NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F082771

Metagenome / Metatranscriptome Family F082771

Go to section:
Overview Alignments Structure & Topology Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F082771
Family Type Metagenome / Metatranscriptome
Number of Sequences 113
Average Sequence Length 106 residues
Representative Sequence MIAKWQWHIGEINKHYDSPHSDRRMPADHKKNYVRYSNFHQIRRNKRVSMIHTNWWCRDQNFRKYFEMRKRHDIKPALSGFYHDDIYENTLSKNTEWAAMRASQQPR
Number of Associated Samples 99
Number of Associated Scaffolds 113

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Eukaryota
% of genes with valid RBS motifs 55.75 %
% of genes near scaffold ends (potentially truncated) 40.71 %
% of genes from short scaffolds (< 2000 bps) 100.00 %
Associated GOLD sequencing projects 94
AlphaFold2 3D model prediction Yes
3D model pTM-score0.28

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Eukaryota (100.000 % of family members)
NCBI Taxonomy ID 2759
Taxonomy All Organisms → cellular organisms → Eukaryota

Most Common Ecosystem
GOLD Ecosystem Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine
(32.743 % of family members)
Environment Ontology (ENVO) Unclassified
(46.903 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Saline → Water (saline)
(77.876 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 37.04%    β-sheet: 5.93%    Coil/Unstructured: 57.04%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  		pTM-score: 0.28
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms100.00 %
UnclassifiedrootN/A0.00 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300001822|ACM39_100852All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea732Open in IMG/M
3300001828|ACM3_1011602All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea553Open in IMG/M
3300003621|JGI26083J51738_10138341All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea504Open in IMG/M
3300003802|Ga0007840_1014085All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea521Open in IMG/M
3300004112|Ga0065166_10183898All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Hypotrichia → Euplotida → Euplotidae → Euplotes → Euplotes harpa815Open in IMG/M
3300004777|Ga0007827_10070094All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea801Open in IMG/M
3300004836|Ga0007759_11000659All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea689Open in IMG/M
3300005516|Ga0066831_10072811All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea929Open in IMG/M
3300006107|Ga0007836_1056447All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea863Open in IMG/M
3300006356|Ga0075487_1464751All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea639Open in IMG/M
3300006373|Ga0075483_1119402All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea555Open in IMG/M
3300006383|Ga0075504_1354878All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea669Open in IMG/M
3300006397|Ga0075488_1502162All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea727Open in IMG/M
3300006803|Ga0075467_10314419All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea831Open in IMG/M
3300007513|Ga0105019_1178853All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1072Open in IMG/M
3300009142|Ga0102885_1138791All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea592Open in IMG/M
3300009432|Ga0115005_10471934All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea999Open in IMG/M
3300009432|Ga0115005_11770602All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea507Open in IMG/M
3300009436|Ga0115008_10376213All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1008Open in IMG/M
3300009436|Ga0115008_11171866All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea581Open in IMG/M
3300009436|Ga0115008_11344921All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea547Open in IMG/M
3300009436|Ga0115008_11536985All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea516Open in IMG/M
3300009441|Ga0115007_10331330All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea990Open in IMG/M
3300009441|Ga0115007_10913162All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea599Open in IMG/M
3300009441|Ga0115007_11200382All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea528Open in IMG/M
3300009593|Ga0115011_10838883All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea764Open in IMG/M
3300009599|Ga0115103_1047418All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea761Open in IMG/M
3300009599|Ga0115103_1658915All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea878Open in IMG/M
3300009599|Ga0115103_1682079All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea707Open in IMG/M
3300009606|Ga0115102_10619133All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea743Open in IMG/M
3300009677|Ga0115104_11219994All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea632Open in IMG/M
3300010985|Ga0138326_10174064All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea694Open in IMG/M
3300012036|Ga0136600_1066592All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea821Open in IMG/M
3300012920|Ga0160423_10814113All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea628Open in IMG/M
3300012952|Ga0163180_11407467All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea579Open in IMG/M
3300012953|Ga0163179_10862639All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea780Open in IMG/M
3300013296|Ga0157374_10913480All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Hypotrichia → Euplotida → Euplotidae → Euplotes → Euplotes harpa896Open in IMG/M
3300016751|Ga0182062_1518424All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea502Open in IMG/M
3300018423|Ga0181593_11164713All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Hypotrichia → Euplotida → Euplotidae → Euplotes → Euplotes harpa522Open in IMG/M
3300018628|Ga0193355_1012964All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea757Open in IMG/M
3300018871|Ga0192978_1057226All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea727Open in IMG/M
3300018871|Ga0192978_1062113All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea694Open in IMG/M
3300018899|Ga0193090_1096132All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea678Open in IMG/M
3300018980|Ga0192961_10103217All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea864Open in IMG/M
3300018982|Ga0192947_10134113All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea827Open in IMG/M
3300018989|Ga0193030_10100461All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea888Open in IMG/M
3300018989|Ga0193030_10140356All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea776Open in IMG/M
3300019021|Ga0192982_10268671All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea612Open in IMG/M
3300019022|Ga0192951_10178760All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea766Open in IMG/M
3300019031|Ga0193516_10222860All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea620Open in IMG/M
3300019032|Ga0192869_10209021All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea833Open in IMG/M
3300019048|Ga0192981_10192004All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea799Open in IMG/M
3300019048|Ga0192981_10192789All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea797Open in IMG/M
3300019048|Ga0192981_10219315All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea737Open in IMG/M
3300019050|Ga0192966_10201607All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea711Open in IMG/M
3300019050|Ga0192966_10219545All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea679Open in IMG/M
3300019051|Ga0192826_10265288All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea631Open in IMG/M
3300019123|Ga0192980_1045892All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea835Open in IMG/M
3300019149|Ga0188870_10088964All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea748Open in IMG/M
3300019272|Ga0182059_1551661All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea506Open in IMG/M
3300020382|Ga0211686_10322813All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea631Open in IMG/M
3300020732|Ga0214201_1053113All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea591Open in IMG/M
3300021169|Ga0206687_1120065All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea780Open in IMG/M
3300021342|Ga0206691_1869543All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea656Open in IMG/M
3300021350|Ga0206692_1568773All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea681Open in IMG/M
3300021359|Ga0206689_10727711All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea698Open in IMG/M
3300021869|Ga0063107_105946All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea795Open in IMG/M
3300021874|Ga0063147_140062All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea507Open in IMG/M
3300021889|Ga0063089_1055612All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea645Open in IMG/M
3300021902|Ga0063086_1011951All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea683Open in IMG/M
3300021905|Ga0063088_1022540All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea648Open in IMG/M
3300021911|Ga0063106_1040485All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea535Open in IMG/M
3300021921|Ga0063870_1040599All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea590Open in IMG/M
3300021925|Ga0063096_1023255All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea674Open in IMG/M
3300021927|Ga0063103_1008059All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea715Open in IMG/M
3300021927|Ga0063103_1043617All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea731Open in IMG/M
3300021930|Ga0063145_1026420All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea731Open in IMG/M
3300021940|Ga0063108_1074799All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea569Open in IMG/M
3300021950|Ga0063101_1087405All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea666Open in IMG/M
3300021959|Ga0222716_10727855All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea523Open in IMG/M
3300024348|Ga0244776_10897321All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea525Open in IMG/M
3300025620|Ga0209405_1170658All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea541Open in IMG/M
3300025684|Ga0209652_1174880All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea542Open in IMG/M
3300025781|Ga0208386_1051189All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea555Open in IMG/M
3300026182|Ga0208275_1040237All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea950Open in IMG/M
3300026447|Ga0247607_1078256All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea584Open in IMG/M
3300026465|Ga0247588_1065527All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea719Open in IMG/M
3300026495|Ga0247571_1142981All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea563Open in IMG/M
3300027810|Ga0209302_10240469All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea855Open in IMG/M
3300027833|Ga0209092_10238027All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1008Open in IMG/M
3300028109|Ga0247582_1095613All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea776Open in IMG/M
3300028110|Ga0247584_1162558All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea548Open in IMG/M
3300028137|Ga0256412_1194225All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea750Open in IMG/M
3300028233|Ga0256417_1119289All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea710Open in IMG/M
3300028282|Ga0256413_1246079All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea636Open in IMG/M
3300028290|Ga0247572_1090318All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea752Open in IMG/M
3300028333|Ga0247595_1054963All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea661Open in IMG/M
3300028412|Ga0306910_1032579All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea837Open in IMG/M
3300031398|Ga0307979_1089186All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea710Open in IMG/M
3300031522|Ga0307388_10510748All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea791Open in IMG/M
3300031558|Ga0308147_1044751All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea559Open in IMG/M
3300031710|Ga0307386_10429849All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea683Open in IMG/M
3300031729|Ga0307391_10572350All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea638Open in IMG/M
3300031734|Ga0307397_10386653All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea644Open in IMG/M
3300031738|Ga0307384_10531062All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea559Open in IMG/M
3300031739|Ga0307383_10330844All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea741Open in IMG/M
3300031750|Ga0307389_10595870All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea715Open in IMG/M
3300032047|Ga0315330_10846568All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea521Open in IMG/M
3300032150|Ga0314779_1024168All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea598Open in IMG/M
3300032520|Ga0314667_10510423All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea668Open in IMG/M
3300032521|Ga0314680_10637220All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea673Open in IMG/M
3300032755|Ga0314709_10562647All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea693Open in IMG/M
3300033572|Ga0307390_10523261All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea735Open in IMG/M


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
MarineEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Marine32.74%
MarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Marine22.12%
SeawaterEnvironmental → Aquatic → Marine → Coastal → Unclassified → Seawater8.85%
SeawaterEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Seawater5.31%
AqueousEnvironmental → Aquatic → Marine → Coastal → Unclassified → Aqueous4.42%
FreshwaterEnvironmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater3.54%
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake2.65%
SeawaterEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Seawater2.65%
Salt MarshEnvironmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh2.65%
Marine PlanktonEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Marine Plankton1.77%
MarineEnvironmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine1.77%
EstuarineEnvironmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine1.77%
Saline LakeEnvironmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Saline Lake1.77%
FreshwaterEnvironmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater0.89%
SedimentEnvironmental → Aquatic → Freshwater → Lake → Sediment → Sediment0.89%
Surface SeawaterEnvironmental → Aquatic → Marine → Oceanic → Photic Zone → Surface Seawater0.89%
MarineEnvironmental → Aquatic → Marine → Coastal → Unclassified → Marine0.89%
SeawaterEnvironmental → Aquatic → Marine → Intertidal Zone → Unclassified → Seawater0.89%
Estuarine WaterEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water0.89%
Pelagic MarineEnvironmental → Aquatic → Marine → Pelagic → Unclassified → Pelagic Marine0.89%
Saline WaterEnvironmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Saline Water0.89%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.89%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300001822Marine plankton microbial communities from the Amazon River plume, Atlantic Ocean - ACM39, ROCA_DNA108_2.0um_23aEnvironmentalOpen in IMG/M
3300001828Marine plankton microbial communities from the Amazon River plume, Atlantic Ocean - ACM3, ROCA_DNA076_2.0um_10fEnvironmentalOpen in IMG/M
3300003621Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - ESP_85LU_5_DNAEnvironmentalOpen in IMG/M
3300003802Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE29Oct07EnvironmentalOpen in IMG/M
3300004112Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.SD (version 2)EnvironmentalOpen in IMG/M
3300004777Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE16Jul07EnvironmentalOpen in IMG/M
3300004836Metatranscriptome of freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM15.DN (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300005516Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201306PF49BEnvironmentalOpen in IMG/M
3300006107Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE23Oct07EnvironmentalOpen in IMG/M
3300006356Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_30_>0.8_RNA1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006373Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_15_>0.8_RNA1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006383Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_D_>0.8_RNA1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006397Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_30_>0.8_RNA2 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006803Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_20_>0.8_DNAEnvironmentalOpen in IMG/M
3300007513Marine water column microbial communities of the permanently stratified Cariaco Basin, Venezuela, November cruise - 237m, 250-2.7um, replicate bEnvironmentalOpen in IMG/M
3300009142Estuarine microbial communities from the Columbia River estuary - metaG 1550B-3EnvironmentalOpen in IMG/M
3300009432Marine eukaryotic phytoplankton communities from Arctic Ocean - Arctic Ocean - Greenland ARC118M MetagenomeEnvironmentalOpen in IMG/M
3300009436Marine eukaryotic phytoplankton communities from Arctic Ocean - Fram Strait ARC3M MetagenomeEnvironmentalOpen in IMG/M
3300009441Marine eukaryotic phytoplankton communities from Arctic Ocean - Arctic Ocean ARC135M MetagenomeEnvironmentalOpen in IMG/M
3300009593Marine eukaryotic phytoplankton communities from Atlantic Ocean - Tropical Atlantic ANT8 MetagenomeEnvironmentalOpen in IMG/M
3300009599Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - MBTS_5May14_M1_3um Metatranscriptome (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300009606Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - MBTS_5May14_M2_3um Metatranscriptome (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300009677Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - CN13ID_70_C50_10m_0.8um Metatranscriptome (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300010985Metatranscriptome of Marine eukaryotic phytoplankton communities from the Antarctic Ocean - ANT-7 (Eukaryote Community Metatranscriptome) (version 8)EnvironmentalOpen in IMG/M
3300012036Saline lake microbial communities from Rauer Islands, Antarctica - Metagenome Filla 2 #698EnvironmentalOpen in IMG/M
3300012920Marine microbial communities from the Costa Rica Dome - CRUD Field 142mm St8 metaGEnvironmentalOpen in IMG/M
3300012952Marine eukaryotic phytoplankton communities from the Atlantic Ocean - Atlantic ANT 4 MetagenomeEnvironmentalOpen in IMG/M
3300012953Marine eukaryotic phytoplankton communities from the Atlantic Ocean - Atlantic ANT 2 MetagenomeEnvironmentalOpen in IMG/M
3300013296Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaGHost-AssociatedOpen in IMG/M
3300016751Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 101408BT metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300018423Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071413AT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300018628Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_111 - TARA_N000001820 (ERX1782125-ERR1711885)EnvironmentalOpen in IMG/M
3300018871Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_085 - TARA_N000001026 (ERX1789475-ERR1719345)EnvironmentalOpen in IMG/M
3300018899Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_085 - TARA_N000001029 (ERX1809754-ERR1740133)EnvironmentalOpen in IMG/M
3300018980Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_083 - TARA_N000001372 (ERX1782312-ERR1712127)EnvironmentalOpen in IMG/M
3300018982Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_082 - TARA_N000001384 (ERX1782271-ERR1711935)EnvironmentalOpen in IMG/M
3300018989Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_152 - TARA_N000002803 (ERX1782326-ERR1711934)EnvironmentalOpen in IMG/M
3300019021Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_085 - TARA_N000001034 (ERX1782268-ERR1711957)EnvironmentalOpen in IMG/M
3300019022Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_082 - TARA_N000001390 (ERX1782474-ERR1712194)EnvironmentalOpen in IMG/M
3300019031Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_142 - TARA_N000003104 (ERX1782386-ERR1711939)EnvironmentalOpen in IMG/M
3300019032Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_066 - TARA_N000000805 (ERX1782188-ERR1712216)EnvironmentalOpen in IMG/M
3300019048Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_085 - TARA_N000001030 (ERX1782209-ERR1712166)EnvironmentalOpen in IMG/M
3300019050Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_084 - TARA_N000001438 (ERX1782371-ERR1711865)EnvironmentalOpen in IMG/M
3300019051Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_040 - TARA_N000000064 (ERX1782232-ERR1712227)EnvironmentalOpen in IMG/M
3300019123Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_085 - TARA_N000001030 (ERX1782390-ERR1712195)EnvironmentalOpen in IMG/M
3300019149Metatranscriptome of marine microbial communities from Baltic Sea - GS695_3p0_dTEnvironmentalOpen in IMG/M
3300019272Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 101405AT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300020382Marine microbial communities from Tara Oceans - TARA_B100000780 (ERX556058-ERR599059)EnvironmentalOpen in IMG/M
3300020732Freshwater microbial communities from Trout Bog Lake, WI - 29MAY2009 epilimnionEnvironmentalOpen in IMG/M
3300021169Metatranscriptome of ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 30m 12015 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021342Metatranscriptome of ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 500m 12015 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021350Metatranscriptome of ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M2 40m 12015 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021359Metatranscriptome of ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 100m 12015 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021869Metatranscriptome of marine eukaryotic phytoplankton communities from the Arctic Ocean - ARK-135M (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021874Metatranscriptome of Marine eukaryotic phytoplankton communities from the Atlantic Ocean - Stratiphyt 2011 S32 C1 B24 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021889Metatranscriptome of marine eukaryotic phytoplankton communities from the Arctic Ocean - ARK-3S (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021902Metatranscriptome of marine eukaryotic phytoplankton communities from the Arctic Ocean - ARK-1S (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021905Metatranscriptome of marine eukaryotic phytoplankton communities from the Arctic Ocean - ARK-2S (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021911Metatranscriptome of marine eukaryotic phytoplankton communities from the Arctic Ocean - ARK-132S (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021921Metatranscriptome of marine eukaryotic phytoplankton communities from Norwegian Sea - 10m ARK-5M ARK-5-3 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021925Metatranscriptome of marine eukaryotic phytoplankton communities from the Arctic Ocean - ARK-51M (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021927Metatranscriptome of marine eukaryotic phytoplankton communities from the Arctic Ocean - ARK-122M (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021930Metatranscriptome of Marine eukaryotic phytoplankton communities from the Atlantic Ocean - Stratiphyt 2011 S29 C1 B24 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021940Marine eukaryotic phytoplankton communities from the Arctic Ocean - ARK-149 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021950Metatranscriptome of marine eukaryotic phytoplankton communities from the Arctic Ocean - ARK-118M (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021959Estuarine water microbial communities from San Francisco Bay, California, United States - C33_13DEnvironmentalOpen in IMG/M
33000243480.2um to 3um size fraction coassemblyEnvironmentalOpen in IMG/M
3300025620Pelagic marine microbial communities from North Sea - COGITO_mtgs_110516 (SPAdes)EnvironmentalOpen in IMG/M
3300025684Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - ESP_74LU_5_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300025781Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH16Oct07 (SPAdes)EnvironmentalOpen in IMG/M
3300026182Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201306PF49B (SPAdes)EnvironmentalOpen in IMG/M
3300026447Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 125R_r (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300026465Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 48R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300026495Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 24R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300027810Marine eukaryotic phytoplankton communities from Arctic Ocean - Arctic Ocean ARC135M Metagenome (SPAdes)EnvironmentalOpen in IMG/M
3300027833Marine eukaryotic phytoplankton communities from Arctic Ocean - Fram Strait ARC3M Metagenome (SPAdes)EnvironmentalOpen in IMG/M
3300028109Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 41R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300028110Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 43R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300028137Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - WCR_74 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300028233Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - MB_1026D (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300028282Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - WCR_77 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300028290Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 25R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300028333Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 60R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300028412Saline lake microbial communities from Rauer Islands, Antarctica - Metagenome Filla 2 #698 (v2)EnvironmentalOpen in IMG/M
3300031398Marine microbial communities from Ellis Fjord, Antarctic Ocean - #1058EnvironmentalOpen in IMG/M
3300031522Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean ? PS103-3.R2 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031558Metatranscriptome of marine microbial communities from Western Arctic Ocean, Canada - CBN3_325_SCM (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031710Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean ? PS103-2.R3 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031729Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean ? PS103-4.R2 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031734Metatranscriptome of marine eukaryotic phytoplankton communities from Antarctic Ocean - PS103-7 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031738Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean ? PS103-2.R1 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031739Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean ? PS103-1.R3 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031750Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean ? PS103-3.R3 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032047Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 40m 34915EnvironmentalOpen in IMG/M
3300032150Metatranscriptome of sea-ice brine viral communities from Beaufort Sea near Barrow, Alaska, United States - SB 2018 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300032520Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Amb1_24May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032521Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red3_22May_deep (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032755Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Shad10_28May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300033572Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean ? PS103-4.R1 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
ACM39_10085223300001822Marine PlanktonMMGRWRWAIGETNRHYDNPHTDRRFPADRKKNYVRYSNFHQMRRNKRVSMIHTNWWCRDQNFRKYFEMRKRHDFKPALSGFYHEALYEEVAKQNAGIAAMRASQKAK*
ACM3_101160223300001828Marine PlanktonMMSKWRWAIGETNRHYDNPHTDRRFPADRKKNYVRYSNFHQMRRNKRVSMIHTNWWCRDQNFRKYFEMRKRHDIKPALSGFYHEPIYKDSVAKNQALIDMRASQQPR*
JGI26083J51738_1013834113300003621MarineLYLLTKQKKEGMIAKWKWHIGEVNKHYDSPHSDRRFPADRKKNYVRYSNFHQIRRNKRISMIHTNWWCRDQNFRKYFDMRKRHGIEPSMSGFYHEPLYEETLKKNTEWAALRASQQAR*
Ga0007840_101408513300003802FreshwaterMIAKWKWHIGEINKHYDSPHADRRFPADRHKNYVRYTNFHQIRRNKKIGMIHTNWWCRDQNFRKYFDMRKRHDIKPAMXGFYHXPLYQQTLQKNTEWAALRASRESR*
Ga0065166_1018389823300004112Freshwater LakeMIEHWRYRLGEVSKQHGAPHRDRRFPVDRKKNYVRYSNFHQTRRNKRLNMIWTNWWCRDQNFRKYFEMRKRHGIRPALSGFYHE*
Ga0007827_1007009413300004777FreshwaterMIAKWKWHIGEINKHYDSPHADRRFPADRHKNYVRYTNFHQIRRNKKIGMIHTNWWCRDQNFRKYFDMRKRHDIKPAMSGFYHEPLYQQTLQKNTEWAALRASRESR*
Ga0007759_1100065913300004836Freshwater LakeMSKWRWHIGEINKHYDSPHADRRFPVDRHKNYVRYTNFHQVRRNKRVGMIHTNWWCRDQNFRKYFDMRKRHDIKPSMSGFYHEPLYEQTLKKNTEWAALRASRES
Ga0066831_1007281113300005516MarineMNKWRWHIGENNKHYDGPHSDRRFPADRKKNYVRYTNFHQVRRNKRVSMIHTNWWCRDQNFRKYFDMRKRHGISPAMSGFYHEPLYAATLAKNTEWANLRASKVSR*
Ga0007836_105644723300006107FreshwaterMIAKWKWHIGEINKHYDSPHADRRFPADRHKNYVRYTNFHQIRRNKKIGMIHTNWWCRDQNFRKYFDMRKRHDIKPAMSGFYHEPLYQQTLQNNTEWAALRASRESR*
Ga0075487_146475123300006356AqueousMMNKWRWHIGENNKHYDGPHSDRRFPVDRKKNYVRYSNAHQIRRAKRVSMIHTNWWCRDQNFRKYFDMRKRHDLRPALSGFYHEPILAKTTQQNQEWATLRASQNSR*
Ga0075483_111940223300006373AqueousMIAKWRWHIGENNKHYDSSHSDRRFPVDRHKNYVRYTNFHQYLLNKRVSMIHTNWWCRDQVFRKYFDMRKKNGIEPSMKGFYHDDLYEKTLAQNTEWAQVRASK
Ga0075504_135487813300006383AqueousMIAKWRWHIGENNKHYDSSHSDRRFPVDRHKNYVRYTNFHQYLRNKRVSMIHTNWWCRDQVFRKYFDMRKKNGIEPSMKGFYHDDLYEKTLALNTEWAQVRASKSML*
Ga0075488_150216223300006397AqueousMMNKWRWHIGENNKHYDGPHSDRRFPVDRKKNYVRYSNAHQIRRAKRVSMIHTNWWCRDQNFRKYFDMRKRHDLRPALSGFYHEPILAKTTQQNQEWAALRASQNSR*
Ga0075467_1031441913300006803AqueousVFLIWHLYQSFVLYLLTKQKKEGMINKWKWHIGEVNKFYDSPHSDRRFPVDRKKNYVRYSNFHQIRRNKRISMIHTNWWCRDQNFRKYFDMRKRHDIKPAMSGFYHEPLYEDTMKRNNEWAALRASQASR*
Ga0105019_117885313300007513MarineMKKESMMNKWRWHIGENNKHYDGPHSDRRFPVDRKKNYVRYSNIHQVRRNKRVSMIHTNWWCRDQNFRKYFDMRKRHDIRPALSGFYHEPIFAKSQAANQAWADLRATKSSR*
Ga0102885_113879123300009142EstuarineMIAKWQWHIGEINKHYDSPHSDRRMPADHKKNYVRYSNFHKTLRNKRVSMIHTNWWCRDQNFRKYFEMRKRHNIKPAISGFYHDSLYEETLAKNKEWAALRQTRSAR*
Ga0115005_1047193413300009432MarineMIAKWKWHIGEVNKHYDAPHTDRRMPADRKKNYVRYSNFHQIRRNKRISMIHTNWWCRDQNFRKYFDMRKKNGIEPGFSGFKHEELYDATMKKNTEWANLRASKAAR*
Ga0115005_1177060213300009432MarineMIAKWQWHIGEINKHYDSPHSDRRMPADHKKNYVRYSNFHQIRRNKRVSMIHTNWWCRDQNFRKYFEMRKRHGVAPAISGFYHDDIYENTLQENTKWAAMRASQQPR*
Ga0115008_1037621323300009436MarineMKKENMMNKWRWHIGENNKHYDGPHSDRRLPADRKKNYVRYSNVHQVRRNKRVSMIHTNWWCRDQNFRKYFDMRKRNDVKPALSGFAHEPIFEKSNAQNQAWADLRSTRVSR*
Ga0115008_1117186613300009436MarineMIAKWQWHIGEINKHYDSPHSDRRMPADHKKNYVRYSNFHQIRRNKRVSMIHTNWWCRDQNFRKYFEMRKRHDIAPAISGFYHDDIYAETLSKNTQWAALRASQQPR*
Ga0115008_1134492123300009436MarineMIAKWQWHIGEINKHYDSPHSDRRMPADHKKNYVRYSNFHQTLRNKRVSMIHTNWWCRDQNFRKYFEMRKRHDIAPAISGFYHDDIYANTLSKNTEWAAMRASQQPR*
Ga0115008_1153698513300009436MarineYVFLIWHLYQSFILYLLTKQKKEGMIAKWKWHIGEVNKHYDAPHTDRRMPADRKKNYVRYSNFHQIRRNKRISMIHTNWWCRDQNFRKYFDMRKKNGIEPGFSGFKHEELYDATMKKNTEWANLRASKAAR*
Ga0115007_1033133023300009441MarineMTKMKKENMMNKWRWHIGENNKHYDGPHSDRRFPADRKKNYVRYSNLHQVRRNKRVSMIHTNWWCRDQNFRKYFDMRKRHDIRPALSGFYHEPIYAKSQAANQAWADLRASKVSR*
Ga0115007_1091316223300009441MarineMKKENMMNKWRWHIGENNKHYDGPHSDRRLPADRKKNYVRYSNVHQVRRNKRVSMIHTNWWCRDQNFRKYFDMRKRNDVKPALTGFAHEPIYEESTRKNQAWADLRSSRVSR*
Ga0115007_1120038213300009441MarineAKWRWHIGENNKHYDSSHSDRRFPVDRHKNYVRYTNFHQYLRNKRVSMIHTNWWCRDQVFRKYFDMRKRNGIAPSMSGFYHDDLYEKTLAKNSEWARVRASKSML*
Ga0115011_1083888313300009593MarineMKKEGMMNKWRWHIGENNKHYDGPHSDRRFPVDRKKNYVRYSNAHQIRRPKRVSMIHTNWWCRDQNFRKYFDMRKRNDIRPALSGFKHEEIFQRSQEQNETW
Ga0115103_104741823300009599MarineMIAKWQWHIGEINKHYDSPHSDRRMPADHKKNYVRYSNFHQIRRNKRVSMIHTNWWCRDQNFRKYFEMRKRHEIAPALSGFYHDDIYENTLQ*
Ga0115103_165891523300009599MarineMIAKWRWHIGENNKHYDSSHSDRRFPVDRHKNYVRYTNFHQYLRNKRVSMIHTNWWCRDQVFRKYFDMRKKHGIAPSMSGFYHDDLYEKTLQQNSEWARVRASKSML*
Ga0115103_168207913300009599MarineMIAKWKWHIGENNRHYDSPHSDRRFPVDRHKNYVRYTNPHQVLRNKRISMIHTNWWCRDQVFRKYFDMRKRHGIKPALSGFAHEEIYDKTLAQNTEWAKIRASKNMQ*
Ga0115102_1061913313300009606MarineMKKENMMNKWRWHIGENNKHYDGPHSDRRFPVDRKKNYVRYSNAHQIRRAKRVSMIHTNWWCRDQNFRKYFDMRKRHDLRPALSGFYHEPILAKTTQQNQEWAALRASQNSR*
Ga0115104_1121999423300009677MarineMKKENMMNKWRWAIGENNKHYDGPHSDRRFPANRQKNYIRYSNPHQVRRNKRVSMIHTNWWCRDQNFRKYFDMRKRHDMKPAMSGFYHEKLYDATMKQNRDWAALRASQQ
Ga0138326_1017406413300010985MarineMKKENMMNKWRWHIGENNKHYDGPHSDRRFPVDRKKNYVRYSNAHQIRRPKRVSMIHTNWWCRDQNFRKYFDMRKRHDIRPALSGFYHEPILAKTEEQNAAWAALRASQSSR
Ga0136600_106659213300012036Saline LakeMWHNGEVNKYYGAPNQLRMPADRKKNYVRYSNFHQVRKNKKTSMIHTNWWCRDQNFRKYFDMRKRHDIKPSISGFYHDGLYTNAVEKNTEWASLRASRSSR*
Ga0160423_1081411313300012920Surface SeawaterMKKEGMMNKWRWHIGENNKHYDGPHSDRRFPVDRKKNYVRYSNAHQIRRPKRVSMIHTNWWCRDQNFRKYFDMRKKNGIEPGFSGFKHEELYDATMKKNTEWANLRASKAAR*
Ga0163180_1140746713300012952SeawaterYSIPSIARSRGFQNHQTLTILLTKMKKENMMNKWRWHIGENNKHYDGPHSDRRFPADRKKNYIRYSNIHQVRRNKRVSMIHTNWWCRDQNFRKYFDMRKRHDIRPALSGFYHEPIFAKSQAANQAWADLRASRVSR*
Ga0163179_1086263923300012953SeawaterMKKENMMNKWRWHIGENNKHYDGPHSDRRFPVDRKKNYVRYSNAHQIRRPKRVSMIHTNWWCRDQNFRKYFDMRKRHDLRPALSGFYHDPIFASTQAQNQ*
Ga0157374_1091348023300013296Miscanthus RhizosphereMIIEKEKMIEHWRYRLGETNKKHTAGHRDRRFPVDRKKNYVRYSNFHQARRNKRLNMIWTNWWCRDQNFRKYFEMRKRHGIRPSLSGFYHE*
Ga0182062_151842413300016751Salt MarshKKENMIAKWRWHIGENNKHYDSSHSDRRFPVDRHKNYVRYTNFHQYLRNKRVSMIHTNWWCRDQVFRKYFDMRKKNGVEPSMSGFYHDDLYEKTLQQNTEWARVRASKSML
Ga0181593_1116471313300018423Salt MarshGENNKHYDSSHSDRRFPADRHKNYVRYTNFHQYLRNKRVSMIHTNWWCRDQVFRKYFDMRKKHGIEPSMKGFYHDDLYEKTLAQNTEWAQVRASKSML
Ga0193355_101296423300018628MarineMLYLLTKSKKENMIAKWRWHVGENNKHYSNPTSDRRFPAHRHKNYLRYSNPHQQLRNKRVSMIHTNWWCRDQVFRKYFDMRKRNGMEPSLSGFYHDDLFEKTKAQNTEWAQIRANKSML
Ga0192978_105722613300018871MarineMIAKWQWHIGEINKHYDSPHSDRRMPADHKKNYVRYANFHQVRRNKRVSMIHTNWWCRDQNFRKYFEMRKRHDIKPAISGFYHDDIYEMTLKKNTEWA
Ga0192978_106211323300018871MarineMKKERMMDKWRWAIGENNKHYDGPHSDRRLPADRKKNYVRYSNPHQIRRNKRVSMIHTNWWCRDQNFRKYFDMRKRHDIRPALSGFYHEPIYAKSQAANQAWADLRATKSSR
Ga0193090_109613213300018899MarineMIAKWQWHIGEINKHYDSPHSDRRMPADHKKNYVRYSNFHQVRRNKRVSMIHTNWWCRDQNFRKYFEMRKRHDIKPALSGFYHDDIYEDTKRRNTEWAALRAS
Ga0192961_1010321733300018980MarineMIAKWQWHIGEINKHYDSPHSDRRMPADHKKNYVRYSNFHQVRRNKRVSMIHTNWWCRDQNFRKYFEMRKRHGIEPSMSGFQHEALYEATMKKNTEWAALRASQAAR
Ga0192947_1013411313300018982MarineMKKEGMMNKWRWHIGENNKHYDGPHSDRRFPVDRKKNYVRYSNAHQIRRPKRVSMIHTNWWCRDQNFRKYFDMRKRHDIRPALSGFYHEPILAKTEEQNA
Ga0193030_1010046113300018989MarineMISNWRWHIGENNRHYDNSHSDRRLPADRKKNYVRYSNFHQMRRNKRVSMIHTNWWCRDQNFRKYFEMRKRHDIKPSMTGFYHEAIYADTVAKNQALIDLRASQAPR
Ga0193030_1014035613300018989MarineMMSKWRWHIGDNNRHYDNSHSDRRLPADRKKNYVRYSNFHQMRRNKRVSMIHTNWWCRDQNFRKYFEMRKRNEIKPALSGFYHE
Ga0192982_1026867113300019021MarineMIAKWQWHIGEINKHYDSPHSDRRMPADHKKNYVRYSNFHQVRRNKRVSMIHTNWWCRDQNFRKYFEMRKRHDIKPALSGFYHDDIYEDTKRRNTEWAALRASQQPR
Ga0192951_1017876013300019022MarineMMSKWRWHIGETNKHYDASHTDRRLPADRKKNYVRYSNFHQMRRNKRVSMIHLNWWCRDQNFRKYFEMRKRHDIKPAMSGFYHEGIYKETIAKNQALIDLRASQAPRLSLDFISLWQKI
Ga0193516_1022286013300019031MarineMKKEGMMNKWRWHIGENNKFYDGPHADRRFPADRKKNYVRYSNFHQVRRNKRVSMIHTNWWCRDQNFRKYFDMRKRHDIRPALSGFYDDEIFRKS
Ga0192869_1020902123300019032MarineMKKESMMNKWRWHIGENNKHYDGPHSDRRFPANRQKNYIRYSNPHQVRRNKRVSMIHTNWWCRDQNFRKYFDMRKRHDIRPALSGFYHDDIHASTTQKNADWAALRASRSSR
Ga0192981_1019200423300019048MarineMIAKWQWHIGEINKHYDSPHSDRRMPADHKKNYVRYSNFHQGLRNKRVSMIHTNWWCRDQNFRKYFEMRKRHDIKPALSGFYHDDIYDMTLKKNTEWA
Ga0192981_1019278913300019048MarineMIAKWQWHIGEINKHYDSPHSDRRMPADHKKNYVRYSNFHQGLRNKRVSMIHTNWWCRDQNFRKYFEMRKRHDIKPALSGFYHDDIYDMTLKKNTEWAAMRASQQPR
Ga0192981_1021931523300019048MarineMIAKWQWHIGEINKHYDSPHSDRRMPADHKKNYVRYSNFHQIRRNKRVSMIHTNWWCRDQNFRKYFEMRKRHDIKPALSGFYHDDIYENTLSKNTEWAAMRASQQPR
Ga0192966_1020160723300019050MarineMIAKWQWHIGEINKHYDSPHSDRRMPADHKKNYVRYSNFHQVRRNKRVSMIHTNWWCRDQNFRKYFEMRKRHDIKPAMSGFYHEGIYKETIAKNQALIDLRASQAPR
Ga0192966_1021954523300019050MarineMKKEGMMNKWRWHIGENNKHYDGPHSDRRFPVDRKKNYVRYSNAHQIRRPKRVSMIHTNWWCRDQNFRKYFEMRKRHDIAPAISGFYHDDIYANTLSKNTEWAAMRASQQPR
Ga0192826_1026528823300019051MarineMLYLLTKQKKENMISKWRWHIGENNRHYDNSHSDRRLPADRKKNYVRYSNFHQMRRNKRVSMIHTNWWCRDQNFRKYFEMRKRHDMRPSMSGFYHEKIHADTVAKNQALIDLRATQAPR
Ga0192980_104589213300019123MarineMIAKWQWHIGEINKHYDSPHSDRRMPADHKKNYVRYSNFHQGLRNKRVSMIHTNWWCRDQNFRKYFEMRKRHDIKPAISGFYHDDIYEMTLKKNTEWAELRASQQPR
Ga0188870_1008896413300019149Freshwater LakeMMNKWRWHIGENNKHYDGPHSDRRFPVDRKKNYVRYSNAHQIRRAKRVSMIHTNWWCRDQNFRKYFEMRKRHDIKPAISGFYHDDIYENTQKMNNQWAALRASQQPR
Ga0182059_155166113300019272Salt MarshAKWRWHIGENNKHYDSSHSDRRFPVDRHKNYVRYTNFHQYLRNKRVSMIHTNWWCRDQVFRKYFDMRKKNGVEPSMSGFYHDDLYEKTLQQNTEWARVRASKSML
Ga0211686_1032281323300020382MarineMMSKWRWHIGETNKHYDASHTDRRLPADRKKNYVRYSNFHQMRRNKRVSMIHLNWWCRDQNFRKYFEMRKRHDIKPAMSGFYHEGIYKETIAKNQALIDLRASQAPR
Ga0214201_105311323300020732FreshwaterMIAKWKWHIGEINKHYDSPHADRRFPADRHKNYVRYTNFHQIRRNKKIGMIHTNWWCRDQNFRKYFDMRKRHDIKPAMSGFYHEPLYQQTLQKNTEWAALRASRESR
Ga0206687_112006513300021169SeawaterLLTKMKKENMMNKWRWHIGENNKHYDGPHSDRRFPVNRQKNYIRYSNPHQVRRNKRVSMIHTNWWCRDQNFRKYFDMRKRHDIRPALSGFYHEPIFAQTQ
Ga0206691_186954323300021342SeawaterMMANWRWHIGETNRFYDMPHSDQRFPADHKKNYVRYSNFHQIKKNKRVSMIHTNWWCRDQNFRKYFDMRKRHDMKPAMSKFYHEPLYEETVKKNQEWADLRASRSLR
Ga0206692_156877313300021350SeawaterMIAKWYWSNGQMTKQYGLPNQLRMPADRKKNYVRYSNFHQVRKNKKTSMIHTNWWCRDQSFRKYFEMRKKNDIRPSISGFYHEPIHEDTVRRNQEWAN
Ga0206689_1072771123300021359SeawaterMIAKWQWHIGEINKHYDSPHSDRRMPADHKKNYVRYSNFHQVRRNKRVSMIHTNWWCRDQNFRKYFEMRKRHGINPALSGFYHDDIYEATASKNNEWAAMRASQQPR
Ga0063107_10594623300021869MarineMTKMKKENMMNKWRWHIGENNKHYDGPHSDRRFPADRKKNYVRYSNLHQVRRNKRVSMIHTNWWCRDQNFRKYFDMRKRHDIRPALSGFYHEPIYAKSQAANQAWADLRASKVSR
Ga0063147_14006223300021874MarineMIAKWQWHIGEINKHYDSPHSDRRMPADHKKNYVRYSNFHQVRRNKRVSMIHTNWWCRDQNFRKYFEMRKRHDIAPAISGFYHDDIYANTLSKNT
Ga0063089_105561223300021889MarineMIAKWQWHIGEINKHYDSPHSDRRMPADHKKNYVRYSNFHQIRRNKRVSMIHTNWWCRDQNFRKYFEMRKRHDIAPAISGFYHDDIYAETLSKN
Ga0063086_101195123300021902MarineMKKENMMNKWRWHIGENNKHYDGPHSDRRLPADRKKNYVRYSNVHQVRRNKRVSMIHTNWWCRDQNFRKYFDMRKRNDVKPALSGFAHEPIFEKSNAQNQAWADLRS
Ga0063088_102254023300021905MarineMIAKWQWHIGEINKHYDSPHSDRRMPADHKKNYVRYSNFHQIRRNKRVSMIHTNWWCRDQNFRKYFEMRKRHDIAPAISGFYHDDIYAETLSKNTQWAALRASQQP
Ga0063106_104048523300021911MarineMIAKWQWHIGEINKHYDSPHSDRRMPADHKKNYVRYSNFHQIRRNKRVSMIHTNWWCRDQNFRKYFEMRKRHDIAPAISGFYHDDIYANTL
Ga0063870_104059923300021921MarineMIAKWQWHIGEINKHYDSPHSDRRMPADHKKNYVRYSNFHQIRRNKRVSMIHTNWWCRDQNFRKYFEMRKRHDIAPAISGFYHDDIYAETLSKNTQWAALRASQ
Ga0063096_102325523300021925MarineMIAKWQWHIGEINKHYDSPHSDRRMPADHKKNYVRYSNFHQIRRNKRVSMIHTNWWCRDQNFRKYFEMRKRHDIAPAISGFYHDDIYAETLSKNTQWAALRASQQ
Ga0063103_100805923300021927MarineMIAKWQWHIGEINKHYDSPHSDRRMPADHKKNYVRYSNFHQIRRNKRVSMIHTNWWCRDQNFRKYFEMRKRHDIAPAISGFYHDDIYAETLSKNTQWAALRASQQPR
Ga0063103_104361723300021927MarineMKKENMMNKWRWHIGENNKHYDGPHSDRRLPADRKKNYVRYSNVHQVRRNKRVSMIHTNWWCRDQNFRKYFDMRKRNDVKPALSGFMHEPIFEKSNAQNQAWADLRSTRVSR
Ga0063145_102642023300021930MarineMIAKWQWHIGEINKHYDSPHSDRRMPADHKKNYVRYSNFHQVRRNKRVSMIHTNWWCRDQNFRKYFEMRKRHDIAPAISGFYHDDIYANTLSKNTEWAAMRASQQPR
Ga0063108_107479923300021940MarineMIAKWQWHIGEINKHYDSPHSDRRMPADHKKNYVRYSNFHQIRRNKRVSMIHTNWWCRDQNFRKYFEMRKRHDIAPAISGFYHDDIYAETLSKNTQWA
Ga0063101_108740523300021950MarineMKKENMMNKWRWHIGENNKHYDGPHSDRRLPADRKKNYVRYSNVHQVRRNKRVSMIHTNWWCRDQNFRKYFDMRKRNDVKPALSGFMHEPIFEKSNAQNQAWA
Ga0222716_1072785513300021959Estuarine WaterIIYVFLIWHLYQSFVLYLLTKQKKEGMVAKWKWHIGEVNKHYDSPHSDRRFPADRKKNYVRYSNFHQVRRNKRISMIHTNWWCRDQNFRKYFDMRKRHGIEPSMSGFYHEPLYEATMAKNTEWANLRASQQSR
Ga0244776_1089732123300024348EstuarineHLYQSFVLYLLTKQKKEGMIAKWKWHIGEVNKHYDSPHSDRRFPADRKKNYVRYSNFHQIRRNKRISMIHTNWWCRDQNFRKYFDMRKRHGIEPSMSGFYHEPLYEETLKKNTEWAALRASQQAR
Ga0209405_117065813300025620Pelagic MarineVFLIWHLYQSFVLYLLTKQKKEGMIAKWKWHIGEVNKHYDSPHSDRRFPADRKKNYVRYSNFHQIRRNKRISMIHTNWWCRDQNFRKYFDMRKRHGIEPSMSGFYHEPLYEETLKKNTEWAALRASQQAR
Ga0209652_117488013300025684MarineYVFLIWHLYQSFVLYLLTKQKKEGMIAKWKWHIGEVNKHYDSPHSDRRFPADRKKNYVRYSNFHQIRRNKRISMIHTNWWCRDQNFRKYFDMRKRHGIEPSMSGFYHEPLYEETLKKNTEWAALRASQQAR
Ga0208386_105118923300025781FreshwaterMIAKWKWHIGEINKHYDSPHADRRFPADRHKNYVRYTNFHQIRRNKKIGMIHTNWWCRDQNFRKYFDMRKRHDIKPAMSGFYHEPLYQQTLQKNTEWAALR
Ga0208275_104023713300026182MarineMNKWRWHIGENNKHYDGPHSDRRFPADRKKNYVRYTNFHQVRRNKRVSMIHTNWWCRDQNFRKYFDMRKRHGISPAMSGFYHEPLYAATLAKNTEWANLRASKVSR
Ga0247607_107825613300026447SeawaterMNKWRWHVGENNKFYDGPHTDRRFPADRKKNYVRYSNIHQVRRNKRVSMIHTNWWCRDQNFRKYFDMRKRHEIRPALSGFYHEEIHAESTAKNQAWADLRATKASR
Ga0247588_106552713300026465SeawaterMIAKWQWHIGEINKHYDSPHSDRRMPADHKKNYVRYSNFHQVRRNKRVSMIHTNWWCRDQNFRKYFEMRKRHDIAPAISGFYHDDIYASTLSKNTEWAAMRASQQPR
Ga0247571_114298123300026495SeawaterMMNKWRWAIGENNKHYDGPHSDRRFPANRQKNYIRYSNPHQVRRNKRVSMIHTNWWCRDQNFRKYFDMRKRHDIRPALSGFYHEPIFASTT
Ga0209302_1024046913300027810MarineMTKMKKENMMNKWRWHIGENNKHYDGPHSDRRFPADRKKNYVRYSNLHQVRRNKRVSMIHTNWWCRDQNFRKYFDMRKRHDIRPALSGFYHEPIYAKSQAANQAWADL
Ga0209092_1023802723300027833MarineMKKENMMNKWRWHIGENNKHYDGPHSDRRLPADRKKNYVRYSNVHQVRRNKRVSMIHTNWWCRDQNFRKYFDMRKRNDVKPALSGFAHEPIFEKSNAQNQAWADLRSTRVSR
Ga0247582_109561313300028109SeawaterMKKENMMNKWRWAIGENNKHYDGPHSDRRFPANRQKNYIRYSNPHQVRRNKRVSMIHTNWWCRDQNFRKYFDMRKRHDIRPALSGFYHEPIFASTT
Ga0247584_116255813300028110SeawaterMMNKWRWHIGENNKHYDGPHSDRRFPVDRKKNYVRYSNAHQIRRNKRVSMIHTNWWCRDQNFRKYFDMRKRHDIRPALSGFYHEPIFEKTQAQNSAWAAL
Ga0256412_119422523300028137SeawaterMMNKWRWHIGENNKHYDGPHADRRFPVDRKKNYVRYSNAHQIRRAKRVSMIHTNWWCRDQNFRKYFDMRKRNNMRPALTGFYHEPIFAATTEANQTWANMRASQSSR
Ga0256417_111928913300028233SeawaterMMNKWRWHIGENNKHYDGPHSDRRFPVDRKKNYVRYSNAHQIRRNKRVSMIHTNWWCRDQNFRKYFDMRKRHDIRPALSGFYHEPIFEKTQAQNSAWAALRASQNPR
Ga0256413_124607923300028282SeawaterMIAKWQWHIGEINKHYDSPHSDRRMPADHKKNYVRYSNFHQVRRNKRVSMIHTNWWCRDQNFRKYFEMRKRHGINPALSGFYHDDIYEAT
Ga0247572_109031813300028290SeawaterMMNKWRWHIGENNKHYDGPHSDRRFPVDRKKNYVRYSNAHQIRRNKRVSMIHTNWWCRDQNFRKYFDMRKRHDIRPALSGFYHEPIFEKTQEQNQAWAALRASQKSV
Ga0247595_105496313300028333SeawaterMIAKWQWHIGEINKHYDSPHSDRRMPADHKKNYVRYSNFHQVRRNKRVSMIHTNWWCRDQNFRKYFEMRKRHDIAPAISGFYHDDIYASTLSKNTEW
Ga0306910_103257913300028412Saline LakeMISKYMWHNGEVNKYYGAPNQLRMPADRKKNYVRYSNFHQVRKNKKTSMIHTNWWCRDQNFRKYFDMRKRHDIKPSISGFYHDGLYTNAVEKNTEWASLRASRSSR
Ga0307979_108918613300031398Saline WaterMISKYMWHNGEVNKYYGAPNQLRMPADRKKNYVRYSNFHQVRKNKKTSMIHTNWWCRDQNFRKYFDMRKRHDIKPSISGFYHDGLYTNAV
Ga0307388_1051074813300031522MarineMKKEGMMNKWRWHIGENNKHYDGPHSDRRFPVDRKKNYVRYSNAHQIRRPKRVSMIHTNWWCRDQNFRKYFDMRKRHDIRPALSGFYHEPILEKTTQQNAEWAALRASQGSR
Ga0308147_104475113300031558MarineMKKEAMMNKWRWHIGENNKHYDGPHSDRRFPADRKKNYVRYSNVHQVRRNKRVSMIHTNWWCRDQNFRKYFDMRKRHDIKPALSGFYHEPIYAKSQE
Ga0307386_1042984923300031710MarineMKKEGMMNKWRWHIGENNKHYDGPHSDRRFPVDRKKNYVRYSNAHQIRRPKRVSMIHTNWWCRDQNFRKYFDMRKRHDIRPALSGFYHEPILEKTTQQNAEW
Ga0307391_1057235023300031729MarineMIAKWQWHIGEINKHYDSPHSDRRMPADHKKNYVRYSNFHQVRRNKRVSMIHTNWWCRDQNFRKYFEMRKRHDIAPAISGFYHDDIY
Ga0307397_1038665313300031734MarineMMNKWRWHIGENNKFYDGPHNDRRFPADRKKNYVRYSNIHQVRRNKRVSMIHTNWWCRDQNFRKYFDMRKRHDIRPALTGFYDDAIY
Ga0307384_1053106213300031738MarineMMNKWRWHIGENNKHYDGPHSDRRFPVDRKKNYVRYSNAHQIRRPKRVSMIHTNWWCRDQNFRKYFDMRKRHDIRPALSGFYHEPILA
Ga0307383_1033084413300031739MarineMIAKWQWHIGEINKHYDSPHSDRRMPADHKKNYVRYSNFHQIRRNKRVSMIHTNWWCRDQNFRKYFEMRKRHEIAPALSGFYHDDIYENTLQKNTQWAAMRASQQPR
Ga0307389_1059587013300031750MarineMNKWRWHIGENNKHYDGPHSDRRFPVDRKKNYVRYSNAHQIRRPKRVSMIHTNWWCRDQNFRKYFDMRKRHDIRPALSGFYHEPILEKTTQQNAEWAALRASQGSR
Ga0315330_1084656813300032047SeawaterKKENMMSRWRWAIGETNKHYDNPHTDRRFPADRKKNYVRYSNFHQMRRNKRVSMIHTNWWCRDQNFRKYFEMRKRHDFKPALSGFYHESIYADSVKKNQALIDLRASQAPR
Ga0314779_102416823300032150SedimentMWANGEITKEYGMPNQKRMPADRKKNYVRYSNFHQVKRNKRTSMIHLNWWCRDQNFRKYFDMRKRHDMKPSIHGFYHEPIYDAAVKKN
Ga0314667_1051042323300032520SeawaterMIAKWQWHIGEINKHYDSPHSDRRMPADHKKNYVRYSNFHQTLRNKRVSMIHTNWWCRDQNFRKYFEMRKRHDIKPALSGFYHDDIYENTLRTNTEW
Ga0314680_1063722013300032521SeawaterMIAKWQWHIGEINKHYDSPHSDRRMPADHKKNYVRYSNFHQTLRNKRVSMIHTNWWCRDQNFRKYFEMRKRHDIKPALSGFYHDDIYENTLRTNTEWANMRASQQP
Ga0314709_1056264723300032755SeawaterMIAKWQWHIGEINKHYDSPHSDRRMPADHKKNYVRYSNFHQTLRNKRVSMIHTNWWCRDQNFRKYFEMRKRHDIKPALSGFYHDDIYENTLRTNTEWANMRASQQ
Ga0307390_1052326123300033572MarineMIAKWQWHIGEINKHYDSPHSDRRMPADHKKNYVRYSNFHQVRRNKRVSMIHTNWWCRDQNFRKYFEMRKRHDIKPALSGFYHDDIYDMTLKKNTEWA

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.