlet → Unclassified → Seawater1.77%
SeawaterEnvironmental → Aquatic → Marine → Coastal → Unclassified → Seawater1.77%
Freshwater To Marine Saline GradientEnvironmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient1.77%
MarineEnvironmental → Aquatic → Marine → Neritic Zone → Unclassified → Marine1.77%
Deep OceanEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Deep Ocean0.89%
SeawaterEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Seawater0.89%
MarineEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Marine0.89%
Marine PlanktonEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Marine Plankton0.89%
Surface SeawaterEnvironmental → Aquatic → Marine → Oceanic → Photic Zone → Surface Seawater0.89%
Marine SedimentEnvironmental → Aquatic → Marine → Oceanic → Sediment → Marine Sediment0.89%
MarineEnvironmental → Aquatic → Marine → Inlet → Unclassified → Marine0.89%
MarineEnvironmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine0.89%
SeawaterEnvironmental → Aquatic → Marine → Intertidal Zone → Unclassified → Seawater0.89%
EstuarineEnvironmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine0.89%
EstuarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine0.89%
SeawaterEnvironmental → Aquatic → Marine → Pelagic → Unclassified → Seawater0.89%
Pelagic MarineEnvironmental → Aquatic → Marine → Neritic Zone → Unclassified → Pelagic Marine0.89%
Deep SubsurfaceEnvironmental → Aquatic → Marine → Volcanic → Unclassified → Deep Subsurface0.89%
Volcanic Co2 SeepsEnvironmental → Aquatic → Marine → Volcanic → Unclassified → Volcanic Co2 Seeps0.89%
Pond WaterEnvironmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Pond Water0.89%
Macroalgal SurfaceHost-Associated → Algae → Green Algae → Ectosymbionts → Unclassified → Macroalgal Surface0.89%

Visualization
Powered by ApexCharts



Associated Samples

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Taxon OIDSample NameHabitat TypeIMG/M Link
3300000101Marine microbial communities from Delaware Coast, sample from Delaware MO Early Summer May 2010EnvironmentalOpen in IMG/M
3300000117Marine microbial communities from Delaware Coast, sample from Delaware MO Winter December 2010EnvironmentalOpen in IMG/M
3300000949Macroalgal surface ecosystem from Botany Bay, Sydney, Australia - BBAY94Host-AssociatedOpen in IMG/M
3300001355Pelagic Microbial community sample from North Sea - COGITO 998_met_08EnvironmentalOpen in IMG/M
3300001830Marine plankton microbial communities from the Amazon River plume, Atlantic Ocean - ACM40, ROCA_DNA028_0.2um_3lEnvironmentalOpen in IMG/M
3300001958Marine microbial communities from Gulf of Mexico, USA - GS016EnvironmentalOpen in IMG/M
3300001969Marine microbial communities from Yucatan Channel, Mexico - GS017EnvironmentalOpen in IMG/M
3300002518Marine viral communities from the Pacific Ocean - ETNP_6_100EnvironmentalOpen in IMG/M
3300005510Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201306SV45EnvironmentalOpen in IMG/M
3300006027Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_30_<0.8_DNAEnvironmentalOpen in IMG/M
3300006735Marine viral communities from the Subarctic Pacific Ocean - 5B_ETSP_OMZ_AT15132_CsCl metaGEnvironmentalOpen in IMG/M
3300006868Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_N_>0.8_DNAEnvironmentalOpen in IMG/M
3300006916Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_24EnvironmentalOpen in IMG/M
3300006920Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_12EnvironmentalOpen in IMG/M
3300007133Seawater microbiome, Papua New Guinea CO2 seep, Dobu 'bubble', water-dsEnvironmentalOpen in IMG/M
3300007236Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_30_>0.8_DNAEnvironmentalOpen in IMG/M
3300007539Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1M Viral MetaGEnvironmentalOpen in IMG/M
3300007778Water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG R2A_C_H2O_MGEnvironmentalOpen in IMG/M
3300007963Marine viral communities from the Subarctic Pacific Ocean - 4_ETSP_OMZ_AT15127 metaG (version 2)EnvironmentalOpen in IMG/M
3300009079Estuarine microbial communities from the Columbia River estuary - Flood tide ETM metaG S.741EnvironmentalOpen in IMG/M
3300009418Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_s17EnvironmentalOpen in IMG/M
3300009433Pelagic marine microbial communities from North Sea - COGITO_mtgs_100330EnvironmentalOpen in IMG/M
3300009481Deep subsurface microbial communities from Kolumbo volcano to uncover new lineages of life (NeLLi) - 2SBTROV12_ACTIVE470 metaGEnvironmentalOpen in IMG/M
3300009507Pelagic marine microbial communities from North Sea - COGITO_mtgs_120607EnvironmentalOpen in IMG/M
3300009754Marine microbial and viral communities from Louisana Shelf, Gulf of Mexico - GoM_2015_C6C_198_18m (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300010368Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_15_0.2_DNAEnvironmentalOpen in IMG/M
3300012920Marine microbial communities from the Costa Rica Dome - CRUD Field 142mm St8 metaGEnvironmentalOpen in IMG/M
3300012952Marine eukaryotic phytoplankton communities from the Atlantic Ocean - Atlantic ANT 4 MetagenomeEnvironmentalOpen in IMG/M
3300016736Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 011508BT metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300016747Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 071409BT metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300016749Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 011512AT metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300016754Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 071405BT metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300016771Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 071412BT metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300017710Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 26 SPOT_SRF_2011-09-28EnvironmentalOpen in IMG/M
3300017729Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 19 SPOT_SRF_2011-01-11EnvironmentalOpen in IMG/M
3300017739Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 56 SPOT_SRF_2014-09-10EnvironmentalOpen in IMG/M
3300017760Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 31 SPOT_SRF_2012-02-16EnvironmentalOpen in IMG/M
3300017762Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 45 SPOT_SRF_2013-07-18EnvironmentalOpen in IMG/M
3300017765Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 36 SPOT_SRF_2012-09-28EnvironmentalOpen in IMG/M
3300017771Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 48 SPOT_SRF_2013-11-13EnvironmentalOpen in IMG/M
3300017776Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 17 SPOT_SRF_2010-11-23EnvironmentalOpen in IMG/M
3300017781Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 46 SPOT_SRF_2013-08-14EnvironmentalOpen in IMG/M
3300017786Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 47 SPOT_SRF_2013-09-18EnvironmentalOpen in IMG/M
3300017824Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011501BT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300017949Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071406AT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300017956Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071403BT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300017968Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071409AT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300017969Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071407BT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300018418Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101403AT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300018420Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011512CT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300018421Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071412BT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300018428Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101404AT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300019266Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 101407AT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300019267Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 071402VT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300019280Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 071401AT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300019283Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 101404CT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300020175Pelagic subsurface seawater microbial communities from Kabeltonne, Helgoland, North Sea - Helgoland_Spring_Bloom_20160321_2EnvironmentalOpen in IMG/M
3300020189Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071401CT metaG (spades assembly)EnvironmentalOpen in IMG/M
3300020312Marine microbial communities from Tara Oceans - TARA_B100000287 (ERX556125-ERR598977)EnvironmentalOpen in IMG/M
3300020345Marine microbial communities from Tara Oceans - TARA_B100000427 (ERX556079-ERR599137)EnvironmentalOpen in IMG/M
3300020378Marine microbial communities from Tara Oceans - TARA_B100000066 (ERX556006-ERR599102)EnvironmentalOpen in IMG/M
3300020380Marine microbial communities from Tara Oceans - TARA_B000000565 (ERX555945-ERR599058)EnvironmentalOpen in IMG/M
3300020395Marine microbial communities from Tara Oceans - TARA_B100000427 (ERX555987-ERR599133)EnvironmentalOpen in IMG/M
3300020401Marine microbial communities from Tara Oceans - TARA_B100000212 (ERX555985-ERR599139)EnvironmentalOpen in IMG/M
3300020403Marine microbial communities from Tara Oceans - TARA_B100000085 (ERX556015-ERR599145)EnvironmentalOpen in IMG/M
3300020417Marine microbial communities from Tara Oceans - TARA_B100000073 (ERX556034-ERR599082)EnvironmentalOpen in IMG/M
3300020430Marine microbial communities from Tara Oceans - TARA_B100000683 (ERX556126-ERR599160)EnvironmentalOpen in IMG/M
3300020431Marine microbial communities from Tara Oceans - TARA_B100001142 (ERX556101-ERR598983)EnvironmentalOpen in IMG/M
3300020457Marine microbial communities from Tara Oceans - TARA_B100001113 (ERX555941-ERR599014)EnvironmentalOpen in IMG/M
3300020468Marine microbial communities from Tara Oceans - TARA_A100000164 (ERX555914-ERR598993)EnvironmentalOpen in IMG/M
3300020469Marine microbial communities from Tara Oceans - TARA_B100001093 (ERX555967-ERR599052)EnvironmentalOpen in IMG/M
3300020471Marine microbial communities from Tara Oceans - TARA_B100000214 (ERX556063-ERR599002)EnvironmentalOpen in IMG/M
3300021368Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO550EnvironmentalOpen in IMG/M
3300021379Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO247EnvironmentalOpen in IMG/M
3300022050Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_4 (v3)EnvironmentalOpen in IMG/M
3300022064Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 29 SPOT_SRF_2011-12-20 (v2)EnvironmentalOpen in IMG/M
3300022065Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_24 (v2)EnvironmentalOpen in IMG/M
3300022069Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_30 (v2)EnvironmentalOpen in IMG/M
3300022167Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_4 (v2)EnvironmentalOpen in IMG/M
3300022925Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011502XT metaGEnvironmentalOpen in IMG/M
3300022935Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071405AT metaGEnvironmentalOpen in IMG/M
3300023116Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071412BT metaGEnvironmentalOpen in IMG/M
3300023170Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071407BT metaGEnvironmentalOpen in IMG/M
3300023180Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071412AT metaGEnvironmentalOpen in IMG/M
3300024346Whole water sample coassemblyEnvironmentalOpen in IMG/M
3300025083Marine viral communities from the Subarctic Pacific Ocean - 11_ETSP_OMZ_AT15265 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025110Marine viral communities from the Subarctic Pacific Ocean - 8_ETSP_OMZ_AT15162 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025674Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1M Viral MetaG (SPAdes)EnvironmentalOpen in IMG/M
3300025712Pelagic marine microbial communities from North Sea - COGITO_mtgs_110321 (SPAdes)EnvironmentalOpen in IMG/M
3300025759Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_24 (SPAdes)EnvironmentalOpen in IMG/M
3300025803Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_30_<0.8_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300025818Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_15_<0.8_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300025853Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Sep_01 (SPAdes)EnvironmentalOpen in IMG/M
3300026125Water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG R2A_C_H2O_MG (SPAdes)EnvironmentalOpen in IMG/M
3300026138Salt pond water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG SF2_A_H2O_MG (SPAdes)EnvironmentalOpen in IMG/M
3300026260Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201406SV67 (SPAdes)EnvironmentalOpen in IMG/M
3300027861 (restricted)Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Na_anoxic_12_MGEnvironmentalOpen in IMG/M
3300027917Marine sediment microbial communities from White Oak River estuary, North Carolina - WOR-2-8_12 (SPAdes)EnvironmentalOpen in IMG/M
3300028196Marine microbial communities from Saanich Inlet, British Columbia, Canada - SI112_10mEnvironmentalOpen in IMG/M
3300028197Marine microbial communities from Northeast Subartic Pacific Ocean, Canada - LP_J_2015_P26_10mEnvironmentalOpen in IMG/M
3300029319Marine viral communities collected during Tara Oceans survey from station TARA_032 - TARA_A100001516EnvironmentalOpen in IMG/M
3300032011Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 60m 3416EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Protein ID Sample Taxon ID Habitat Sequence
DelMOSum2010_1028254523300000101MarineVTFDFSVDNTNWYDVVETDGTAVTYTVTAGDVVRVDPSGWAFASSGFIRVTSGSAEAADRSIKLIFRTA*
DelMOWin2010_1006414313300000117MarineQCDGLLLSGIQFPATMTGTAITLDFSFDGSTWVDVKETDGTEVSYTVSAGDMVRVDPSGWAFAAIGFLRVTSGSSEAADRQINLIFRQS*
BBAY94_1020375713300000949Macroalgal SurfaceTFDFAFDGTDWKDVVETDNTEVTYTVSADNVVRVDPSGWAFATAGFVRVTSNGTETADRKIQLIFKQS*
JGI20158J14315_1004639433300001355Pelagic MarineFPATMTGTALTLDFSFDGSTWVDVKETDGTEVSYTVSAGDVVRVDPSGWAFASIGFLRVTSGSSEAADRQINLIFKQS*
ACM40_105615623300001830Marine PlanktonQFPAAMTGSAITFDFSLDNSTWVDVKETDATDTSYTVSAGDVLRVDPSGWAFASNGYFRVTSDGTEAADRSIILHFRHS*
GOS2232_100087123300001958MarinePAAMTGSNITFDFSMDNSSFVDVKETDGSDVSYTVSVGDIVRVDPSGWAFASNGFLRVTSDGNEAADRKIILHFRHS*
GOS2233_105857113300001969MarineFPAAMTGSAITFDHSLDNSTWADVKETDGTDVTYTVSAGDLIRLDPSGWAFASNGYIRITSDGTEAADRTIEVYFRRS*
JGI25134J35505_1013275413300002518MarineFPAAMTGSNITFDFSMNGSTGWVDVFETDGTEVSYTVSAGNMLRVDPSGWAFASNGYIRINSDGSEAADRSIVLYFRHS*
Ga0066825_1030868013300005510MarineTVTFDFSFDGTNFVDVVETDGTEVSYSVSAGNVVRVDPSGWAFASNGYIRVSSNGTEAADRKIILHFRHS*
Ga0075462_1018005313300006027AqueousGIIFPATMTGTAVTFDYSLDESTWYDVVETDGTEVSYTVSAGNVTRVDPSGWAFASSGYIRISSGSAEAADRKITLIFRAS*
Ga0098038_115181713300006735MarineMLLCGIQYPAAMTGSSVTFDFSMDNSTFVDVKETDGTDVTYSVSAGDMVRVDPSGWAFASNGFIRVTSNGSEAADRKITLHFRNS*
Ga0075481_1022915523300006868AqueousLSGIVFPAAMTGANVTFDFSFDGTNWVDVVETDNTEVTYVVSAGNVVRVDPSGWAFATAGFVRVTSDGTETADRNIQLIFKQS*
Ga0070750_1012695913300006916AqueousQFPAAMTGSNITFDFSMDNSTWVDVTETDGTAVTYVVTAGDMVRVDPSGWAFASNGYIRVTSDGNEAADRSLTLHFRHS*
Ga0070748_103758013300006920AqueousFDFSIDGTNWYDVVETDGTAVTYTVTAGDAVRVDPSGWAFASSGFIRVTSGSAEAADRNIKLIFRTA*
Ga0101671_102886723300007133Volcanic Co2 SeepsLLCGVQFPAAMTGTAITFDFALDNSTWADVKETDGTDTSYTVSAGDVLRVDPSGWAFASGGYLRVTSNGTEAADRSIVLHFRHS*
Ga0075463_1020345213300007236AqueousTFDFSIDGTNWYDVVETDGTAVTYTVTAGDAVRVDPSGWAFASSGFIRVTSGSAEAADRNIKLIFRTA*
Ga0099849_107622213300007539AqueousDVVETDNTEVTYTVSPGNVVRVDPSGWAFATAGFVRVTSDATETADRNIVLIFKQS*
Ga0102954_104093323300007778WaterLLTGIVFPATMTGTEVTFDFSVDNTNWYDVVETDGTAVTYTVTAGDVVRVDPSGWAFASSGFIRVTSGSAEAADRSIKLIFRTA*
Ga0102954_125757623300007778WaterLLSGIEFPATMTGSNVTFDFSYDGSTWVDVVETDNTEVTYVVSQGNMVRVDPSGWAFAAIGFLRVTSDGNEAADRKINLVFKQS*
Ga0110931_111319523300007963MarinePAAMTGSALTFDFSIDGTNWYDVVETDGTEVSYTVTAGDAVRVDPSGWAFASSGFIRVTSGSAEAADRSIKLIFRTA*
Ga0110931_121214223300007963MarineDGMLLTGIVFPAAMTGTEVTFDFSVDNTNWYDVVETDGTAVTYTVTAGDVVRVDPSGWAFASSGFIRVTSGSAEAADRSIKLIFRTA*
Ga0102814_1019735413300009079EstuarineGLLLSGIVFPSTMTGSTVTFDFSFDGTNFVDVVETDGTPVSYTVTAGDVVRVDPSGWAFASLGFLRIVSGSSEAADRTINLIFKQS*
Ga0114908_106750913300009418Deep OceanGMLLCGIQYPAAMTGSSVTFDFSMDNSTFVDVKETDGTDVTYSVSAGDMVRVDPSGWAFASNGFIRVTSNGSEAADRSIILHFRHS*
Ga0115545_127667523300009433Pelagic MarineSNVTFDFSYDGSTWVDVVETDGTEVTYVVSAGNVVRVDPSGWAFASIGFLKITSDGNEAADRKINLIFKQS*
Ga0114932_1054084813300009481Deep SubsurfaceMLLCGIQFPAAMTGTAITFDFALDNSTWADVKETDGSAVSYTVSAGDVVRVDPSGWGFASNGYIRLTSNDNEAADRSIVLHFRHS*
Ga0115572_1080291923300009507Pelagic MarineMTGTALTLDFSFDGSTWVDVKETDGTEVSYTVSAGDVVRVDPSGWAFASIGFLRVTSGSSEAADRQINLIFKQS*
Ga0123364_109796023300009754MarineVDVVETDGTAVSYTVTAGDVVRVDPSGWAFATTGSLRVTSDATEAADRKIQLIFKAS*
Ga0129324_1025656113300010368Freshwater To Marine Saline GradientPAAMTGTEVTFDFSVDNTNWYDVVETDGTAVTYTVTAGDVVRVDPSGWAFASSGFIRVTSGSAEAADRSIKLIFRTA*
Ga0129324_1041423723300010368Freshwater To Marine Saline GradientSFDGNTWVDVVETDNTEVTYVVSAGNVVRVDPSGWAFATAGFVRVTSDATEAADRNIQLIFKQS*
Ga0160423_1117337223300012920Surface SeawaterAMTGSNVTFDFAFDGSTWVDVVETDGTEVTYTVSAGNVTRVDPSGWAFASSGYLRITSDGSEAADRKITLIFRAS*
Ga0163180_1060562433300012952SeawaterLLCGIQYPAAMTGSSVTFDFSMDNSTFVDVKETDGTDVTYSVSAGDMVRVDPSGWAFASNGFIRVTSNGSEAADRSIILHFRHS*
Ga0182049_115364223300016736Salt MarshQFPAAMTGSAITFDFSLDNSTWVDVKETDATDTSYTVSAGDVLRVDPSGWAFASNGYIRVTSDGTEAADRSIILHFRHS
Ga0182078_1048015213300016747Salt MarshMLLCGIQFPATMTGTAITFDFSLDNSTWADVKETVGTYVSCTISAGDAVRVDPSGWAFASNGYLRITSNGTEAADRSITVHLRHS
Ga0182053_140648323300016749Salt MarshFPAAMTGSAITFDFSLDNSTWVDVKETDATDTSYTVSAGDVLRVDPSGWACASNGYIRMTSDGTEAADSSIILHFRHS
Ga0182072_109050723300016754Salt MarshMTGANVTFDFSFDGTNWVDVVETDGTEVSYVVTAGDVVRVDPSGWAFASSGYLRITSDAVEAADRTISLIFRTS
Ga0182082_127469113300016771Salt MarshGTTITLDFSLDGTTWVDVFETDGTEVSYTISAGNAIRLDPSGWALASSGYLRVTSDGTEAADRKITLVFRSS
Ga0181403_100121273300017710SeawaterFPAAMTGTAVTFDYSLDETAFYDVVETNGTEVSYTVSAGNVVRVEPNGWYFASAGYLRITSNGTEAADRKITLIFRAS
Ga0181396_102526923300017729SeawaterLTGIIFPAAMTGTAVTFDYSLDETAFYDVVETNGTEVSYTVSAGNVVRVEPNGWYFASAGYLRITSNGTEAADRKITLIFRAS
Ga0181433_111571713300017739SeawaterEFPAAMTGSAVSFDFSMDNSAFIDVKETDGTDVTYSVSAGDMVRVDPSGWAFASNGFIRVTSNGSEAADRSIILHFRHS
Ga0181408_107259213300017760SeawaterLSGIIFPGTMTGTALTVDFSLDGSTWYDVVETDGTEVSYTITAGDAVRVDPSGWAFASSGFVRVTSGSTEAADRKITLIFRAA
Ga0181422_118139113300017762SeawaterPGTMTGTALTVDFSLDGSTWYDVVETDGTEVSYTITAGDAVRVDPSGWAFASSGFVRVTSGSTEAADRKITLIFRAA
Ga0181413_110918413300017765SeawaterGLLLSGIEFPAAMTGSNVTFDFSYDGGTWVDVVETNGTEVTYSVSTGNVVRVDPSGWAFASIGFLRVTSDGNEASDRKINLIFKQS
Ga0181425_109421123300017771SeawaterFDFSVDGSSWVDVVETDGTEVSYTVSAGNATRVDPSGWAFASGGFLRITSDGTEAADRKIKLIFRTA
Ga0181394_114208023300017776SeawaterPAAMTGSNVTFDFSYDGGTWVDVVETNGTEVTYSVSTGNVVRVDPSGWAFASIGFLRVTSDGNEASDRKINLIFKQS
Ga0181423_108531423300017781SeawaterFSIDGTNWYDVVETDGTAVTYTVTAGDVVRVDPSGWAFASIGFIRVTSGSTEAADRSIKLIFRTA
Ga0181424_1021006123300017786SeawaterCDGLLLSGIEFPAAMTGSNVTFDFSYDGGTWVDVVETNGTEVTYSVSTGNVVRVDPSGWAFASIGFLRVTSDGNEASDRKINLIFKQS
Ga0181552_1052736023300017824Salt MarshTFDFSFDGSTWVDVVETDGTEVSYTVSAGNVTRVDPSGWAFATAGFVRVTSDGTEAADREIQLIFKQS
Ga0181584_1029565213300017949Salt MarshITFDYSVDNSSWVDVFETDGTEVSYTISAGNVVRIDPSGWAFASNGYIRVTSDGTEAADRKIKLLFRTA
Ga0181580_1053496213300017956Salt MarshLLSGIVFPAAMTGTAVTFDFSFDGSTWVDVVETDGTEVSYTVSTGNVTRVDPSGWAFASAGFIRVTSNGTEAADRNIQLIFKQS
Ga0181587_1088423723300017968Salt MarshLLCGIQFPATMTGTAITFDFSLDNSTWADVKETDGTDVSYTISAGDAVRVDPSGWAFASNGYLRITSDGTEAADRSITVHLRHS
Ga0181587_1088446723300017968Salt MarshLLCGIQFPATMTGTAITFDFSLDNSTWADVKETDGTDVSYTVSAGDAVRVDPSGWAFASNGYLRITSDGTEAADRSITVHLRHS
Ga0181585_1065367023300017969Salt MarshSGIVFPAAMTGTAVTFDFSVDGTNWYDVKETDGTDVSYTISVGDAVRVDPSGWAFASSGFLRISSDGTEVADRSIKLIFRTA
Ga0181585_1088767313300017969Salt MarshVTFDFSFDGSTWVDVVETDGTEVSYTVSTGNVTRVDPSGWAFASAGFIRVTSNGTEAADRNIQLIFKQS
Ga0181567_1080401133300018418Salt MarshCGIQFPAAMTGSTVTFDFSMDNTTFLDVKETDGTDVSYTVSAGDVVRVDPSGWAFASNGYIRVTSNGTEAADRKIILHFRHS
Ga0181563_1013252513300018420Salt MarshLCGVVFPATMTGTAITFDYSVDNSSWVDVFETDGTEVSYTVSAGNVVRIDPSGWAFASNGYIRVTSDGTEAADRKIKLLFRTA
Ga0181592_1096724313300018421Salt MarshNSTWVDVVETDGTEVTYTVSAGNVTRVDPSGWAFASSGFIRVTSDGTEAADRNITLIFRA
Ga0181568_1037702013300018428Salt MarshVNVENMLLCGVVFPATMTGTTITFDFSVDGSSWIDVFETDGTEVSYTVSADNVVRVDPSGWAFASNGFIRVTSDATEAADRKIKLLFRTA
Ga0182061_101541123300019266Salt MarshVVFPATMTGTAITFDYSVDNSSWVDVFETDGTEVSYTVSAGNVVRIDPSGWAFASNGYIRVTSDGTEAADRKIKLLFRTA
Ga0182069_144326513300019267Salt MarshMLLCGVVFPATMTGTAITFDYSVDNSSWVDVFETDGTEVSYTVSAGNVVRIDPSGWAFASNGYIRVTSDGTEAAD
Ga0182068_133575513300019280Salt MarshMTGTSVTFDFSFDGSTWVDVVETDGTEVTYTVTAGDVVRVDPSGWAFASAGFIRVTSNGTEAADRNIQLIFKQS
Ga0182068_146615523300019280Salt MarshFPATMTGTTITLDFSLDGTTWVDVFETDGTEVSYTISAGNAIRLDPSGWALASSGYLRVTSDGTEAADRNITLVFRSS
Ga0182058_130463323300019283Salt MarshNVENMLLCGIVFPATMTGTAITFDYSVDGSSWIDVFETDGTEVSYTVSADNVVRVDPSGWAFASNGYIRVTSDATEAADRKIKLLFRTA
Ga0206124_1028763123300020175SeawaterTFDFSIDGTNWYDVVETDGTAVTYTVTAGDAVRVDPSGWAFASVGFIRVTSGSAEAADRSIKLIFRTA
Ga0181578_1005142233300020189Salt MarshGTAVTFDFSFDGSTWIDVVETDGTEVTYTVTAGDVVRVDPSGWAFATAGFIRVSSDATELADRNIQLIFKQS
Ga0211542_101180533300020312MarineDGLLLSGIVFPAAMTGTTVTFDFSFDGTNFVDVVETDGTEVSYSVSAGNVVRVDPSGWAFASPGFLRVTSGSNEAADRTINLIFKQS
Ga0211706_105018833300020345MarineAMTRSSITFAFSMNGSTGWMNVHETDGTEVSYTVSAGKMVRVDPSGWAFASNGYIRVLSNGSEAADRNIVLHFRHS
Ga0211527_1018941813300020378MarineAMTGTAVTFDFATDNSTWVDVVETDGTEVSYTVSAGNLVRVDPSGWAFASSGYIRVTSNGSEAADRNINLIFRAS
Ga0211498_1010128813300020380MarineIQFPAAMTGSNISFDFALDNSTWVDVKETDGTDVTYTVSAGDILRVDPSGWAFASNGYIRITSDGNEAADRKLILHFRHS
Ga0211705_1002715613300020395MarineCGIEFPAAMTGSNITFDFSMNGSTGWVDVFETDGSEVSYTVSAGNMVRVDPSGWAFASNGYLRINSDGSEAADRSIVLYFRHS
Ga0211617_1002465313300020401MarineAMTGTAVTFDYSVDGTNFVDIKETDGTEVSYTVSAGDAIRIDPSGWAFAGGGFIRITSGSTEAADRKIKLLFRTA
Ga0211617_1038337713300020401MarineTTVTFDFSFDGTNFVDVVETDGTEVSYSVSAGNVVRVDPSGWAFASTGFLRVVSASSEAADRTINLIFKQS
Ga0211532_1020692823300020403MarineEGMLLCGIQFPAAMTGSNITFDFSLDNSTWVDVKETDGTDTSYTVSAGDILRVDPSGWAFASNGYIRVTSDGTEGADRSIVLHFRHS
Ga0211528_1018901813300020417MarineLDFSFDGTNWVDVFETDGTEVSYTVSAGNAVRVDPSGWAFASSGYLRVTSDGTEAADRNITLIFRTS
Ga0211622_1004546933300020430MarineAMTGSNITFDFSMDNSTFIDVKEADGSDTTVTVSAGDIVRLDPSGFAFASNGFLRVTSDGNEAADRKVILHFRHS
Ga0211554_1016865723300020431MarineINVDNMLLAGIVFPSAMTGANITFDFSVDGSSWVDVVETDGTEVSYTVSAGNATRVDPSGWAFASGGYIRVTSDGTEAADRKIKLIFRTA
Ga0211643_1001444863300020457MarineGSNVTFDYSLDETAFYDVVETDGTEVTYSVSAGNVVRVDPSGWAFASSGYLRITSDGSEAADRKITLIFRAS
Ga0211475_1041466113300020468MarineLCGIQYPAAMTGSSVTFDFSMDNSTFVDVKETDGTDVTYSVSAGDMVRVDPSGWAFASNGFIRVTSNGSEAADRSIILHFRHS
Ga0211577_1070491513300020469MarineDNMLLAGIVFPSAMTGSNITFDFSVDGSSWVDVVETDGTEVSYTVSAGNATRVDPSGWAFASGGYLRITSDGTEAADRKIKLIFRTA
Ga0211614_1040920733300020471MarinePAAMTGTAVTFDFALDNSSWADVKETDGTEVSYTVSAGDVVRVDPSGWAFASNGYIRVTSNGSEAADRKIILHFRHS
Ga0213860_1011581523300021368SeawaterQLDGMLLCGIQFPATMTGTAITFDFSLDNTNWADVKETDGTDVSYTISAGDAVRVDPSGWAFASNGYLRITSDGTEAADRSIIVHLRHS
Ga0213864_1014269823300021379SeawaterATMTGANVTFDFSFDGTNWVDVVETDGTEVSYVVTAGDVVRVDPSGWAFASSGYLRITSDAVEAADRTISLIFRTS
Ga0196883_105074823300022050AqueousKVFPAAMTGANVTFDFSYDGINWKDVVETNNTEVTYVVSAGNVVRVDPSGWAFATAGFLRITSDGTETADRQINLIFKSS
Ga0224899_10090523300022064SeawaterDGLLLSGIEFPAAMTGSNVTFDFSYDGGTWVDVVETDNTEVTYVVSPGNMVRVDPSGWAFAAIGFLRVTSDGNEAADRQINLVFKQS
Ga0212024_104436623300022065AqueousSYDGINWKDVVETNNTEVTYVVSAGNVVRVDPSGWAFATAGFLRITSDGTETADRQINLIFKSS
Ga0212026_107128623300022069AqueousFDFSIDGTNWYDVVETDGTAVTYTVTAGDAVRVDPSGWAFASSGFIRVTSGSAEAADRSIKLIFRTA
Ga0212020_107281523300022167AqueousPAAMTGANVTFDFSFDGTNWVDVVETDNTEVTYVVSAGNVVRVDPSGWAFATAGFVRVTSDGTETADRNIQLIFKQS
Ga0255773_1017222123300022925Salt MarshQFPATMTGSAITFDFSLDNSTWVDVKETDATDTSYTVSAGDVLRVDPSGWAFASNGYIRITSDGTEAADRSIILHFRHS
Ga0255780_1029717913300022935Salt MarshFPAAMTGTAVTFDFSFDGSTWVDVVETDGTEVTYTVTAGDVVRVDPSGWAFATAGFIRVSSDATELADRNIQLIFKQS
Ga0255751_1048490423300023116Salt MarshGNTWVDVVETDNTEVTYVVSAGNVVRVDPSGWAFATAGFIRVTSDGTETADRNIQLIFKQ
Ga0255761_1030366213300023170Salt MarshMTGANVTFDFSFDGTNWVDVVETDNTEVTYVVSAGNVVRVDPSGWAFATAGFIRVTSDATEAADRNIQLIFKQS
Ga0255761_1055472013300023170Salt MarshFDFSVDGTNWYDVKETDGTDVSYTISVGDAVRVDPSGWAFASSGFLRISSDGTEVADRSIKLIFRTA
Ga0255768_1064183233300023180Salt MarshGIVFPSAFTGSTITFDYSVDGSNWVDVFETDGTEVSYTVSADNVVRVDPSGWAFASNGYIRVTSSGTEAADRKIKLIFRTA
Ga0244775_1074478313300024346EstuarineCGIQFPAAMTGTAITFDYSMDNSTFVDVKETDGTEVSYTVSAGDMVRVDPSGWAFASNGYIRVSSNGTEAADRKIILHFRHS
Ga0208791_102848113300025083MarineGLLLSGIEFPAAMTGSNVTFDFSYDGSTWVDVVETDGTEVTYVVSAGNVVRVDPSGWAFASIGFLKVTSDGNEAADRKINLIFKQS
Ga0208158_114080423300025110MarineFPAAMTGSNITFDFSMNGSTGWVDVFETDGTEVSYTVSAGNMLRVDPSGWAFASNGYIRITSDGNEAADRKITLHFRNS
Ga0208162_103541933300025674AqueousVVETDNTEVTYTVSPGNVVRVDPSGWAFATAGFIRVTSDGTEAADRNIQLIFKQS
Ga0208162_109890223300025674AqueousGTSVTFDFSFNGTNWVDVVETDNTEVTYTVSPGNVVRVDPSGWAFATAGFVRVTSDDTETADRNIVLIFKQS
Ga0209305_119518423300025712Pelagic MarineELTFDFSIDGTNWYDVVETDGTAVTYTVTAGDAVRVDPSGWAFASSGFIRVTSGSAEAADRNIKLIFRTA
Ga0208899_119074723300025759AqueousCGIQFPATMTGSAITFDFALDNSTWVDVKETDGTDTSYTVSAGDVLRVDPSGWAFASNGYIRITSDGTEAADRSIILHFRHS
Ga0208425_109585323300025803AqueousAMTGSNITFDYSIDNTNWVDVVETDGTEVTYVVSVGNIQRLDPSGWAFAGEGWLRITSDGTEAADRTLKVYTRHS
Ga0208425_111012613300025803AqueousDGMLLTGIIFPATMTGTAVTFDYSLDESTWYDVVETDGTEVSYTVSAGNVTRVDPSGWAFASSGYIRISSGSAEAADRKITLIFRAS
Ga0208542_100388283300025818AqueousFSVDNTNWYDVVETDGTAVTYTVTAGDVVRVDPSGWAFASSGFIRVTSGSAEAADRSIKLIFRTA
Ga0208645_105128433300025853AqueousSFDGTNWVDVVETDNTEVTYVVSAGNVVRVDPSGWAFATAGFVRVTSDGTETADRNIQLIFKQS
Ga0209962_108013713300026125WaterLLCGIQFPATMTGTNVTFDFSMDNSTWVDVTETDGTAVTYVVTAGDMVRVDPSGWAFAAIGFLRVTSDGNEAADRKINLVFKQS
Ga0209951_111381523300026138Pond WaterSFDGTAWKDVVETDNTEVSYVVSADNVVRVDPSGWAFASSGFLRVTSDGTETTDKAIQLIFKSS
Ga0208408_115797013300026260MarineMTGSNITFDFSMNGSTGWVDVFETDGTEVSYTVSAGNMVRVDPSGWAFASNGYLRINSDGSEAADRSIVLYFRHS
(restricted) Ga0233415_1009272023300027861SeawaterLLCGIQFPAAMTGSNITFDFSMDNSTWVDVTETDGTAVTYVVTAGDMVRVDPSGWAFASNGYIRVTSDGNEAADRSLTLHFRHS
(restricted) Ga0233415_1023897113300027861SeawaterTFDFSFDGAAWKDVVETDNTEVTYVVSADNVVRVDPSGWAFATAGFLRVTSDGTETADKAIQLIFKSS
Ga0209536_10262233513300027917Marine SedimentILFPATMTGANVTFDFSFDGSTWVDVVETDGTEVSYVVTAGDVVRVDPSGWAFASSGYLRITSDAVEAADRTISLIFRTS
Ga0257114_123569323300028196MarineFDGAAWKDVVETDNTEVTYVVSADNVVRVDPSGWAFASSGFIRVTSDGTETADKAIQLIFKSS
Ga0257110_117508623300028197MarineMTGSAVTFDFSFDGINFVDVVETDGTPVSYTVTAGDVVRVDPSGWAFAAAGFLRVVSGSSEAADRTINLIFKQS
Ga0183748_104883213300029319MarineSTWVDVVETDGTEVTYTVSAGNVTRVDPSGWAFATAGSVRVTSDGTEAADREIQLIFKQS
Ga0315316_10005999153300032011SeawaterSGIVFPAAMTGATVTFDFSFNGTTWYDVVETDGTEVSYTVSAGNVVRVDPSGWAFASPGFLRVTSSNSEAADRTINLIFKQS


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.