Metagenome / Metatranscriptome Family F082841

Basic Information
Family ID	F082841
Family Type	Metagenome / Metatranscriptome
Number of Sequences	113
Average Sequence Length	43 residues
Representative Sequence	QTLEQAQASVTMDAYKDWEFYAQQRPGNVAGTYRALTSGR
Number of Associated Samples	105
Number of Associated Scaffolds	113

Quality Assessment
Transcriptomic Evidence	Yes
Most common taxonomic group	Bacteria
% of genes with valid RBS motifs	2.65 %
% of genes near scaffold ends (potentially truncated)	98.23 %
% of genes from short scaffolds (< 2000 bps)	94.69 %
Associated GOLD sequencing projects	98
AlphaFold2 3D model prediction	Yes
3D model pTM-score	0.25

Most Common Taxonomy
Group	Bacteria (95.575 % of family members)
NCBI Taxonomy ID	2
Taxonomy	All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil (9.735 % of family members)
Environment Ontology (ENVO)	Unclassified (36.283 % of family members)
Earth Microbiome Project Ontology (EMPO)	Host-associated → Plant → Plant rhizosphere (44.248 % of family members)

Full Alignment
Alignment of all the sequences in the family.

Powered by MSAViewer

Seed Alignment
Alignment of a non-redundant set of sequences, used to build the family's HMM profile.

Powered by MSAViewer

AlphaFold2 Input Alignment
Refined alignment used as input for AlphaFold2.

Powered by MSAViewer

Predicted Topology & Secondary Structure
Classification:	Globular	Signal Peptide:	No	Secondary Structure distribution:	α-helix: 39.71% β-sheet: 0.00% Coil/Unstructured: 60.29%
Feature Viewer

Powered by Feature Viewer

Pfam ID	Name	% Frequency in 113 Family Scaffolds
PF00903	Glyoxalase	6.19
PF13468	Glyoxalase_3	6.19
PF12681	Glyoxalase_2	5.31
PF13649	Methyltransf_25	4.42
PF00696	AA_kinase	2.65
PF12276	DUF3617	2.65
PF12847	Methyltransf_18	1.77
PF13857	Ank_5	1.77
PF12796	Ank_2	1.77
PF13620	CarboxypepD_reg	1.77
PF08308	PEGA	1.77
PF02776	TPP_enzyme_N	1.77
PF05193	Peptidase_M16_C	0.88
PF00873	ACR_tran	0.88
PF09835	DUF2062	0.88
PF16326	ABC_tran_CTD	0.88
PF02621	VitK2_biosynth	0.88
PF01042	Ribonuc_L-PSP	0.88
PF00578	AhpC-TSA	0.88
PF02655	ATP-grasp_3	0.88
PF16363	GDP_Man_Dehyd	0.88
PF03446	NAD_binding_2	0.88
PF03372	Exo_endo_phos	0.88
PF02405	MlaE	0.88
PF07995	GSDH	0.88
PF04519	Bactofilin	0.88
PF00753	Lactamase_B	0.88
PF00698	Acyl_transf_1	0.88
PF07883	Cupin_2	0.88
PF05960	DUF885	0.88
PF12867	DinB_2	0.88
PF01370	Epimerase	0.88
PF01968	Hydantoinase_A	0.88

COG ID	Name	Functional Category	% Frequency in 113 Family Scaffolds
COG0251	Enamine deaminase RidA/Endoribonuclease Rid7C, YjgF/YER057c/UK114 family	Defense mechanisms [V]	0.88
COG0767	Permease subunit MlaE of the ABC-type intermembrane phospholipid transporter Mla	Cell wall/membrane/envelope biogenesis [M]	0.88
COG1427	Chorismate dehydratase (menaquinone biosynthesis, futalosine pathway)	Coenzyme transport and metabolism [H]	0.88
COG1664	Cytoskeletal protein CcmA, bactofilin family	Cytoskeleton [Z]	0.88
COG2133	Glucose/arabinose dehydrogenase, beta-propeller fold	Carbohydrate transport and metabolism [G]	0.88
COG4805	Uncharacterized conserved protein, DUF885 family	Function unknown [S]	0.88

NCBI Taxonomy

Select NCBI taxonomy Level:

Name	Rank	Taxonomy	Distribution
All Organisms	root	All Organisms	95.58 %
Unclassified	root	N/A	4.42 %

Name	Rank	Taxonomy	Distribution
cellular organisms	root	All Organisms → cellular organisms	95.58 %
Unclassified	root	N/A	4.42 %

Name	Rank	Taxonomy	Distribution
Bacteria	superkingdom	All Organisms → cellular organisms → Bacteria	95.58 %
Unclassified	root	N/A	4.42 %

Name	Rank	Taxonomy	Distribution
Acidobacteria	phylum	All Organisms → cellular organisms → Bacteria → Acidobacteria	51.33 %
Proteobacteria	phylum	All Organisms → cellular organisms → Bacteria → Proteobacteria	7.96 %
Unclassified	root	N/A	4.42 %
PVC group	clade	All Organisms → cellular organisms → Bacteria → PVC group	2.65 %
Terrabacteria group	clade	All Organisms → cellular organisms → Bacteria → Terrabacteria group	1.77 %

Name	Rank	Taxonomy	Distribution
unclassified Acidobacteria	no rank	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria	35.40 %
Unclassified	root	N/A	4.42 %
Acidobacteriia	class	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia	3.54 %
Alphaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	2.65 %
Gammaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	1.77 %
Planctomycetes	phylum	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes	1.77 %
Verrucomicrobia	phylum	All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia	0.88 %
unclassified Proteobacteria	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria	0.88 %
Actinobacteria	phylum	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	0.88 %
Blastocatellia	class	All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia	0.88 %
Cyanobacteria/Melainabacteria group	clade	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group	0.88 %
Vicinamibacteria	class	All Organisms → cellular organisms → Bacteria → Acidobacteria → Vicinamibacteria	0.88 %

Name	Rank	Taxonomy	Distribution
Acidobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	35.40 %
Unclassified	root	N/A	4.42 %
Rhodospirillales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales	2.65 %
Bryobacterales	order	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales	1.77 %
Xanthomonadales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales	1.77 %
unclassified Blastocatellia	no rank	All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia	0.88 %
Vicinamibacterales	order	All Organisms → cellular organisms → Bacteria → Acidobacteria → Vicinamibacteria → Vicinamibacterales	0.88 %
Candidatus Acidoferrales	order	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales	0.88 %
unclassified Terriglobia	no rank	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia	0.88 %
Proteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium	0.88 %
Cyanobacteria	phylum	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria	0.88 %
Actinomycetia	class	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia	0.88 %
Planctomycetia	class	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia	0.88 %
unclassified Verrucomicrobia	no rank	All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia	0.88 %
Phycisphaerae	class	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae	0.88 %

Name	Rank	Taxonomy	Distribution
Acidobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	35.40 %
Unclassified	root	N/A	4.42 %
Azospirillaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Azospirillaceae	2.65 %
Rhodanobacteraceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Rhodanobacteraceae	1.77 %
Verrucomicrobia bacterium	species	All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium	0.88 %
Blastocatellia bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium	0.88 %
Acidobacteriia bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium	0.88 %
Vicinamibacteraceae	family	All Organisms → cellular organisms → Bacteria → Acidobacteria → Vicinamibacteria → Vicinamibacterales → Vicinamibacteraceae	0.88 %
Candidatus Acidoferrum	genus	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum	0.88 %
Bryobacteraceae	family	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae	0.88 %
Nostocales	order	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales	0.88 %
Actinomycetales	order	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales	0.88 %
Solibacteraceae	family	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae	0.88 %
unclassified Phycisphaerae	no rank	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae	0.88 %
Planctomycetales	order	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales	0.88 %
Proteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium	0.88 %

Name	Rank	Taxonomy	Distribution
Acidobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	35.40 %
Unclassified	root	N/A	4.42 %
Arenibaculum	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Azospirillaceae → Arenibaculum	2.65 %
Dokdonella	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Rhodanobacteraceae → Dokdonella	1.77 %
Luteitalea	genus	All Organisms → cellular organisms → Bacteria → Acidobacteria → Vicinamibacteria → Vicinamibacterales → Vicinamibacteraceae → Luteitalea	0.88 %
Phycisphaerae bacterium	species	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium	0.88 %
Candidatus Sulfopaludibacter	genus	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter	0.88 %
Candidatus Acidoferrum panamensis	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis	0.88 %
Nostocaceae	family	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Nostocaceae	0.88 %
Verrucomicrobia bacterium	species	All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium	0.88 %
Blastocatellia bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium	0.88 %
Acidobacteriia bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium	0.88 %
Bryobacteraceae	family	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae	0.88 %
Actinomycetales	order	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales	0.88 %
Planctomycetales	order	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales	0.88 %
Proteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium	0.88 %

Name	Rank	Taxonomy	Distribution
Acidobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	35.40 %
Unclassified	root	N/A	4.42 %
Arenibaculum pallidiluteum	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Azospirillaceae → Arenibaculum → Arenibaculum pallidiluteum	2.65 %
Dokdonella fugitiva	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Rhodanobacteraceae → Dokdonella → Dokdonella fugitiva	1.77 %
unclassified Candidatus Sulfopaludibacter	no rank	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter	0.88 %
Luteitalea pratensis	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → Vicinamibacteria → Vicinamibacterales → Vicinamibacteraceae → Luteitalea → Luteitalea pratensis	0.88 %
Phycisphaerae bacterium	species	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium	0.88 %
Candidatus Acidoferrum panamensis	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis	0.88 %
Nostocaceae	family	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Nostocaceae	0.88 %
Verrucomicrobia bacterium	species	All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium	0.88 %
Blastocatellia bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium	0.88 %
Acidobacteriia bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium	0.88 %
Bryobacteraceae	family	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae	0.88 %
Actinomycetales	order	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales	0.88 %
Planctomycetales	order	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales	0.88 %
Proteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium	0.88 %

Name	Rank	Taxonomy	Distribution
Acidobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	35.40 %
Unclassified	root	N/A	4.42 %
Arenibaculum pallidiluteum	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Azospirillaceae → Arenibaculum → Arenibaculum pallidiluteum	2.65 %
Dokdonella fugitiva	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Rhodanobacteraceae → Dokdonella → Dokdonella fugitiva	1.77 %
Candidatus Sulfopaludibacter sp. SbA4	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4	0.88 %
Luteitalea pratensis	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → Vicinamibacteria → Vicinamibacterales → Vicinamibacteraceae → Luteitalea → Luteitalea pratensis	0.88 %
Phycisphaerae bacterium	species	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium	0.88 %
Candidatus Acidoferrum panamensis	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis	0.88 %
Nostocaceae	family	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Nostocaceae	0.88 %
Verrucomicrobia bacterium	species	All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium	0.88 %
Blastocatellia bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium	0.88 %
Acidobacteriia bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium	0.88 %
Bryobacteraceae	family	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae	0.88 %
Actinomycetales	order	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales	0.88 %
Planctomycetales	order	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales	0.88 %
Proteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium	0.88 %

Visualization

Powered by ApexCharts

Associated Scaffolds

Scaffold	Taxonomy	Length	IMG/M Link
3300000550\|F24TB_13396060	All Organisms → cellular organisms → Bacteria	564	Open in IMG/M
3300000559\|F14TC_100273780	All Organisms → cellular organisms → Bacteria	590	Open in IMG/M
3300000956\|JGI10216J12902_119122584	All Organisms → cellular organisms → Bacteria	677	Open in IMG/M
3300004479\|Ga0062595_101980890	All Organisms → cellular organisms → Bacteria → Proteobacteria	561	Open in IMG/M
3300005332\|Ga0066388_102461162	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	945	Open in IMG/M
3300005334\|Ga0068869_100121109	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales	2001	Open in IMG/M
3300005441\|Ga0070700_101453230	All Organisms → cellular organisms → Bacteria	581	Open in IMG/M
3300005456\|Ga0070678_101057100	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Rhodanobacteraceae → Dokdonella → Dokdonella fugitiva	748	Open in IMG/M
3300005458\|Ga0070681_11550453	All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium	587	Open in IMG/M
3300005534\|Ga0070735_10332310	All Organisms → cellular organisms → Bacteria	913	Open in IMG/M
3300005542\|Ga0070732_10877465	All Organisms → cellular organisms → Bacteria	548	Open in IMG/M
3300005616\|Ga0068852_102325177	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Azospirillaceae → Arenibaculum → Arenibaculum pallidiluteum	557	Open in IMG/M
3300005764\|Ga0066903_100743319	All Organisms → cellular organisms → Bacteria	1740	Open in IMG/M
3300005764\|Ga0066903_102468156	All Organisms → cellular organisms → Bacteria	1006	Open in IMG/M
3300005764\|Ga0066903_103672254	All Organisms → cellular organisms → Bacteria → Acidobacteria	826	Open in IMG/M
3300005843\|Ga0068860_101789108	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	636	Open in IMG/M
3300006032\|Ga0066696_10594261	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	719	Open in IMG/M
3300006237\|Ga0097621_101350433	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	674	Open in IMG/M
3300006358\|Ga0068871_100802266	All Organisms → cellular organisms → Bacteria → Proteobacteria	868	Open in IMG/M
3300006577\|Ga0074050_11710218	All Organisms → cellular organisms → Bacteria	1038	Open in IMG/M
3300006755\|Ga0079222_10523868	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	877	Open in IMG/M
3300006804\|Ga0079221_10503441	All Organisms → cellular organisms → Bacteria	787	Open in IMG/M
3300006806\|Ga0079220_11588533	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4	566	Open in IMG/M
3300006844\|Ga0075428_101485284	All Organisms → cellular organisms → Bacteria	710	Open in IMG/M
3300006844\|Ga0075428_102586721	All Organisms → cellular organisms → Bacteria	519	Open in IMG/M
3300006853\|Ga0075420_101707893	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	539	Open in IMG/M
3300006871\|Ga0075434_101893403	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	602	Open in IMG/M
3300006881\|Ga0068865_100236838	All Organisms → cellular organisms → Bacteria	1434	Open in IMG/M
3300006894\|Ga0079215_10192987	All Organisms → cellular organisms → Bacteria	1022	Open in IMG/M
3300006904\|Ga0075424_102862331	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	502	Open in IMG/M
3300006918\|Ga0079216_11133073	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	621	Open in IMG/M
3300006969\|Ga0075419_11107104	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	581	Open in IMG/M
3300007004\|Ga0079218_10093231	All Organisms → cellular organisms → Bacteria → Acidobacteria	2043	Open in IMG/M
3300009088\|Ga0099830_11828820	All Organisms → cellular organisms → Bacteria	507	Open in IMG/M
3300009100\|Ga0075418_12371350	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	579	Open in IMG/M
3300009137\|Ga0066709_102006069	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	802	Open in IMG/M
3300009156\|Ga0111538_13667749	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	532	Open in IMG/M
3300009551\|Ga0105238_12677303	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Azospirillaceae → Arenibaculum → Arenibaculum pallidiluteum	535	Open in IMG/M
3300010042\|Ga0126314_10811331	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium	689	Open in IMG/M
3300010166\|Ga0126306_11361137	All Organisms → cellular organisms → Bacteria	586	Open in IMG/M
3300010359\|Ga0126376_12200053	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	596	Open in IMG/M
3300010360\|Ga0126372_11416179	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	728	Open in IMG/M
3300010362\|Ga0126377_12681228	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	573	Open in IMG/M
3300010398\|Ga0126383_13646714	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	503	Open in IMG/M
3300010403\|Ga0134123_11641746	All Organisms → cellular organisms → Bacteria	692	Open in IMG/M
3300011119\|Ga0105246_12380635	Not Available	519	Open in IMG/M
3300011120\|Ga0150983_13176300	All Organisms → cellular organisms → Bacteria → Acidobacteria	501	Open in IMG/M
3300011409\|Ga0137323_1077121	All Organisms → cellular organisms → Bacteria → Acidobacteria	735	Open in IMG/M
3300011409\|Ga0137323_1105190	All Organisms → cellular organisms → Bacteria → Acidobacteria	623	Open in IMG/M
3300011416\|Ga0137422_1045323	All Organisms → cellular organisms → Bacteria → Acidobacteria	1052	Open in IMG/M
3300011440\|Ga0137433_1195452	All Organisms → cellular organisms → Bacteria	662	Open in IMG/M
3300012206\|Ga0137380_10688063	Not Available	889	Open in IMG/M
3300012212\|Ga0150985_105355959	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	729	Open in IMG/M
3300012469\|Ga0150984_111034133	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	526	Open in IMG/M
3300012480\|Ga0157346_1023217	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	557	Open in IMG/M
3300012892\|Ga0157294_10286597	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	521	Open in IMG/M
3300012908\|Ga0157286_10266457	All Organisms → cellular organisms → Bacteria	611	Open in IMG/M
3300012922\|Ga0137394_10397171	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	1176	Open in IMG/M
3300012931\|Ga0153915_11369863	All Organisms → cellular organisms → Bacteria → Acidobacteria	827	Open in IMG/M
3300012971\|Ga0126369_10209386	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales	1887	Open in IMG/M
3300012987\|Ga0164307_10795853	Not Available	751	Open in IMG/M
3300013308\|Ga0157375_13324091	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	536	Open in IMG/M
3300014745\|Ga0157377_10169438	All Organisms → cellular organisms → Bacteria	1365	Open in IMG/M
3300014745\|Ga0157377_11198668	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	588	Open in IMG/M
3300014838\|Ga0182030_10493652	All Organisms → cellular organisms → Bacteria	1226	Open in IMG/M
3300015359\|Ga0134085_10301483	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Nostocaceae	705	Open in IMG/M
3300015374\|Ga0132255_105294824	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	546	Open in IMG/M
3300016404\|Ga0182037_11171270	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae	674	Open in IMG/M
3300017792\|Ga0163161_11783531	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	547	Open in IMG/M
3300017792\|Ga0163161_11871390	Not Available	534	Open in IMG/M
3300018466\|Ga0190268_10589525	All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium	784	Open in IMG/M
3300018469\|Ga0190270_11402669	All Organisms → cellular organisms → Bacteria	745	Open in IMG/M
3300018469\|Ga0190270_12689547	Not Available	560	Open in IMG/M
3300018476\|Ga0190274_11780766	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	710	Open in IMG/M
3300018482\|Ga0066669_11697386	All Organisms → cellular organisms → Bacteria → Acidobacteria	580	Open in IMG/M
3300020170\|Ga0179594_10303155	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	605	Open in IMG/M
3300020582\|Ga0210395_10662064	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium	782	Open in IMG/M
3300021858\|Ga0213852_1321169	All Organisms → cellular organisms → Bacteria	3220	Open in IMG/M
3300025290\|Ga0207673_1060823	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	538	Open in IMG/M
3300025908\|Ga0207643_10407459	All Organisms → cellular organisms → Bacteria → Proteobacteria	860	Open in IMG/M
3300025917\|Ga0207660_11577947	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Azospirillaceae → Arenibaculum → Arenibaculum pallidiluteum	529	Open in IMG/M
3300025919\|Ga0207657_10521818	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Rhodanobacteraceae → Dokdonella → Dokdonella fugitiva	930	Open in IMG/M
3300025919\|Ga0207657_11310234	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	547	Open in IMG/M
3300025938\|Ga0207704_10983743	All Organisms → cellular organisms → Bacteria	713	Open in IMG/M
3300025941\|Ga0207711_10341986	All Organisms → cellular organisms → Bacteria → Acidobacteria → Vicinamibacteria → Vicinamibacterales → Vicinamibacteraceae → Luteitalea → Luteitalea pratensis	1385	Open in IMG/M
3300025942\|Ga0207689_10187923	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	1704	Open in IMG/M
3300025960\|Ga0207651_11994002	All Organisms → cellular organisms → Bacteria	522	Open in IMG/M
3300026088\|Ga0207641_11670162	All Organisms → cellular organisms → Bacteria	639	Open in IMG/M
3300026089\|Ga0207648_10337470	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	1357	Open in IMG/M
3300026121\|Ga0207683_10149321	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	2108	Open in IMG/M
3300026333\|Ga0209158_1265082	All Organisms → cellular organisms → Bacteria → Acidobacteria	589	Open in IMG/M
3300026548\|Ga0209161_10264355	All Organisms → cellular organisms → Bacteria → Acidobacteria	878	Open in IMG/M
3300027787\|Ga0209074_10141749	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	856	Open in IMG/M
3300027903\|Ga0209488_10591666	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis	806	Open in IMG/M
3300027986\|Ga0209168_10456242	All Organisms → cellular organisms → Bacteria	619	Open in IMG/M
3300028381\|Ga0268264_10303927	All Organisms → cellular organisms → Bacteria	1503	Open in IMG/M
3300028587\|Ga0247828_10742420	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	616	Open in IMG/M
3300028810\|Ga0307294_10395263	All Organisms → cellular organisms → Bacteria	519	Open in IMG/M
3300029911\|Ga0311361_10993438	All Organisms → cellular organisms → Bacteria	704	Open in IMG/M
3300031128\|Ga0170823_13305012	All Organisms → cellular organisms → Bacteria	2019	Open in IMG/M
3300031184\|Ga0307499_10336636	All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium	507	Open in IMG/M
3300031538\|Ga0310888_10373420	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	831	Open in IMG/M
3300031908\|Ga0310900_10015034	All Organisms → cellular organisms → Bacteria	3925	Open in IMG/M
3300031913\|Ga0310891_10095297	All Organisms → cellular organisms → Bacteria	907	Open in IMG/M
3300031946\|Ga0310910_10629212	All Organisms → cellular organisms → Bacteria → Acidobacteria	850	Open in IMG/M
3300032002\|Ga0307416_102634765	All Organisms → cellular organisms → Bacteria	600	Open in IMG/M
3300032012\|Ga0310902_10914372	All Organisms → cellular organisms → Bacteria	605	Open in IMG/M
3300032013\|Ga0310906_10967888	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	610	Open in IMG/M
3300032075\|Ga0310890_10098345	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	1827	Open in IMG/M
3300032144\|Ga0315910_11234678	All Organisms → cellular organisms → Bacteria	583	Open in IMG/M
3300032157\|Ga0315912_10904897	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	701	Open in IMG/M
3300034151\|Ga0364935_0285541	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	542	Open in IMG/M
3300034819\|Ga0373958_0030101	All Organisms → cellular organisms → Bacteria → Acidobacteria	1060	Open in IMG/M

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:

Habitat	Taxonomy	Distribution
Environmental	Environmental	64.60%
Host-Associated	Host-Associated	35.40%

Habitat	Taxonomy	Distribution
Terrestrial	Environmental → Terrestrial	59.29%
Plants	Host-Associated → Plants	35.40%
Aquatic	Environmental → Aquatic	5.31%

Habitat	Taxonomy	Distribution
Soil	Environmental → Terrestrial → Soil	57.52%
Rhizosphere	Host-Associated → Plants → Rhizosphere	17.70%
Rhizoplane	Host-Associated → Plants → Rhizoplane	15.93%
Sediment	Environmental → Aquatic → Sediment	3.54%
Freshwater	Environmental → Aquatic → Freshwater	1.77%
Roots	Host-Associated → Plants → Roots	1.77%
Peat	Environmental → Terrestrial → Peat	0.89%
Floodplain	Environmental → Terrestrial → Floodplain	0.89%

Habitat	Taxonomy	Distribution
Unclassified	Environmental → Terrestrial → Soil → Unclassified	47.79%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified	13.27%
Epiphytes	Host-Associated → Plants → Rhizoplane → Epiphytes	12.39%
Loam	Environmental → Terrestrial → Soil → Loam	8.85%
Soil	Host-Associated → Plants → Rhizosphere → Soil	4.42%
Unclassified	Environmental → Aquatic → Sediment → Unclassified	3.54%
Unclassified	Host-Associated → Plants → Rhizoplane → Unclassified	1.77%
Soil	Host-Associated → Plants → Rhizoplane → Soil	1.77%
Rhizosphere	Host-Associated → Plants → Roots → Rhizosphere	1.77%
Sediment	Environmental → Aquatic → Freshwater → Sediment	0.89%
Wetlands	Environmental → Aquatic → Freshwater → Wetlands	0.89%
Wetlands	Environmental → Terrestrial → Soil → Wetlands	0.89%
Unclassified	Environmental → Terrestrial → Peat → Unclassified	0.89%
Sediment	Environmental → Terrestrial → Floodplain → Sediment	0.89%

Habitat	Taxonomy	Distribution
Unclassified	Environmental → Terrestrial → Soil → Unclassified → Unclassified	25.66%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified	13.27%
Unclassified	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified	12.39%
Agricultural Land	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land	7.08%
Agricultural	Environmental → Terrestrial → Soil → Unclassified → Agricultural	6.19%
Grasslands	Environmental → Terrestrial → Soil → Unclassified → Grasslands	5.31%
Forest Soil	Environmental → Terrestrial → Soil → Loam → Forest Soil	4.42%
Unclassified	Host-Associated → Plants → Rhizosphere → Soil → Unclassified	4.42%
Unclassified	Environmental → Aquatic → Sediment → Unclassified → Unclassified	3.54%
Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil	3.54%
Agricultural Soil	Environmental → Terrestrial → Soil → Loam → Agricultural Soil	2.65%
Grasslands	Environmental → Terrestrial → Soil → Loam → Grasslands	1.77%
Unclassified	Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified	1.77%
Unclassified	Host-Associated → Plants → Rhizoplane → Soil → Unclassified	1.77%
Soil	Host-Associated → Plants → Roots → Rhizosphere → Soil	1.77%
Unclassified	Environmental → Aquatic → Freshwater → Sediment → Unclassified	0.89%
Unclassified	Environmental → Aquatic → Freshwater → Wetlands → Unclassified	0.89%
Permafrost	Environmental → Terrestrial → Soil → Wetlands → Permafrost	0.89%
Unclassified	Environmental → Terrestrial → Peat → Unclassified → Unclassified	0.89%
Unclassified	Environmental → Terrestrial → Floodplain → Sediment → Unclassified	0.89%

Habitat	Taxonomy	Distribution
Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil	9.73%
Populus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere	7.08%
Agricultural Soil	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil	6.19%
Soil	Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil	6.19%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere	5.31%
Vadose Zone Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil	4.42%
Tropical Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil	4.42%
Soil	Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil	3.54%
Soil	Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil	3.54%
Tropical Forest Soil	Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil	3.54%
Surface Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil	2.65%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere	2.65%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere	2.65%
Serpentine Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil	1.77%
Grasslands Soil	Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil	1.77%
Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil	1.77%
Soil	Environmental → Terrestrial → Soil → Loam → Grasslands → Soil	1.77%
Corn Rhizosphere	Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere	1.77%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere	1.77%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizoplane → Soil → Unclassified → Miscanthus Rhizosphere	1.77%
Miscanthus Rhizosphere	Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere	1.77%
Corn Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere	1.77%
Watersheds	Environmental → Aquatic → Freshwater → Sediment → Unclassified → Watersheds	0.89%
Freshwater Wetlands	Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands	0.89%
Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil	0.89%
Terrestrial Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil	0.89%
Grasslands Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil	0.89%
Soil	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil	0.89%
Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil	0.89%
Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil	0.89%
Bog	Environmental → Terrestrial → Soil → Wetlands → Permafrost → Bog	0.89%
Forest Soil	Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil	0.89%
Corn, Switchgrass And Miscanthus Rhizosphere	Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere	0.89%
Bog	Environmental → Terrestrial → Peat → Unclassified → Unclassified → Bog	0.89%
Sediment	Environmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment	0.89%
Arabidopsis Rhizosphere	Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere	0.89%
Avena Fatua Rhizosphere	Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere	0.89%
Corn Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere	0.89%
Arabidopsis Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Rhizosphere	0.89%
Corn, Switchgrass And Miscanthus Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere	0.89%
Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere	0.89%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere	0.89%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere	0.89%
Corn Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere	0.89%
Rhizosphere Soil	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere Soil	0.89%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere	0.89%
Avena Fatua Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere	0.89%

Visualization

Powered by ApexCharts

Associated Samples

Taxon OID	Sample Name	Habitat Type	IMG/M Link
3300000550	Amended soil microbial communities from Kansas Great Prairies, USA - BrdU amended with acetate total DNA F2.4 TB clc assemly	Environmental	Open in IMG/M
3300000559	Amended soil microbial communities from Kansas Great Prairies, USA - control no BrdU total DNA F1.4 TC clc assemly	Environmental	Open in IMG/M
3300000956	Soil microbial communities from Great Prairies - Kansas, Native Prairie soil	Environmental	Open in IMG/M
3300004479	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAs	Environmental	Open in IMG/M
3300005332	Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly)	Environmental	Open in IMG/M
3300005334	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2	Host-Associated	Open in IMG/M
3300005441	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG	Environmental	Open in IMG/M
3300005456	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG	Host-Associated	Open in IMG/M
3300005458	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG	Environmental	Open in IMG/M
3300005534	Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen07_05102014_R1	Environmental	Open in IMG/M
3300005542	Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1	Environmental	Open in IMG/M
3300005616	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2	Host-Associated	Open in IMG/M
3300005764	Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)	Environmental	Open in IMG/M
3300005843	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2	Host-Associated	Open in IMG/M
3300006032	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145	Environmental	Open in IMG/M
3300006237	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2)	Host-Associated	Open in IMG/M
3300006358	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2	Host-Associated	Open in IMG/M
3300006577	Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHPA (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300006755	Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter	Environmental	Open in IMG/M
3300006804	Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200	Environmental	Open in IMG/M
3300006806	Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100	Environmental	Open in IMG/M
3300006844	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2	Host-Associated	Open in IMG/M
3300006853	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD4	Host-Associated	Open in IMG/M
3300006871	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3	Host-Associated	Open in IMG/M
3300006881	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2	Host-Associated	Open in IMG/M
3300006894	Agricultural soil microbial communities from Utah to study Nitrogen management - NC Control	Environmental	Open in IMG/M
3300006904	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3	Host-Associated	Open in IMG/M
3300006918	Agricultural soil microbial communities from Utah to study Nitrogen management - NC AS100	Environmental	Open in IMG/M
3300006969	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3	Host-Associated	Open in IMG/M
3300007004	Agricultural soil microbial communities from Utah to study Nitrogen management - NC Compost	Environmental	Open in IMG/M
3300009088	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG	Environmental	Open in IMG/M
3300009100	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2	Host-Associated	Open in IMG/M
3300009137	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158	Environmental	Open in IMG/M
3300009156	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2)	Host-Associated	Open in IMG/M
3300009551	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG	Host-Associated	Open in IMG/M
3300010042	Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot105B	Environmental	Open in IMG/M
3300010166	Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot27	Environmental	Open in IMG/M
3300010359	Tropical forest soil microbial communities from Panama - MetaG Plot_15	Environmental	Open in IMG/M
3300010360	Tropical forest soil microbial communities from Panama - MetaG Plot_6	Environmental	Open in IMG/M
3300010362	Tropical forest soil microbial communities from Panama - MetaG Plot_22	Environmental	Open in IMG/M
3300010398	Tropical forest soil microbial communities from Panama - MetaG Plot_35	Environmental	Open in IMG/M
3300010403	Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3	Environmental	Open in IMG/M
3300011119	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG	Host-Associated	Open in IMG/M
3300011120	Combined assembly of Microbial Forest Soil metaT	Environmental	Open in IMG/M
3300011409	Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT423_2	Environmental	Open in IMG/M
3300011416	Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT551_2	Environmental	Open in IMG/M
3300011440	Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT840_2	Environmental	Open in IMG/M
3300012206	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaG	Environmental	Open in IMG/M
3300012212	Combined assembly of Hopland grassland soil	Host-Associated	Open in IMG/M
3300012469	Combined assembly of Soil carbon rhizosphere	Host-Associated	Open in IMG/M
3300012480	Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.5.yng.040610	Host-Associated	Open in IMG/M
3300012892	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S209-509C-1	Environmental	Open in IMG/M
3300012908	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S089-202R-1	Environmental	Open in IMG/M
3300012922	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaG	Environmental	Open in IMG/M
3300012931	Freshwater wetland microbial communities from Ohio, USA - Open water 3 Core 3 Depth 3 metaG	Environmental	Open in IMG/M
3300012971	Tropical forest soil microbial communities from Panama - MetaG Plot_1	Environmental	Open in IMG/M
3300012987	Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_243_MG	Environmental	Open in IMG/M
3300013308	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG	Host-Associated	Open in IMG/M
3300014745	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG	Host-Associated	Open in IMG/M
3300014838	Permafrost microbial communities from Stordalen Mire, Sweden - 812S3M metaG (Illumina Assembly)	Environmental	Open in IMG/M
3300015359	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09182015	Environmental	Open in IMG/M
3300015374	Col-0 rhizosphere combined assembly	Host-Associated	Open in IMG/M
3300016404	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082	Environmental	Open in IMG/M
3300017792	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG	Host-Associated	Open in IMG/M
3300018466	Populus adjacent soil microbial communities from riparian zone of Blue River, Arizona, USA - 249 T	Environmental	Open in IMG/M
3300018469	Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 320 T	Environmental	Open in IMG/M
3300018476	Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 531 T	Environmental	Open in IMG/M
3300018482	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118	Environmental	Open in IMG/M
3300020170	Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad1_1_08_16fungal (Illumina Assembly)	Environmental	Open in IMG/M
3300020582	Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-O	Environmental	Open in IMG/M
3300021858	Metatranscriptome of freshwater sediment microbial communities from post-fracked creek in Pennsylvania, United States - ABR_2015 (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300025290	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5	Host-Associated	Open in IMG/M
3300025908	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes)	Host-Associated	Open in IMG/M
3300025917	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes)	Environmental	Open in IMG/M
3300025919	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025938	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes)	Host-Associated	Open in IMG/M
3300025941	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025942	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes)	Host-Associated	Open in IMG/M
3300025960	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300026088	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes)	Host-Associated	Open in IMG/M
3300026089	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes)	Host-Associated	Open in IMG/M
3300026121	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300026333	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_140 (SPAdes)	Environmental	Open in IMG/M
3300026548	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 (SPAdes)	Environmental	Open in IMG/M
3300027787	Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter (SPAdes)	Environmental	Open in IMG/M
3300027903	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 (SPAdes)	Environmental	Open in IMG/M
3300027986	Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen07_05102014_R1 (SPAdes)	Environmental	Open in IMG/M
3300028381	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes)	Host-Associated	Open in IMG/M
3300028587	Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day3	Environmental	Open in IMG/M
3300028810	Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_151	Environmental	Open in IMG/M
3300029911	III_Bog_N2 coassembly	Environmental	Open in IMG/M
3300031128	Oak Summer Coassembly Site 11 - Champenoux / Amance forest	Environmental	Open in IMG/M
3300031184	Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 13_S	Environmental	Open in IMG/M
3300031538	Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D1	Environmental	Open in IMG/M
3300031908	Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24D1	Environmental	Open in IMG/M
3300031913	Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D4	Environmental	Open in IMG/M
3300031946	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF172	Environmental	Open in IMG/M
3300032002	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3	Host-Associated	Open in IMG/M
3300032012	Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24D3	Environmental	Open in IMG/M
3300032013	Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D3	Environmental	Open in IMG/M
3300032075	Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D3	Environmental	Open in IMG/M
3300032144	Garden soil microbial communities collected in Santa Monica, California, United States - Edamame soil	Environmental	Open in IMG/M
3300032157	Garden soil microbial communities collected in Santa Monica, California, United States - V. faba soil	Environmental	Open in IMG/M
3300034151	Sediment microbial communities from East River floodplain, Colorado, United States - 2_s17	Environmental	Open in IMG/M
3300034819	Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1	Host-Associated	Open in IMG/M

Geographical Distribution

Zoom:	Powered by OpenStreetMap

Structure Viewer


Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100	pTM-score: 0.25
Secondary Structure: α-helix β-sheet Coil Turn	pTM-score: 0.25
Powered by PDBe Molstar

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

Metagenome / Metatranscriptome Family F082841

Overview

Multiple Sequence Alignments

Structure & Topology

Predicted Secondary Structure and Topology

Predicted 3D Structure

Low Quality Model:

Gene Neighborhood

Neighboring Pfam domains

Neighboring Clusters of Orthologous Genes (COGs)

Phylogeny

NCBI Taxonomy

Associated Scaffolds

Environmental Properties

Associated Habitat Types

Associated Samples

Family Sequences

Protein ID	Sample Taxon ID	Habitat	Sequence
F24TB_133960602	3300000550	Soil	AKAIAAGQTLEQAQTSVLMDAYKDWEFYAQQRPLNVAGMYRSLAGSR*
F14TC_1002737801	3300000559	Soil	AAGQTLEQAQASVTMDAYKDWEFYAQQRPANVAGTYRALKAGN*
JGI10216J12902_1191225842	3300000956	Soil	DAVAKAVAAGQTLEQAQASVLMDAYKDWEFYEVQRPQNVAGMYRALTAGRR*
Ga0062595_1019808902	3300004479	Soil	KEAVAAAIAQGQTLEQAQASVLMQDYKDWEFYAQQRPQNVAGMYRALSARR*
Ga0066388_1024611622	3300005332	Tropical Forest Soil	TLEDAQKSVTMDAYKDWEFYEQQRPQNVAGMYRALSASR*
Ga0068869_1001211093	3300005334	Miscanthus Rhizosphere	IAAGQTLEQAQASVTMDAYKEWEFYAQQRPGNVAGTYRALTSGK*
Ga0070700_1014532301	3300005441	Corn, Switchgrass And Miscanthus Rhizosphere	AGQTLEQAQASVTMDAYKGWEFYDQQRPGNVAGTYRALTSNK*
Ga0070678_1010571001	3300005456	Miscanthus Rhizosphere	QLRDAVAKSIAAGQTLEQAQASILMDDYKDWEFYAAQRPQNIAGTYRALAKR*
Ga0070681_115504532	3300005458	Corn Rhizosphere	GQTLEQAQASVLMDAYKDWEFYAQQRPQNVAGMYRALSSARR*
Ga0070735_103323101	3300005534	Surface Soil	LEQAQASVLMENYKDWEFYDVQRPQNVAGTYRALSAKR*
Ga0070732_108774651	3300005542	Surface Soil	IAAGQTLEQAQASVLMENYRDWEFYEQQHAQNVAGTYRALKGN*
Ga0068852_1023251771	3300005616	Corn Rhizosphere	EQAQASILMDDYKDWEFYAVQRPQNVAGTYRALAKR*
Ga0066903_1007433191	3300005764	Tropical Forest Soil	KAIAAGQTLEDAQKSVTMDAYKDWEFYEQQRPQNVAGMYRALSASR*
Ga0066903_1024681561	3300005764	Tropical Forest Soil	AVVKAVAAGQTLEQAQAGVTMAAYTGWEFYEQQRPANVAGTYRALMSNK*
Ga0066903_1036722541	3300005764	Tropical Forest Soil	QKSVTMDAYKDWEFYDQQRPQNVAGMYRALSPQR*
Ga0068860_1017891083	3300005843	Switchgrass Rhizosphere	GQTLEQAQASVTMDAYKDWEFYAQQRPGNVAGTYRALTSGK*
Ga0066696_105942612	3300006032	Soil	QTVEQVQAGILMDNYKGWEFYDQQRPQNVAGTYRALMSNR*
Ga0097621_1013504332	3300006237	Miscanthus Rhizosphere	VAKSIAAGQTLEQAQDSVTMDAYKDWEFYAQQRPGNVAGTYRALTSGR*
Ga0068871_1008022662	3300006358	Miscanthus Rhizosphere	GQTLEQAQASVLMQDYKDWEFYAQQRPQNVAGMYRALSARR*
Ga0074050_117102183	3300006577	Soil	AAGQTLEQAQASVLMDAYKDWEFYAVQRPQNVAGMYRALSARR*
Ga0079222_105238683	3300006755	Agricultural Soil	AIAAGQTLEQAQAGVLMENYKDWEFYDQQRAQNVAGTYRALTAKR*
Ga0079221_105034411	3300006804	Agricultural Soil	IAAGQTLEQAQASVLMEKYKDWEFYDQQRPQNVAGTYRALTAKR*
Ga0079220_115885331	3300006806	Agricultural Soil	QTLEQAQASVLMEQYKDWEFYDLQRPQNVAGTYRALAPKR*
Ga0075428_1014852843	3300006844	Populus Rhizosphere	AAGQTLEQAQASVTMDAYKDWEFYEQQRPANVAGTYRALMNGR*
Ga0075428_1025867212	3300006844	Populus Rhizosphere	QAQASVTMDAYKDWEFYEQQRPANVAGTYRALTAGR*
Ga0075420_1017078932	3300006853	Populus Rhizosphere	EQAQASVTMDAYKDWEFYAQQRPANVAGTYRALTSGK*
Ga0075434_1018934032	3300006871	Populus Rhizosphere	AGQTLEQAQAGVLMEAYKGWEFYDQQRPANVAGTYRALSSNR*
Ga0068865_1002368383	3300006881	Miscanthus Rhizosphere	AIAAGQSLEQAQAAVTMDAYKDWEFYAQQRPQNVAGMYRALSARR*
Ga0079215_101929873	3300006894	Agricultural Soil	EQAQASVTMDGYKEWEFYAQQRPANVAGTYRALTSGQ*
Ga0075424_1028623311	3300006904	Populus Rhizosphere	GQTLEQAQATITMDAYKDWEFYDAQRPQNVAGMYRALSAGRR*
Ga0079216_111330731	3300006918	Agricultural Soil	QTLEQAQASVTMDAYKGWDFYAQQRPQNVAGMYRALTAGGR*
Ga0075419_111071042	3300006969	Populus Rhizosphere	EQAQASVTMDAYKDWEFYAQQRPANVAGTYRALTSGR*
Ga0079218_100932311	3300007004	Agricultural Soil	AGQTLEQAQAGVTMDAYKDWEFYEQQRPANVAGTYRALMNNR*
Ga0099830_118288202	3300009088	Vadose Zone Soil	AISAGQTLEQAQSSVLMENYKDWEFYEQQHAQNVAGTYRALKGN*
Ga0075418_123713501	3300009100	Populus Rhizosphere	IAAGQTLEQAQASVTMDAYKDWEFYAQQRPANVAGTYRALTSGK*
Ga0066709_1020060691	3300009137	Grasslands Soil	QAQASVTMDAYKGWEFYEQQRPGNVAGTYRAISSNR*
Ga0111538_136677492	3300009156	Populus Rhizosphere	LEQAQKSVSMEKYKDWDFYEQQRPQNVAGMYRALTAGR*
Ga0105238_126773031	3300009551	Corn Rhizosphere	EQAQASILMDDYKDWEFYAAQRPQNIAGTYRALAKR*
Ga0126314_108113312	3300010042	Serpentine Soil	AKAVAAGQTLEQAQASITMDAYKDWEFYEQQRPQNVAGMYRALSARRP*
Ga0126306_113611371	3300010166	Serpentine Soil	ANAIAAGQTLEQAQASVTMDAYKDWEFYAQQRPANVAGTYRALNAGR*
Ga0126376_122000531	3300010359	Tropical Forest Soil	AIAAGQTLEEAQKSVTMDAYKDWEFYEQQRPQNVAGMYRALMAASK*
Ga0126372_114161791	3300010360	Tropical Forest Soil	GQTLEDAQKSVTMDAYKDWEFYEQQRPQNVAGMYRALSASR*
Ga0126377_126812282	3300010362	Tropical Forest Soil	AQKSVTMDAYKDWEFYEQQRPQNVSGMYRALTASR*
Ga0126383_136467141	3300010398	Tropical Forest Soil	AGQTLEEAQKSVTMDAYKDWEFYEQQRPQNVSGMYRSLTASR*
Ga0134123_116417463	3300010403	Terrestrial Soil	LEQAQAAVTMDAYKDWEFYAQQRPQNVAGMYRALSARR*
Ga0105246_123806351	3300011119	Miscanthus Rhizosphere	TLEQAQASVLMDAYKGWEFYDQQRPGNVAGTYRALTSNR*
Ga0150983_131763002	3300011120	Forest Soil	LEQIQAGVLMENYKNWEFFDQQRPQNVAGTYRALMNNK*
Ga0137323_10771212	3300011409	Soil	AGQTLEQTQKSVTMDAYKDWDFYEQQRPQNVAGMYRALTAK*
Ga0137323_11051901	3300011409	Soil	VSKAVAAGQTLEQAQASVMMDAYKDWEFYQQQRPGNVAGTYRALQAGR*
Ga0137422_10453232	3300011416	Soil	ELRAAVAKAIAAGQTLEAAQKSVTMDAYKDWEFYEQQRPQNVAGMYRALGGK*
Ga0137433_11954521	3300011440	Soil	AGQTLEQAQASVTMDAYKDWEFYEQQRPASVAGTYRALNAGR*
Ga0137380_106880631	3300012206	Vadose Zone Soil	AQKSVLMEAYKDWEFYDQQRPQNVAGMYRALTANR*
Ga0150985_1053559593	3300012212	Avena Fatua Rhizosphere	GQTLEQAQAAVTMDAYKEWEFYDAQRPQNVAGMYRAMTAKK*
Ga0150984_1110341331	3300012469	Avena Fatua Rhizosphere	VGEAQKSVTMDAYKDWEFYDQQRPQNVAGMYRALKK*
Ga0157346_10232172	3300012480	Arabidopsis Rhizosphere	AAVAKSIAAGQSVEQAQASVTMDAYKDWEFYAQQRPANVAGTYRALTSGR*
Ga0157294_102865971	3300012892	Soil	DAVAKSIAAGQTLEQAQASVTMDAYKDWEFYAQQRPGNVAGTYRALTSGK*
Ga0157286_102664573	3300012908	Soil	LRAAVAKAIAAGQTLEQAQASVTMDAYKDWEFYEQQRSANVAGTFRALTAGR*
Ga0137394_103971711	3300012922	Vadose Zone Soil	TLEQAQASVTMDAYKAWDFYEQQRPQNVAGMYRALSSNRR*
Ga0153915_113698631	3300012931	Freshwater Wetlands	IADGQTLEQAQASVLMEDYKDWEFYAVQRPLNVAGTYRALKGN*
Ga0126369_102093863	3300012971	Tropical Forest Soil	GQTVEEAQKSVTMDAYKDWEFYEQQRPQNVVGMYRALTADRK*
Ga0164307_107958532	3300012987	Soil	DAVAKAIAAGQTLEQAQASVLMENYKDWEFYEQQHAQNVAGTYRALKGN*
Ga0157375_133240912	3300013308	Miscanthus Rhizosphere	EQAQASVLMDTYKGWEFYEQQRPANVAGTYRALTSNK*
Ga0157377_101694384	3300014745	Miscanthus Rhizosphere	LRAAVAKAIAAGQTLEQAQASVTMDAYKDWEFYEQQRPANVAGTYRALTAGR*
Ga0157377_111986681	3300014745	Miscanthus Rhizosphere	QKAITAGQTVEQVQKSVTMEKYKDWDFYEQQRPQNVAGMYRALTAGR*
Ga0182030_104936523	3300014838	Bog	ELLSDAVAKSIAAGQTLEQAQASILMDDYKDWEFYAVQRPQNIAGTYRALAKR*
Ga0134085_103014831	3300015359	Grasslands Soil	TIEQAQKSVMMEAYKDWEFYDQQRPQNVTGMYRALSGSR*
Ga0132255_1052948242	3300015374	Arabidopsis Rhizosphere	LEQAQASVTMDAYKDWEFYAQQRPGNVAGTYRALTSGR*
Ga0182037_111712701	3300016404	Soil	AQASVLMADYKDWEFYAQQRPQNVAGTYRALAAKR
Ga0163161_117835312	3300017792	Switchgrass Rhizosphere	QTLEQAQASVLMDAYKGWEFYEQQRPANVAGTYRALTSNK
Ga0163161_118713902	3300017792	Switchgrass Rhizosphere	EQAQASVLMDAYKGWEFYEQQRPGNVAGTYRALTSNK
Ga0190268_105895251	3300018466	Soil	TRDSVLMSEYASWEFYEQQRPQNVAGAYRLLTASR
Ga0190270_114026691	3300018469	Soil	QTLEQAQASVTMDAYKGWDFYAQQRPQNVAGMYRALSTNPR
Ga0190270_126895472	3300018469	Soil	QTLEQAQASVTMDAYKDWEFFMQQRAANVAGFYRALSAGR
Ga0190274_117807663	3300018476	Soil	GQTLEQAQASVTMDAYKEWEFYAQQRPGNVAGTYRALTSGK
Ga0066669_116973861	3300018482	Grasslands Soil	GQTVEQAQAGILMDNYKGWEFYDQQRPQNVAGTYRALTSNR
Ga0179594_103031552	3300020170	Vadose Zone Soil	EQAQANILMEEYRTWEFYDQQRPGNVAGTYRALSSNR
Ga0210395_106620642	3300020582	Soil	AGQTLQQAQESVLMENYKDWEFYAAQRPQNVAGTYRALTSKR
Ga0213852_13211691	3300021858	Watersheds	AVARAIAAGETLQQAHASVLMENYKDWEFYDQQRLQNVAGTYRALTAK
Ga0207673_10608232	3300025290	Corn, Switchgrass And Miscanthus Rhizosphere	MAAGQSVEQAQASVTMDAYKDWEFYAQQRPANVAGTYRALTSGR
Ga0207643_104074591	3300025908	Miscanthus Rhizosphere	VAKAVAAGQTLEQAQASVTMDAYKDWEFFEAQRPQNVAGMYRSMTANRR
Ga0207660_115779472	3300025917	Corn Rhizosphere	EQAQASILMDDYKDWEFYAAQRPQNIAGTYRALAKR
Ga0207657_105218184	3300025919	Corn Rhizosphere	VAKSIAAGQTLEQAQASILMDDYKDWEFYAAQRPQNIAGTYRALAKR
Ga0207657_113102342	3300025919	Corn Rhizosphere	AAVAKSIAAGQTLEQAQASVTMDAYKDWEFYAQQRPGNVAGTYRALTSGR
Ga0207704_109837432	3300025938	Miscanthus Rhizosphere	AKSIAAGQTLEQAQASILMDDYKDWEFYAAQRPQNIAGTYRALAKR
Ga0207711_103419863	3300025941	Switchgrass Rhizosphere	QTLEQAQASVTMDAYKSWDFYEQQRPQNVAGMYRALSSNRR
Ga0207689_101879233	3300025942	Miscanthus Rhizosphere	QTLEQAQASVTMDAYKDWEFYAQQRPGNVAGTYRALTSGR
Ga0207651_119940022	3300025960	Switchgrass Rhizosphere	LLKAVAAGQSLEDAQKSVTMDAYKDWEFYDQQRPQNVAGMY
Ga0207641_116701623	3300026088	Switchgrass Rhizosphere	QAQASVTMDAYKDWEFYEQQRPANVAGTYRALTTGR
Ga0207648_103374701	3300026089	Miscanthus Rhizosphere	TLEQAQASVMMEAYKAWDFYEQQRPQNVAGMYRALSASRR
Ga0207683_101493213	3300026121	Miscanthus Rhizosphere	TLEQAQASVTMDAYKDWEFYAQQRPGNVAGTYRALTSGR
Ga0209158_12650822	3300026333	Soil	KAIASGQTLEQVQAGVLMENYKNWEFFDQQRPQNVAGTYRALMNNK
Ga0209161_102643552	3300026548	Soil	REELKDAVARAIAAGQTIEQAQKSVMMEAYKDWEFYDQQRPQNVTGMYRALSGSR
Ga0209074_101417493	3300027787	Agricultural Soil	LEQAQAGVLMENYKDWEFYDQQRAQNVAGTYRALTAKR
Ga0209488_105916661	3300027903	Vadose Zone Soil	KEAVAKAISAGQTLEQAQSSVLMENYKDWEFYEQQHAQNVAGTYRALKGN
Ga0209168_104562422	3300027986	Surface Soil	LEQAQASVLMENYKDWEFYDVQRPQNVAGTYRALSAKR
Ga0268264_103039271	3300028381	Switchgrass Rhizosphere	VAAAIAQGQTLEQAQASVLMQDYKDWEFYAQQRPQNVAGMYRALSARR
Ga0247828_107424202	3300028587	Soil	AQDSVTMDAYKDWEFYAQQRPGNVAGTYRALTSGR
Ga0307294_103952631	3300028810	Soil	ELKTAVAAAVAAGQTLEQAQASVLMDAYKDWEFYAQQRPQNVAGMYRALSTKR
Ga0311361_109934382	3300029911	Bog	QLGAAVAKAIAAGQTLEQAQASVLMEDYKDWEFYAVQRPQNVAGTYRALTSKK
Ga0170823_133050123	3300031128	Forest Soil	QTLEQAQASVLMANYKDWEFYDQQHAQNVAGTYRALKGN
Ga0307499_103366362	3300031184	Soil	AIAAGQTLEQAQASVLMDAYKGWEFYEQQRPANVAGTYRALTSNK
Ga0310888_103734202	3300031538	Soil	KSIAAGQTLEQAQASVTMDAYKDWEFYAQQRPGNVAGTYRALTSGR
Ga0310900_100150345	3300031908	Soil	RDAVAKAIAAGQTLEQAQASVTMDAYRNWEFYEQQRPGNVAGTYRALNAGR
Ga0310891_100952971	3300031913	Soil	TLEQAQASVTMDAYKDWEFYEQQRPANVAGTYRALTTGR
Ga0310910_106292121	3300031946	Soil	QAQATVLMDGYKDWEFYALQRPQNVAGTYRALAAQR
Ga0307416_1026347652	3300032002	Rhizosphere	MQDAVAKAIAAGQTLEQAQASVVMDAYKDWEFFAQQRPQNVAGTYRALTAAR
Ga0310902_109143723	3300032012	Soil	KAIAAGQTLEQAQASVTMDAYKDWEFYEQQRPANVAGTYRALTAGR
Ga0310906_109678882	3300032013	Soil	ELRAAVAKSIAAGQTLEQAQASVTMDAYKDWEFYAQQRPGNVAGTYRALTSGR
Ga0310890_100983453	3300032075	Soil	SIAAGQTLEQAQASVTMDAYKDWEFYAQQRPANVTGTYRALTSGR
Ga0315910_112346781	3300032144	Soil	KSIAAGQTLEQAQSSVTMDAYKDWEFYEQQRPGNVAGTYRAITAGR
Ga0315912_109048973	3300032157	Soil	AVAKSIAAGQTLEQAQAGVTMDAYKDWEFYAQQRPGNVAGTYRALTSGK
Ga0364935_0285541_3_131	3300034151	Sediment	AGQTLEQAQATVTMDAYKDWEFYAQQRPGNVAGTYRALTSGK
Ga0373958_0030101_2_151	3300034819	Rhizosphere Soil	AVAKSIAAGQSVEQAQASVTMDAYKDWEFYAQQRPANVAGTYRALTSGR

Hidden Markov Model


Click on a Sequence Logo column to get its information.
Powered by Skylign