Metagenome / Metatranscriptome Family F082950

Basic Information
Family ID	F082950
Family Type	Metagenome / Metatranscriptome
Number of Sequences	113
Average Sequence Length	40 residues
Representative Sequence	MAARLRSTSSSVVAQDETLIRIAVRPCQTVPPHQHVPS
Number of Associated Samples	104
Number of Associated Scaffolds	113

Quality Assessment
Transcriptomic Evidence	Yes
Most common taxonomic group	Bacteria
% of genes with valid RBS motifs	41.59 %
% of genes near scaffold ends (potentially truncated)	96.46 %
% of genes from short scaffolds (< 2000 bps)	90.27 %
Associated GOLD sequencing projects	100
AlphaFold2 3D model prediction	Yes
3D model pTM-score	0.37

Most Common Taxonomy
Group	Bacteria (80.531 % of family members)
NCBI Taxonomy ID	2
Taxonomy	All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (7.080 % of family members)
Environment Ontology (ENVO)	Unclassified (26.549 % of family members)
Earth Microbiome Project Ontology (EMPO)	Free-living → Non-saline → Soil (non-saline) (45.133 % of family members)

Full Alignment
Alignment of all the sequences in the family.

Powered by MSAViewer

Seed Alignment
Alignment of a non-redundant set of sequences, used to build the family's HMM profile.

Powered by MSAViewer

AlphaFold2 Input Alignment
Refined alignment used as input for AlphaFold2.

Powered by MSAViewer

Predicted Topology & Secondary Structure
Classification:	Globular	Signal Peptide:	No	Secondary Structure distribution:	α-helix: 34.85% β-sheet: 0.00% Coil/Unstructured: 65.15%
Feature Viewer

Powered by Feature Viewer

Pfam ID	Name	% Frequency in 113 Family Scaffolds
PF06271	RDD	7.96
PF08002	DUF1697	5.31
PF07883	Cupin_2	2.65
PF12867	DinB_2	2.65
PF07729	FCD	1.77
PF00704	Glyco_hydro_18	1.77
PF00440	TetR_N	1.77
PF12792	CSS-motif	1.77
PF00266	Aminotran_5	1.77
PF00005	ABC_tran	1.77
PF13450	NAD_binding_8	1.77
PF02518	HATPase_c	1.77
PF00206	Lyase_1	0.88
PF02627	CMD	0.88
PF01436	NHL	0.88
PF06674	DUF1176	0.88
PF01177	Asp_Glu_race	0.88
PF07221	GlcNAc_2-epim	0.88
PF05235	CHAD	0.88
PF12680	SnoaL_2	0.88
PF11918	Peptidase_S41_N	0.88
PF13103	TonB_2	0.88
PF00903	Glyoxalase	0.88
PF11902	DUF3422	0.88
PF04542	Sigma70_r2	0.88
PF00156	Pribosyltran	0.88
PF13180	PDZ_2	0.88
PF03459	TOBE	0.88
PF17137	DUF5110	0.88
PF01346	FKBP_N	0.88
PF04480	DUF559	0.88
PF02954	HTH_8	0.88
PF08327	AHSA1	0.88
PF05694	SBP56	0.88
PF01850	PIN	0.88
PF04909	Amidohydro_2	0.88
PF07589	PEP-CTERM	0.88
PF00480	ROK	0.88
PF06559	DCD	0.88
PF06723	MreB_Mbl	0.88
PF01872	RibD_C	0.88
PF04519	Bactofilin	0.88
PF13644	DKNYY	0.88
PF02574	S-methyl_trans	0.88
PF07730	HisKA_3	0.88
PF02146	SIR2	0.88
PF03466	LysR_substrate	0.88
PF01197	Ribosomal_L31	0.88
PF05746	DALR_1	0.88

COG ID	Name	Functional Category	% Frequency in 113 Family Scaffolds
COG1714	Uncharacterized membrane protein YckC, RDD family	Function unknown [S]	7.96
COG3797	Uncharacterized conserved protein, DUF1697 family	Function unknown [S]	5.31
COG1802	DNA-binding transcriptional regulator, GntR family	Transcription [K]	1.77
COG1940	Sugar kinase of the NBD/HSP70 family, may contain an N-terminal HTH domain	Transcription [K]	1.77
COG2186	DNA-binding transcriptional regulator, FadR family	Transcription [K]	1.77
COG0018	Arginyl-tRNA synthetase	Translation, ribosomal structure and biogenesis [J]	0.88
COG0254	Ribosomal protein L31	Translation, ribosomal structure and biogenesis [J]	0.88
COG0262	Dihydrofolate reductase	Coenzyme transport and metabolism [H]	0.88
COG0545	FKBP-type peptidyl-prolyl cis-trans isomerase	Posttranslational modification, protein turnover, chaperones [O]	0.88
COG0568	DNA-directed RNA polymerase, sigma subunit (sigma70/sigma32)	Transcription [K]	0.88
COG0599	Uncharacterized conserved protein YurZ, alkylhydroperoxidase/carboxymuconolactone decarboxylase family	General function prediction only [R]	0.88
COG0646	Methionine synthase I (cobalamin-dependent), methyltransferase domain	Amino acid transport and metabolism [E]	0.88
COG0717	dCTP deaminase	Nucleotide transport and metabolism [F]	0.88
COG0751	Glycyl-tRNA synthetase, beta subunit	Translation, ribosomal structure and biogenesis [J]	0.88
COG0846	NAD-dependent protein deacetylase, SIR2 family	Posttranslational modification, protein turnover, chaperones [O]	0.88
COG1077	Cell shape-determining ATPase MreB, actin-like superfamily	Cell cycle control, cell division, chromosome partitioning [D]	0.88
COG1191	DNA-directed RNA polymerase specialized sigma subunit	Transcription [K]	0.88
COG1595	DNA-directed RNA polymerase specialized sigma subunit, sigma24 family	Transcription [K]	0.88
COG1664	Cytoskeletal protein CcmA, bactofilin family	Cytoskeleton [Z]	0.88
COG1985	Pyrimidine reductase, riboflavin biosynthesis	Coenzyme transport and metabolism [H]	0.88
COG2040	Homocysteine/selenocysteine methylase (S-methylmethionine-dependent)	Amino acid transport and metabolism [E]	0.88
COG2128	Alkylhydroperoxidase family enzyme, contains CxxC motif	Inorganic ion transport and metabolism [P]	0.88
COG2942	Mannose or cellobiose epimerase, N-acyl-D-glucosamine 2-epimerase family	Carbohydrate transport and metabolism [G]	0.88
COG3025	Inorganic triphosphatase YgiF, contains CYTH and CHAD domains	Inorganic ion transport and metabolism [P]	0.88
COG3850	Signal transduction histidine kinase NarQ, nitrate/nitrite-specific	Signal transduction mechanisms [T]	0.88
COG3851	Signal transduction histidine kinase UhpB, glucose-6-phosphate specific	Signal transduction mechanisms [T]	0.88
COG4564	Signal transduction histidine kinase	Signal transduction mechanisms [T]	0.88
COG4585	Signal transduction histidine kinase ComP	Signal transduction mechanisms [T]	0.88
COG4941	Predicted RNA polymerase sigma factor, contains C-terminal TPR domain	Transcription [K]	0.88
COG5607	CHAD domain, binds inorganic polyphosphates	Function unknown [S]	0.88

NCBI Taxonomy

Select NCBI taxonomy Level:

Name	Rank	Taxonomy	Distribution
All Organisms	root	All Organisms	80.53 %
Unclassified	root	N/A	19.47 %

Name	Rank	Taxonomy	Distribution
cellular organisms	root	All Organisms → cellular organisms	80.53 %
Unclassified	root	N/A	19.47 %

Name	Rank	Taxonomy	Distribution
Bacteria	superkingdom	All Organisms → cellular organisms → Bacteria	80.53 %
Unclassified	root	N/A	19.47 %

Name	Rank	Taxonomy	Distribution
Acidobacteria	phylum	All Organisms → cellular organisms → Bacteria → Acidobacteria	19.47 %
Unclassified	root	N/A	19.47 %
Proteobacteria	phylum	All Organisms → cellular organisms → Bacteria → Proteobacteria	15.93 %
Terrabacteria group	clade	All Organisms → cellular organisms → Bacteria → Terrabacteria group	5.31 %
PVC group	clade	All Organisms → cellular organisms → Bacteria → PVC group	3.54 %
FCB group	clade	All Organisms → cellular organisms → Bacteria → FCB group	0.88 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	19.47 %
unclassified Acidobacteria	no rank	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria	6.19 %
Gammaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	6.19 %
Acidobacteriia	class	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia	5.31 %
Verrucomicrobia	phylum	All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia	3.54 %
Actinobacteria	phylum	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	3.54 %
Betaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	1.77 %
delta/epsilon subdivisions	subphylum	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions	1.77 %
Chloroflexi	phylum	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi	0.88 %
Gemmatimonadetes	phylum	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes	0.88 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	19.47 %
Acidobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	6.19 %
Xanthomonadales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales	4.42 %
Acidobacteriales	order	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales	2.65 %
Bryobacterales	order	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales	2.65 %
Burkholderiales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales	1.77 %
Deltaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria	1.77 %
Actinomycetia	class	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia	1.77 %
Thermoleophilia	class	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia	0.88 %
Nevskiales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales	0.88 %
Verrucomicrobiae	class	All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae	0.88 %
Thermomicrobia	class	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Thermomicrobia	0.88 %
unclassified Verrucomicrobia	no rank	All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia	0.88 %
Opitutae	class	All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae	0.88 %
unclassified Gemmatimonadetes	no rank	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes	0.88 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	19.47 %
Acidobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	6.19 %
Xanthomonadaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Xanthomonadaceae	3.54 %
Acidobacteriaceae	family	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae	2.65 %
Solibacteraceae	family	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae	2.65 %
Desulfobacterales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales	1.77 %
Burkholderiales genera incertae sedis	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiales genera incertae sedis	1.77 %
Actinomycetia	class	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia	1.77 %
Solirubrobacterales	order	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales	0.88 %
Sinobacteraceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Sinobacteraceae	0.88 %
Gemmatimonadetes bacterium	species	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium	0.88 %
Verrucomicrobia bacterium A1	species	All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium A1	0.88 %
unclassified Xanthomonadales	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → unclassified Xanthomonadales	0.88 %
Sphaerobacteridae	subclass	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Thermomicrobia → Sphaerobacteridae	0.88 %
Opitutales	order	All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales	0.88 %
Verrucomicrobiales	order	All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales	0.88 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	19.47 %
Acidobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	6.19 %
Lysobacter	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Xanthomonadaceae → Lysobacter	2.65 %
Candidatus Sulfopaludibacter	genus	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter	1.77 %
Desulfobacteraceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae	1.77 %
Actinomycetia	class	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia	1.77 %
Methylibium	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiales genera incertae sedis → Methylibium	0.88 %
Occallatibacter	genus	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Occallatibacter	0.88 %
Xanthomonadales bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → unclassified Xanthomonadales → Xanthomonadales bacterium	0.88 %
Rubrivivax	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiales genera incertae sedis → Rubrivivax	0.88 %
Arenimonas	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Xanthomonadaceae → Arenimonas	0.88 %
Verrucomicrobiaceae	family	All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobiaceae	0.88 %
Sphaerobacterales	order	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Thermomicrobia → Sphaerobacteridae → Sphaerobacterales	0.88 %
unclassified Acidobacteriaceae	no rank	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → unclassified Acidobacteriaceae	0.88 %
Candidatus Solibacter	genus	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter	0.88 %
Hydrocarboniphaga	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Sinobacteraceae → Hydrocarboniphaga	0.88 %
Opitutaceae	family	All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae	0.88 %
Solirubrobacterales	order	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales	0.88 %
Gemmatimonadetes bacterium	species	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium	0.88 %
Verrucomicrobia bacterium A1	species	All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium A1	0.88 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	19.47 %
Acidobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	6.19 %
Lysobacter enzymogenes	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Xanthomonadaceae → Lysobacter → Lysobacter enzymogenes	2.65 %
Desulfobotulus	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae → Desulfobotulus	1.77 %
Candidatus Sulfopaludibacter	genus	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter	1.77 %
Actinomycetia	class	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia	1.77 %
Acidobacteriaceae bacterium URHE0068	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → unclassified Acidobacteriaceae → Acidobacteriaceae bacterium URHE0068	0.88 %
unclassified Rubrivivax	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiales genera incertae sedis → Rubrivivax → unclassified Rubrivivax	0.88 %
unclassified Methylibium	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiales genera incertae sedis → Methylibium → unclassified Methylibium	0.88 %
Lacunisphaera	genus	All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera	0.88 %
Occallatibacter savannae	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Occallatibacter → Occallatibacter savannae	0.88 %
Arenimonas oryziterrae	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Xanthomonadaceae → Arenimonas → Arenimonas oryziterrae	0.88 %
Prosthecobacter	genus	All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobiaceae → Prosthecobacter	0.88 %
Sphaerobacterineae	suborder	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Thermomicrobia → Sphaerobacteridae → Sphaerobacterales → Sphaerobacterineae	0.88 %
Xanthomonadales bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → unclassified Xanthomonadales → Xanthomonadales bacterium	0.88 %
Candidatus Solibacter	genus	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter	0.88 %
Hydrocarboniphaga	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Sinobacteraceae → Hydrocarboniphaga	0.88 %
Solirubrobacterales	order	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales	0.88 %
Gemmatimonadetes bacterium	species	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium	0.88 %
Verrucomicrobia bacterium A1	species	All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium A1	0.88 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	19.47 %
Acidobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	6.19 %
Lysobacter enzymogenes	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Xanthomonadaceae → Lysobacter → Lysobacter enzymogenes	2.65 %
Desulfobotulus	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae → Desulfobotulus	1.77 %
Candidatus Sulfopaludibacter	genus	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter	1.77 %
Actinomycetia	class	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia	1.77 %
Arenimonas oryziterrae DSM 21050 = YC6267	strain	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Xanthomonadaceae → Arenimonas → Arenimonas oryziterrae → Arenimonas oryziterrae DSM 21050 = YC6267	0.88 %
Methylibium sp. NZG	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiales genera incertae sedis → Methylibium → unclassified Methylibium → Methylibium sp. NZG	0.88 %
Lacunisphaera limnophila	species	All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila	0.88 %
Rubrivivax sp.	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiales genera incertae sedis → Rubrivivax → unclassified Rubrivivax → Rubrivivax sp.	0.88 %
Sphaerobacteraceae	family	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Thermomicrobia → Sphaerobacteridae → Sphaerobacterales → Sphaerobacterineae → Sphaerobacteraceae	0.88 %
Prosthecobacter debontii	species	All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobiaceae → Prosthecobacter → Prosthecobacter debontii	0.88 %
Acidobacteriaceae bacterium URHE0068	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → unclassified Acidobacteriaceae → Acidobacteriaceae bacterium URHE0068	0.88 %
Occallatibacter savannae	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Occallatibacter → Occallatibacter savannae	0.88 %
Xanthomonadales bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → unclassified Xanthomonadales → Xanthomonadales bacterium	0.88 %
Candidatus Solibacter	genus	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter	0.88 %
Hydrocarboniphaga	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Sinobacteraceae → Hydrocarboniphaga	0.88 %
Solirubrobacterales	order	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales	0.88 %
Gemmatimonadetes bacterium	species	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium	0.88 %
Verrucomicrobia bacterium A1	species	All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium A1	0.88 %

Visualization

Powered by ApexCharts

Associated Scaffolds

Scaffold	Taxonomy	Length	IMG/M Link
2124908039\|B3_v_NODE_125812_len_9783_cov_10_237043	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	9833	Open in IMG/M
3300000789\|JGI1027J11758_11868837	All Organisms → cellular organisms → Bacteria	596	Open in IMG/M
3300000887\|AL16A1W_10447911	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia	897	Open in IMG/M
3300000955\|JGI1027J12803_105647127	All Organisms → cellular organisms → Bacteria → Proteobacteria	1070	Open in IMG/M
3300001538\|A10PFW1_10165655	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia	696	Open in IMG/M
3300002128\|JGI24036J26619_10083015	Not Available	644	Open in IMG/M
3300004184\|Ga0066401_1099044	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → unclassified Xanthomonadales → Xanthomonadales bacterium	523	Open in IMG/M
3300004481\|Ga0069718_15228831	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	2295	Open in IMG/M
3300004594\|Ga0068976_1204378	All Organisms → cellular organisms → Bacteria	1870	Open in IMG/M
3300005175\|Ga0066673_10430802	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium	773	Open in IMG/M
3300005331\|Ga0070670_100935799	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Xanthomonadaceae → Lysobacter → Lysobacter enzymogenes	787	Open in IMG/M
3300005335\|Ga0070666_10602391	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter	802	Open in IMG/M
3300005364\|Ga0070673_100479670	Not Available	1122	Open in IMG/M
3300005539\|Ga0068853_100777578	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Xanthomonadaceae → Arenimonas → Arenimonas oryziterrae → Arenimonas oryziterrae DSM 21050 = YC6267	916	Open in IMG/M
3300005540\|Ga0066697_10781329	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	519	Open in IMG/M
3300005553\|Ga0066695_10300832	All Organisms → cellular organisms → Bacteria	1011	Open in IMG/M
3300005718\|Ga0068866_10760283	Not Available	670	Open in IMG/M
3300005764\|Ga0066903_105606725	All Organisms → cellular organisms → Bacteria → Acidobacteria	661	Open in IMG/M
3300005841\|Ga0068863_101157030	Not Available	779	Open in IMG/M
3300005841\|Ga0068863_101618984	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter	657	Open in IMG/M
3300005921\|Ga0070766_10168571	All Organisms → cellular organisms → Bacteria	1352	Open in IMG/M
3300005994\|Ga0066789_10346785	All Organisms → cellular organisms → Bacteria → Acidobacteria	620	Open in IMG/M
3300005995\|Ga0066790_10047447	All Organisms → cellular organisms → Bacteria	1860	Open in IMG/M
3300006176\|Ga0070765_101617871	All Organisms → cellular organisms → Bacteria → Acidobacteria	609	Open in IMG/M
3300006846\|Ga0075430_101516395	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales	551	Open in IMG/M
3300006854\|Ga0075425_102814731	All Organisms → cellular organisms → Bacteria	535	Open in IMG/M
3300006876\|Ga0079217_10382268	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae → Desulfobotulus	822	Open in IMG/M
3300006880\|Ga0075429_101131840	Not Available	684	Open in IMG/M
3300007255\|Ga0099791_10183395	All Organisms → cellular organisms → Bacteria	984	Open in IMG/M
3300009012\|Ga0066710_101202286	All Organisms → cellular organisms → Bacteria	1174	Open in IMG/M
3300009012\|Ga0066710_103100824	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	643	Open in IMG/M
3300009012\|Ga0066710_103455789	All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium A1	599	Open in IMG/M
3300009038\|Ga0099829_10577993	All Organisms → cellular organisms → Bacteria → Acidobacteria	934	Open in IMG/M
3300009078\|Ga0105106_10007249	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Sinobacteraceae → Hydrocarboniphaga	7965	Open in IMG/M
3300009166\|Ga0105100_10061712	All Organisms → cellular organisms → Bacteria	2177	Open in IMG/M
3300009167\|Ga0113563_11372003	All Organisms → cellular organisms → Bacteria	829	Open in IMG/M
3300009169\|Ga0105097_10468930	All Organisms → cellular organisms → Bacteria	703	Open in IMG/M
3300009638\|Ga0116113_1137432	Not Available	607	Open in IMG/M
3300009816\|Ga0105076_1099643	Not Available	563	Open in IMG/M
3300010358\|Ga0126370_12242640	Not Available	539	Open in IMG/M
3300011028\|Ga0138577_100872	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae	1684	Open in IMG/M
3300011112\|Ga0114947_10478097	Not Available	883	Open in IMG/M
3300012014\|Ga0120159_1207898	Not Available	519	Open in IMG/M
3300012198\|Ga0137364_11036089	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	619	Open in IMG/M
3300012362\|Ga0137361_10737755	All Organisms → cellular organisms → Bacteria	898	Open in IMG/M
3300014165\|Ga0181523_10152875	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	1357	Open in IMG/M
3300014165\|Ga0181523_10828314	All Organisms → cellular organisms → Bacteria	504	Open in IMG/M
3300014495\|Ga0182015_10181391	All Organisms → cellular organisms → Bacteria	1415	Open in IMG/M
3300015359\|Ga0134085_10254492	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	765	Open in IMG/M
3300016294\|Ga0182041_12003480	All Organisms → cellular organisms → Bacteria	539	Open in IMG/M
3300017792\|Ga0163161_11661627	All Organisms → cellular organisms → Bacteria → Acidobacteria	565	Open in IMG/M
3300018003\|Ga0187876_1154429	Not Available	800	Open in IMG/M
3300018042\|Ga0187871_10340468	All Organisms → cellular organisms → Bacteria	829	Open in IMG/M
3300018059\|Ga0184615_10430676	All Organisms → cellular organisms → Bacteria	719	Open in IMG/M
3300018086\|Ga0187769_10094526	All Organisms → cellular organisms → Bacteria	2141	Open in IMG/M
3300018086\|Ga0187769_10373365	All Organisms → cellular organisms → Bacteria	1071	Open in IMG/M
3300018432\|Ga0190275_10136167	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Thermomicrobia → Sphaerobacteridae → Sphaerobacterales → Sphaerobacterineae → Sphaerobacteraceae	2241	Open in IMG/M
3300018432\|Ga0190275_13571893	All Organisms → cellular organisms → Bacteria	503	Open in IMG/M
3300018482\|Ga0066669_10940875	All Organisms → cellular organisms → Bacteria	776	Open in IMG/M
3300018482\|Ga0066669_11897124	All Organisms → cellular organisms → Bacteria → Proteobacteria	554	Open in IMG/M
3300019786\|Ga0182025_1019179	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → unclassified Acidobacteriaceae → Acidobacteriaceae bacterium URHE0068	1221	Open in IMG/M
3300019885\|Ga0193747_1051005	All Organisms → cellular organisms → Bacteria → Terrabacteria group	1028	Open in IMG/M
3300020170\|Ga0179594_10169902	All Organisms → cellular organisms → Bacteria	811	Open in IMG/M
3300020581\|Ga0210399_11229674	All Organisms → cellular organisms → Bacteria → Acidobacteria	593	Open in IMG/M
3300021168\|Ga0210406_10916200	All Organisms → cellular organisms → Bacteria	658	Open in IMG/M
3300021358\|Ga0213873_10220770	Not Available	593	Open in IMG/M
3300021401\|Ga0210393_10558427	Not Available	935	Open in IMG/M
3300021403\|Ga0210397_10759525	Not Available	747	Open in IMG/M
3300021560\|Ga0126371_11743693	All Organisms → cellular organisms → Bacteria → Acidobacteria	745	Open in IMG/M
3300022226\|Ga0224512_10054414	All Organisms → cellular organisms → Bacteria → Proteobacteria	2369	Open in IMG/M
3300022724\|Ga0242665_10288083	All Organisms → cellular organisms → Bacteria	571	Open in IMG/M
3300025864\|Ga0209429_10163640	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter	927	Open in IMG/M
3300025899\|Ga0207642_10189710	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	1127	Open in IMG/M
3300025924\|Ga0207694_11303713	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Xanthomonadaceae → Lysobacter → Lysobacter enzymogenes	614	Open in IMG/M
3300025935\|Ga0207709_10758081	All Organisms → cellular organisms → Bacteria	781	Open in IMG/M
3300025935\|Ga0207709_11654661	All Organisms → cellular organisms → Bacteria → Proteobacteria	532	Open in IMG/M
3300025938\|Ga0207704_10734153	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiales genera incertae sedis → Rubrivivax → unclassified Rubrivivax → Rubrivivax sp.	820	Open in IMG/M
3300026035\|Ga0207703_11980908	Not Available	559	Open in IMG/M
3300026078\|Ga0207702_11518634	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Xanthomonadaceae → Lysobacter → Lysobacter enzymogenes	663	Open in IMG/M
3300026121\|Ga0207683_11014213	All Organisms → cellular organisms → Bacteria	770	Open in IMG/M
3300026343\|Ga0209159_1095825	All Organisms → cellular organisms → Bacteria	1300	Open in IMG/M
3300026467\|Ga0257154_1045793	Not Available	673	Open in IMG/M
3300026523\|Ga0209808_1250539	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	565	Open in IMG/M
3300027371\|Ga0209418_1105551	Not Available	505	Open in IMG/M
3300027765\|Ga0209073_10096251	All Organisms → cellular organisms → Bacteria	1039	Open in IMG/M
3300027846\|Ga0209180_10127180	All Organisms → cellular organisms → Bacteria	1463	Open in IMG/M
3300027853\|Ga0209274_10008414	All Organisms → cellular organisms → Bacteria	4662	Open in IMG/M
3300027857\|Ga0209166_10684319	All Organisms → cellular organisms → Bacteria	517	Open in IMG/M
3300027871\|Ga0209397_10030142	Not Available	1830	Open in IMG/M
3300027871\|Ga0209397_10416368	All Organisms → cellular organisms → Bacteria → Proteobacteria	659	Open in IMG/M
3300027909\|Ga0209382_11782520	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae → Desulfobotulus	600	Open in IMG/M
3300028145\|Ga0247663_1076463	All Organisms → cellular organisms → Bacteria	591	Open in IMG/M
3300028380\|Ga0268265_10190488	All Organisms → cellular organisms → Bacteria	1770	Open in IMG/M
3300028381\|Ga0268264_10401149	Not Available	1318	Open in IMG/M
3300028745\|Ga0302267_10154827	Not Available	1056	Open in IMG/M
3300028775\|Ga0302231_10153590	All Organisms → cellular organisms → Bacteria → Proteobacteria	961	Open in IMG/M
3300028813\|Ga0302157_10726505	All Organisms → cellular organisms → Bacteria → Acidobacteria	504	Open in IMG/M
3300028824\|Ga0307310_10031835	All Organisms → cellular organisms → Bacteria	2123	Open in IMG/M
3300029952\|Ga0311346_10026727	All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia	9003	Open in IMG/M
3300029999\|Ga0311339_11284318	All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila	665	Open in IMG/M
3300030693\|Ga0302313_10031027	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiales genera incertae sedis → Methylibium → unclassified Methylibium → Methylibium sp. NZG	2487	Open in IMG/M
3300030943\|Ga0311366_10694854	All Organisms → cellular organisms → Bacteria	884	Open in IMG/M
3300031235\|Ga0265330_10109857	All Organisms → cellular organisms → Bacteria	1178	Open in IMG/M
3300031802\|Ga0310123_10611873	All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobiaceae → Prosthecobacter → Prosthecobacter debontii	672	Open in IMG/M
3300031823\|Ga0307478_11027949	All Organisms → cellular organisms → Bacteria	688	Open in IMG/M
3300031852\|Ga0307410_10516784	Not Available	985	Open in IMG/M
3300031995\|Ga0307409_101854070	All Organisms → cellular organisms → Bacteria	632	Open in IMG/M
3300032000\|Ga0310903_10501107	All Organisms → cellular organisms → Bacteria → Acidobacteria	634	Open in IMG/M
3300032009\|Ga0318563_10472759	All Organisms → cellular organisms → Bacteria	678	Open in IMG/M
3300032261\|Ga0306920_103736416	Not Available	558	Open in IMG/M
3300033405\|Ga0326727_10404912	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Occallatibacter → Occallatibacter savannae	1249	Open in IMG/M
3300033413\|Ga0316603_10878096	All Organisms → cellular organisms → Bacteria → Proteobacteria	844	Open in IMG/M
3300033482\|Ga0316627_102756793	All Organisms → cellular organisms → Bacteria	521	Open in IMG/M

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:

Habitat	Taxonomy	Distribution
Environmental	Environmental	76.99%
Host-Associated	Host-Associated	23.01%

Habitat	Taxonomy	Distribution
Terrestrial	Environmental → Terrestrial	61.95%
Plants	Host-Associated → Plants	23.01%
Aquatic	Environmental → Aquatic	15.04%

Habitat	Taxonomy	Distribution
Soil	Environmental → Terrestrial → Soil	54.87%
Rhizosphere	Host-Associated → Plants → Rhizosphere	12.39%
Freshwater	Environmental → Aquatic → Freshwater	11.50%
Rhizoplane	Host-Associated → Plants → Rhizoplane	10.62%
Peat	Environmental → Terrestrial → Peat	7.08%
Marine	Environmental → Aquatic → Marine	2.65%
Sediment	Environmental → Aquatic → Sediment	0.89%

Habitat	Taxonomy	Distribution
Unclassified	Environmental → Terrestrial → Soil → Unclassified	41.59%
Epiphytes	Host-Associated → Plants → Rhizoplane → Epiphytes	9.73%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified	8.85%
Wetlands	Environmental → Terrestrial → Soil → Wetlands	7.08%
Unclassified	Environmental → Terrestrial → Peat → Unclassified	7.08%
Sediment	Environmental → Aquatic → Freshwater → Sediment	6.19%
Wetlands	Environmental → Aquatic → Freshwater → Wetlands	5.31%
Loam	Environmental → Terrestrial → Soil → Loam	5.31%
Soil	Host-Associated → Plants → Rhizosphere → Soil	3.54%
Oceanic	Environmental → Aquatic → Marine → Oceanic	1.77%
Sediment	Environmental → Aquatic → Marine → Sediment	0.89%
Unclassified	Environmental → Aquatic → Sediment → Unclassified	0.89%
Sand	Environmental → Terrestrial → Soil → Sand	0.89%
Soil	Host-Associated → Plants → Rhizoplane → Soil	0.89%

Habitat	Taxonomy	Distribution
Unclassified	Environmental → Terrestrial → Soil → Unclassified → Unclassified	14.16%
Grasslands	Environmental → Terrestrial → Soil → Unclassified → Grasslands	10.62%
Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil	9.73%
Unclassified	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified	9.73%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified	8.85%
Unclassified	Environmental → Terrestrial → Peat → Unclassified → Unclassified	7.08%
Unclassified	Environmental → Aquatic → Freshwater → Sediment → Unclassified	6.19%
Permafrost	Environmental → Terrestrial → Soil → Unclassified → Permafrost	4.42%
Forest Soil	Environmental → Terrestrial → Soil → Loam → Forest Soil	4.42%
Bog	Environmental → Aquatic → Freshwater → Wetlands → Bog	3.54%
Unclassified	Environmental → Terrestrial → Soil → Wetlands → Unclassified	3.54%
Permafrost	Environmental → Terrestrial → Soil → Wetlands → Permafrost	3.54%
Unclassified	Host-Associated → Plants → Rhizosphere → Soil → Unclassified	3.54%
Unclassified	Environmental → Aquatic → Freshwater → Wetlands → Unclassified	1.77%
Agricultural Land	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land	1.77%
Unclassified	Environmental → Aquatic → Marine → Oceanic → Unclassified	0.89%
Sediment	Environmental → Aquatic → Marine → Oceanic → Sediment	0.89%
Unclassified	Environmental → Aquatic → Marine → Sediment → Unclassified	0.89%
Unclassified	Environmental → Aquatic → Sediment → Unclassified → Unclassified	0.89%
Agricultural	Environmental → Terrestrial → Soil → Unclassified → Agricultural	0.89%
Grasslands	Environmental → Terrestrial → Soil → Loam → Grasslands	0.89%
Unclassified	Environmental → Terrestrial → Soil → Sand → Unclassified	0.89%
Unclassified	Host-Associated → Plants → Rhizoplane → Soil → Unclassified	0.89%

Habitat	Taxonomy	Distribution
Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil	7.08%
Vadose Zone Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil	5.31%
Soil	Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil	5.31%
Grasslands Soil	Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil	4.42%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere	4.42%
Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil	3.54%
Populus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere	3.54%
Freshwater Sediment	Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment	2.65%
Permafrost	Environmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost	2.65%
Soil	Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil	2.65%
Palsa	Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa	2.65%
Bog	Environmental → Terrestrial → Peat → Unclassified → Unclassified → Bog	2.65%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere	2.65%
Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere	2.65%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere	2.65%
Wetland	Environmental → Aquatic → Freshwater → Sediment → Unclassified → Wetland	1.77%
Peatland	Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland	1.77%
Bog	Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog	1.77%
Tropical Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil	1.77%
Peatlands Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil	1.77%
Agricultural Soil	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil	1.77%
Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil	1.77%
Soil	Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil	1.77%
Tropical Peatland	Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland	1.77%
Soil	Environmental → Terrestrial → Soil → Wetlands → Permafrost → Soil	1.77%
Corn Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere	1.77%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere	1.77%
Freshwater Sediment	Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment	0.89%
Sediment	Environmental → Aquatic → Freshwater → Sediment → Unclassified → Sediment	0.89%
Peatland	Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland	0.89%
Freshwater Wetlands	Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands	0.89%
Marine	Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine	0.89%
Deep Subsurface	Environmental → Aquatic → Marine → Oceanic → Sediment → Deep Subsurface	0.89%
Sediment	Environmental → Aquatic → Marine → Sediment → Unclassified → Sediment	0.89%
Groundwater Sediment	Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment	0.89%
Grasslands Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil	0.89%
Surface Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil	0.89%
Arctic Peat Soil	Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil	0.89%
Soil	Environmental → Terrestrial → Soil → Unclassified → Permafrost → Soil	0.89%
Corn, Switchgrass And Miscanthus Rhizosphere	Environmental → Terrestrial → Soil → Unclassified → Grasslands → Corn, Switchgrass And Miscanthus Rhizosphere	0.89%
Hardwood Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil	0.89%
Soil	Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil	0.89%
Palsa	Environmental → Terrestrial → Soil → Wetlands → Permafrost → Palsa	0.89%
Permafrost	Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost	0.89%
Soil	Environmental → Terrestrial → Soil → Loam → Grasslands → Soil	0.89%
Tropical Forest Soil	Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil	0.89%
Forest Soil	Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil	0.89%
Groundwater Sand	Environmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand	0.89%
Fen	Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen	0.89%
Peat Soil	Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil	0.89%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere	0.89%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizoplane → Soil → Unclassified → Miscanthus Rhizosphere	0.89%
Corn Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere	0.89%
Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere	0.89%

Visualization

Powered by ApexCharts

Associated Samples

Taxon OID	Sample Name	Habitat Type	IMG/M Link
2124908039	Soil microbial communities from permafrost in Bonanza Creek, Alaska, sample from Bog Site B4	Environmental	Open in IMG/M
3300000789	Soil microbial communities from Great Prairies - Iowa, Native Prairie soil	Environmental	Open in IMG/M
3300000887	Permafrost active layer microbial communities from McGill Arctic Research Station, Canada - (A3-65cm-16A)- 1 week illumina	Environmental	Open in IMG/M
3300000955	Soil microbial communities from Great Prairies - Iowa, Native Prairie soil	Environmental	Open in IMG/M
3300001538	Permafrost active layer microbial communities from McGill Arctic Research Station, Canada - (A10-PF 4A)- 1 week illumina	Environmental	Open in IMG/M
3300002128	Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5	Environmental	Open in IMG/M
3300004184	Freshwater sediment methanotrophic microbial communities from Lake Washington under simulated oxygen tension - Sediment Metagenome 1_LOW4	Environmental	Open in IMG/M
3300004481	Combined Assembly of Gp0112041, Gp0112042, Gp0112043	Environmental	Open in IMG/M
3300004594	Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 73 (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300005175	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_122	Environmental	Open in IMG/M
3300005331	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG	Host-Associated	Open in IMG/M
3300005335	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG	Host-Associated	Open in IMG/M
3300005364	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG	Host-Associated	Open in IMG/M
3300005539	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2	Host-Associated	Open in IMG/M
3300005540	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_146	Environmental	Open in IMG/M
3300005553	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_144	Environmental	Open in IMG/M
3300005718	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2	Host-Associated	Open in IMG/M
3300005764	Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)	Environmental	Open in IMG/M
3300005841	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2	Host-Associated	Open in IMG/M
3300005921	Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6	Environmental	Open in IMG/M
3300005994	Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 3 DNA2013-049	Environmental	Open in IMG/M
3300005995	Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 3 DNA2013-050	Environmental	Open in IMG/M
3300006176	Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5	Environmental	Open in IMG/M
3300006846	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4	Host-Associated	Open in IMG/M
3300006854	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4	Host-Associated	Open in IMG/M
3300006876	Agricultural soil microbial communities from Utah to study Nitrogen management - NC AS200	Environmental	Open in IMG/M
3300006880	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3	Host-Associated	Open in IMG/M
3300007255	Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1	Environmental	Open in IMG/M
3300009012	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159	Environmental	Open in IMG/M
3300009038	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG	Environmental	Open in IMG/M
3300009078	Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 10-12cm September2015	Environmental	Open in IMG/M
3300009166	Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 10-12cm May2015	Environmental	Open in IMG/M
3300009167	Freshwater wetland microbial communities from Ohio, USA, analyzing the effect of biotic and abiotic controls - Mud 3 Core 4 Depth 3 metaG - Illumina Assembly (version 2)	Environmental	Open in IMG/M
3300009169	Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 10-12cm May2015	Environmental	Open in IMG/M
3300009638	Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_10_10	Environmental	Open in IMG/M
3300009816	Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N1_0_10	Environmental	Open in IMG/M
3300010358	Tropical forest soil microbial communities from Panama - MetaG Plot_3	Environmental	Open in IMG/M
3300011028	Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 64 (Metagenome Metatranscriptome) (version 2)	Environmental	Open in IMG/M
3300011112	Deep subsurface microbial communities from Mariana Trench to uncover new lineages of life (NeLLi) - CR02 metaG	Environmental	Open in IMG/M
3300012014	Permafrost microbial communities from Nunavut, Canada - A10_80cm_6M	Environmental	Open in IMG/M
3300012198	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaG	Environmental	Open in IMG/M
3300012362	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG	Environmental	Open in IMG/M
3300014165	Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_30_metaG	Environmental	Open in IMG/M
3300014495	Permafrost microbial communities from Stordalen Mire, Sweden - 712P3M metaG	Environmental	Open in IMG/M
3300015359	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09182015	Environmental	Open in IMG/M
3300016294	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178	Environmental	Open in IMG/M
3300017792	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG	Host-Associated	Open in IMG/M
3300018003	Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_17_40	Environmental	Open in IMG/M
3300018042	Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_16_10	Environmental	Open in IMG/M
3300018059	Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_65_coex	Environmental	Open in IMG/M
3300018086	Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_10_MG	Environmental	Open in IMG/M
3300018432	Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 550 T	Environmental	Open in IMG/M
3300018482	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118	Environmental	Open in IMG/M
3300019786	Permafrost microbial communities from Stordalen Mire, Sweden - P3-2 metaG (PacBio error correction)	Environmental	Open in IMG/M
3300019885	Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L1m2	Environmental	Open in IMG/M
3300020170	Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad1_1_08_16fungal (Illumina Assembly)	Environmental	Open in IMG/M
3300020581	Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M	Environmental	Open in IMG/M
3300021168	Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-M	Environmental	Open in IMG/M
3300021358	Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3	Host-Associated	Open in IMG/M
3300021401	Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-O	Environmental	Open in IMG/M
3300021403	Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-O	Environmental	Open in IMG/M
3300021560	Tropical forest soil microbial communities from Panama - MetaG Plot_4	Environmental	Open in IMG/M
3300022226	Sediment microbial communities from San Francisco Bay, California, United States - SF_May12_sed_USGS_13	Environmental	Open in IMG/M
3300022724	Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-17-M (Metagenome Metatranscriptome) (v2)	Environmental	Open in IMG/M
3300025864	Arctic peat soil from Barrow, Alaska - Barrow Graham LP Ref core NGADG0004-212 (SPAdes)	Environmental	Open in IMG/M
3300025899	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes)	Host-Associated	Open in IMG/M
3300025924	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025935	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025938	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes)	Host-Associated	Open in IMG/M
3300026035	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes)	Host-Associated	Open in IMG/M
3300026078	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes)	Host-Associated	Open in IMG/M
3300026121	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300026343	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_144 (SPAdes)	Environmental	Open in IMG/M
3300026467	Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DW-16-A	Environmental	Open in IMG/M
3300026523	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_157 (SPAdes)	Environmental	Open in IMG/M
3300027371	Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM2H0_M1 (SPAdes)	Environmental	Open in IMG/M
3300027765	Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 (SPAdes)	Environmental	Open in IMG/M
3300027846	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG (SPAdes)	Environmental	Open in IMG/M
3300027853	Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1 (SPAdes)	Environmental	Open in IMG/M
3300027857	Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen01_05102014_R1 (SPAdes)	Environmental	Open in IMG/M
3300027871	Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Open_0915_D1 (SPAdes)	Environmental	Open in IMG/M
3300027909	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 (SPAdes)	Host-Associated	Open in IMG/M
3300028145	Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK04	Environmental	Open in IMG/M
3300028380	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes)	Host-Associated	Open in IMG/M
3300028381	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes)	Host-Associated	Open in IMG/M
3300028745	Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Bog_E1_3	Environmental	Open in IMG/M
3300028775	Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N2_2	Environmental	Open in IMG/M
3300028813	Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_N3_3	Environmental	Open in IMG/M
3300028824	Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_197	Environmental	Open in IMG/M
3300029952	II_Bog_N3 coassembly	Environmental	Open in IMG/M
3300029999	I_Palsa_E3 coassembly	Environmental	Open in IMG/M
3300030693	Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_N2_2	Environmental	Open in IMG/M
3300030943	III_Fen_N2 coassembly	Environmental	Open in IMG/M
3300031235	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG	Host-Associated	Open in IMG/M
3300031802	Marine microbial communities from Western Arctic Ocean, Canada - CB6_AW_1057	Environmental	Open in IMG/M
3300031823	Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05	Environmental	Open in IMG/M
3300031852	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3	Host-Associated	Open in IMG/M
3300031995	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2	Host-Associated	Open in IMG/M
3300032000	Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C0D3	Environmental	Open in IMG/M
3300032009	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f19	Environmental	Open in IMG/M
3300032261	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2)	Environmental	Open in IMG/M
3300033405	Lab enriched peat soil microbial communities from McLean, Ithaca, NY, United States - MB29MY	Environmental	Open in IMG/M
3300033413	Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_soil_day10_noCT	Environmental	Open in IMG/M
3300033482	Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M2_C1_D1_C	Environmental	Open in IMG/M

Geographical Distribution

Zoom:	Powered by OpenStreetMap

Structure Viewer


Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100	pTM-score: 0.37
Secondary Structure: α-helix β-sheet Coil Turn	pTM-score: 0.37
Powered by PDBe Molstar

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

Metagenome / Metatranscriptome Family F082950

Overview

Multiple Sequence Alignments

Structure & Topology

Predicted Secondary Structure and Topology

Predicted 3D Structure

Low Quality Model:

Gene Neighborhood

Neighboring Pfam domains

Neighboring Clusters of Orthologous Genes (COGs)

Phylogeny

NCBI Taxonomy

Associated Scaffolds

Environmental Properties

Associated Habitat Types

Associated Samples

Family Sequences

Protein ID	Sample Taxon ID	Habitat	Sequence
B3_v_00494240	2124908039	Soil	MRIIAARLRSTSSCVVAHDETLMRIAVRPCQTVRPA
JGI1027J11758_118688372	3300000789	Soil	MAARLSWMSASVVAQLETETRIAVWPCHSVGPHQQVP
AL16A1W_104479112	3300000887	Permafrost	MRMIASALLSMSAAVVAQEDTLIRIAARPCHSVPPHQQVP
JGI1027J12803_1056471271	3300000955	Soil	MASTLRATSSAVVAHELTLMRIAARPCQRVGPHQHV
A10PFW1_101656552	3300001538	Permafrost	MRMIASALLSMSAAVVAQEDTLIRIAARPCHSVPPHQQVPS
JGI24036J26619_100830151	3300002128	Corn, Switchgrass And Miscanthus Rhizosphere	MASTERSTSSSVVAQEITLTRIAVTPCQMVTPHQHVP
Ga0066401_10990441	3300004184	Freshwater Sediment	MASMLRSTSASVVAQEQTLMRIAARPCQRLPPHQQVPSAWSSS
Ga0069718_152288313	3300004481	Sediment	MAAALRSTSASVVAHEQTLIRIAVCPCQTVPPHQHVPSAWI
Ga0068976_12043782	3300004594	Peatlands Soil	MAVRLFSTSSALVAQEDTLIRMAFLPCQTVPPHQQVPSARISSITF*
Ga0066673_104308023	3300005175	Soil	MGKPNRYARAMRIIAARLCSTSCSVVAQDETLMRIAVRPCHTVPPHQQV
Ga0070670_1009357991	3300005331	Switchgrass Rhizosphere	MLFSTSSSVVAHDDTLIRIAVSPCQTVPPHQHVPSSWIAAI
Ga0070666_106023912	3300005335	Switchgrass Rhizosphere	MPRAIRTMACALRSASASVVAHDETLIRMAVRPCHSVGPHQHVPSSWMAAI
Ga0070673_1004796703	3300005364	Switchgrass Rhizosphere	MIASIERSTSASVVAHEMTLTRIAVRPCHTVGPHQHVPSS
Ga0068853_1007775782	3300005539	Corn Rhizosphere	MDRATRKIAAMLRSMSSSVVAQDETLMRIAVRPCQTVPPHQQ
Ga0066697_107813291	3300005540	Soil	MRIIACRLRFTSVSVVAQDDTLIRIAVFPCHTVPPHQQVPSSW
Ga0066695_103008321	3300005553	Soil	MSPATRIIASRLRSTSSSVVAHDETLIRMAVCPCHTVAPAQH
Ga0068866_107602831	3300005718	Miscanthus Rhizosphere	MAAMEASTSASVVAQEMTLTRIAVLPCHTVTPHQH
Ga0066903_1056067252	3300005764	Tropical Forest Soil	MAETLFSMSASVVDQLLTLMRIAVRPFHTVPPHQQVPS
Ga0068863_1011570301	3300005841	Switchgrass Rhizosphere	MRRIARKLRSISASVVAQEETLMRMAARPCHSVGPHQ
Ga0068863_1016189841	3300005841	Switchgrass Rhizosphere	MPRATRTMACALRSASSSVVAHDETLIRIAVRPCQRVGPHQHVPSSCMAA
Ga0070766_101685711	3300005921	Soil	MASRLSSTSASVVAQEETLTLIADFPCHTVPPHQHVPS
Ga0066789_103467851	3300005994	Soil	VAALRSTSSSVVAQQETEIRMAVCPCQTVPPHQQV
Ga0066790_100474471	3300005995	Soil	MAARLCSTSASVVAQLHTLMRIAVRPCQTVPPHQQ
Ga0070765_1016178711	3300006176	Soil	MAAMLRSTSSSVVAQLETLMRIAVWPCHWVAPHQQVPS
Ga0075430_1015163952	3300006846	Populus Rhizosphere	MTSAQRSTSASVVAQLDTEKRSAGRPCQTVPPAQNVPS
Ga0075425_1028147312	3300006854	Populus Rhizosphere	VVLLSMSSSVVDQLLTLMRMAVRPFQTVPPHQQVPS
Ga0079217_103822681	3300006876	Agricultural Soil	MLCATSASVVAHDETLMRIAMVPCHDVPPHQHVPSCWIAA
Ga0075429_1011318401	3300006880	Populus Rhizosphere	MLTSTSWVVVAHDEMLMRIAARPCHSVPPHQQVPS
Ga0099791_101833952	3300007255	Vadose Zone Soil	MRKIACRLYSTSDSVVAQDDTLIRMAGFPCQTVPPHQQVP
Ga0066710_1012022862	3300009012	Grasslands Soil	MLRSTSAAVVAQDETLIRMAWRPCQTVPPHQQVPSRWTDATTRVV
Ga0066710_1031008241	3300009012	Grasslands Soil	MSPATRIIASRLRSTSSSVVAHDETLIRMAVCPCHTVAPAQHV
Ga0066710_1034557891	3300009012	Grasslands Soil	MAAATRIIASRLRSTSSSVVAHDETLIRMAVCPCHTVAPAQHV
Ga0099829_105779932	3300009038	Vadose Zone Soil	MAAKLASTSSSVVAQDETLMRIAVCLCHSVPPHQQV
Ga0105106_100072491	3300009078	Freshwater Sediment	MAAALRSTSASVVAHEQTLIRIAVCPCQTVPPHQHVPSAWIAS
Ga0105100_100617121	3300009166	Freshwater Sediment	MPMIAFSLFFSSFSVAAQEDTLLRIAVRPCQTVPPHEEVR
Ga0113563_113720031	3300009167	Freshwater Wetlands	MASMLLETSRSVVAHEETLILIARRPCQVVPPHQQVPSAWMPAMTR
Ga0105097_104689301	3300009169	Freshwater Sediment	MAAALRSTSASVVAHEQTLIRIAVCPCQTVPPHQHVPSAW
Ga0116113_11374322	3300009638	Peatland	MLRSTSSSVVAHDETLILIAVCPCHTVDPHQQVPSAC
Ga0105076_10996431	3300009816	Groundwater Sand	MACTLRSTSASVVAQDETLIRIAVRPCHSVSPQKQVPSA
Ga0126370_122426401	3300010358	Tropical Forest Soil	MADMERSISPSVVAQELTLMRIAARPLQLVPPHQQVPASW
Ga0138577_1008721	3300011028	Peatlands Soil	MAVRLFSTSSAVVAQEDTLIRMAFLPCQTVPPHQQ
Ga0114947_104780971	3300011112	Deep Subsurface	MIAVSDASTSASVVAHDETLILIAARPRQTVPAHQHVPSSCTPAI
Ga0120159_12078981	3300012014	Permafrost	MRMIASALLSMSAAVVAQEDTLIRIAARPCHSVPPHQQVPSSC
Ga0137364_110360892	3300012198	Vadose Zone Soil	MRIIACRLRSTSVSVVAQDDTLIRIAVFPCHTVPPHQQV
Ga0137361_107377552	3300012362	Vadose Zone Soil	MASRLRSTSVSVVAQEDTLIRIAVFPCQTVPPHQQVPSSWTR
Ga0181523_101528752	3300014165	Bog	MAVRLISTSSSDVTHEETLIRIAGRPRHSVPPHQQVP
Ga0181523_108283141	3300014165	Bog	MASRLRSTSSAVVAQEATLIRIAVRPCQVVGPHQQVPSRWMRSITC
Ga0182015_101813911	3300014495	Palsa	MAATLRSTSSLVVAQLDTLMRIAACPCQWVPPHQQ
Ga0134085_102544923	3300015359	Grasslands Soil	MSPATRIIASRLRSTSSSVVAHDETLIRMAVCPCHTVAPAQ
Ga0182041_120034802	3300016294	Soil	MAAKLRSTSAPVVAHEEMLMRMAGCPCQTVGPRCGHT
Ga0163161_116616271	3300017792	Switchgrass Rhizosphere	MRVIAARLVSTSSSVVAHEDTLIRMAGWPRQVVPPHQHVPSR
Ga0187876_11544292	3300018003	Peatland	MACRLRSTSAAVVAHEDTLIRIAVRPCHVVAPHQQVPSCWMRSIT
Ga0187871_103404681	3300018042	Peatland	MLSLAAFRIAARLFSTSASVVAQDDTLIRIAVFPCQTVPPHQHVPS
Ga0184615_104306761	3300018059	Groundwater Sediment	MLLSTSASVVAHELTLMRMAVRPCHTVLPHQHVPSR
Ga0187769_100945261	3300018086	Tropical Peatland	MLRSTSSSVVDQLLTLMRMDARPFHTVPPHQHVPSSWMAA
Ga0187769_103733651	3300018086	Tropical Peatland	MMLAKERSTSSSVVAQEDRLIRMAVRPCHTVPPHQH
Ga0190275_101361673	3300018432	Soil	MTIRATRTIAARLRSTSSSVVAQDETLIRIAARPCQVVPPHQQVPS
Ga0190275_135718931	3300018432	Soil	MLRSTSSSVVAHDETDIRIARLPCQVVPPAQQVPSDWT
Ga0066669_109408751	3300018482	Grasslands Soil	MGKPNRYARAMRIIAARLCSTSCSVVAQDETLMRIAVRPCHTVPPHQQVP
Ga0066669_118971241	3300018482	Grasslands Soil	MAAALRSTSASVVAALHTLMRMAVEPCHTVPPAQQVP
Ga0182025_10191791	3300019786	Permafrost	LFYSSAALIIAARLRSTSSLLVTQDETLIRIAVFPCHTVEPHQQVFPQ
Ga0193747_10510051	3300019885	Soil	MIASALLSMSASVVAHEDTLIRIAARPCHSVPPHQQ
Ga0179594_101699022	3300020170	Vadose Zone Soil	MAARLRCTSSSVVAQEETLMRIAVLPCQTVPAHQQVPSSWMRRIT
Ga0210399_112296742	3300020581	Soil	MRIIAAWLRSTSSSVVSQLDRLIRIAVLPCHCVPPHQQVPSFCN
Ga0210406_109162001	3300021168	Soil	MRMMAPRLLSTSVSVVAQEQTLMRIAVFPCHTVAPHQH
Ga0213873_102207702	3300021358	Rhizosphere	MAARLISTSSSLVAQEETLMRMAGRPCHSVPPHQH
Ga0210393_105584273	3300021401	Soil	MRTMAARLRTTSSLVVAQEDTLMRIAVFPCHTVPLHQQVPSS
Ga0210397_107595251	3300021403	Soil	MIAWTLRSTSSAVVIHDEMLIRIAVCPCQTVLPHQHVPSSWTL
Ga0126371_117436931	3300021560	Tropical Forest Soil	MLFSISSSVVDQLLTLMRMAVRPFHTVPPHQQVPSSCMAEMTRRVC
Ga0224512_100544144	3300022226	Sediment	MAARLRSTSAVVVDQFETLMRIAVFPCQTVTPHQHVPS
Ga0242665_102880831	3300022724	Soil	MAARLCSTSSSVVAHEETLIRMAVFPCQTVPPHQQVPS
Ga0209429_101636401	3300025864	Arctic Peat Soil	MASRLRSTSASVVAHEETLMRIATRPCHSVGPHQQ
Ga0207642_101897102	3300025899	Miscanthus Rhizosphere	MAAMLRSTSASVVAQDETLIRIATLPCQSVLPHQQLPSSCKR
Ga0207694_113037131	3300025924	Corn Rhizosphere	MLFSTSSSVVAHDDTLIRIAVSPCQTVPPHQHVPSSWIAAIT
Ga0207709_107580812	3300025935	Miscanthus Rhizosphere	MRKMAAMERSTSASVVAHEITLTRIAVRPCHAVAPHQHVPS
Ga0207709_116546611	3300025935	Miscanthus Rhizosphere	MLRPTSSSVVAHDDTLMRIAARPRQRVGPHQQVPSACS
Ga0207704_107341532	3300025938	Miscanthus Rhizosphere	MAARLRRTSASVVAHEDTLMRIATRPCHCVSPHQQVPSACT
Ga0207703_119809082	3300026035	Switchgrass Rhizosphere	MAATEASTSASVVAQEMTLTRIAVLPCHTVTPHQHVPSA
Ga0207702_115186341	3300026078	Corn Rhizosphere	MLFSTSSSVVAHDDTLIRIAVSPCQTVPPHQHVPSSWIAAITRC
Ga0207683_110142131	3300026121	Miscanthus Rhizosphere	MMPRATRTMAWALRSASSSVVAHDETLIRIAVRPCHNVGPHQQVPSSCM
Ga0209159_10958253	3300026343	Soil	MSPATRIIASRLRSTSSSVVAHDETLIRMAVCPCHTVAPAQHVP
Ga0257154_10457932	3300026467	Soil	VARAIRIMAAKLRSTSSVVAAQEETLMRIAVFACQTVPLHQQ
Ga0209808_12505392	3300026523	Soil	MSPATRIIASKLRSTSSSVVAHDETLIRMAVCPCHTVAPAQHVPSA
Ga0209418_11055511	3300027371	Forest Soil	MTLFATLTIAAALFSTSSSVVAQLETEIRMAVCPCHTVPPRQQVP
Ga0209073_100962511	3300027765	Agricultural Soil	MLFSTSASVVDQLLTLIRIAARPFHVVPPHQQTPS
Ga0209180_101271801	3300027846	Vadose Zone Soil	MASKLRSTSSSVVAHEEMLMRMAVRPCQTVPPAQQ
Ga0209274_100084146	3300027853	Soil	MPTIAARLRSTSSAVVAQEDTLMRIAVFPCQTVPLHQQVPSSCMR
Ga0209166_106843192	3300027857	Surface Soil	MAAMRIMASTLRSISSSVVAQQETEMRMAVCPCHTVPPHQQVP
Ga0209397_100301421	3300027871	Wetland	MLRSTSSSVVAHEHTLIRIAVRPCHTVPPHQQVPSACTAEMPC
Ga0209397_104163683	3300027871	Wetland	MLSSTSASVVAQEQTLMRMAVRPCQTVPPHQQVPSCCT
Ga0209382_117825202	3300027909	Populus Rhizosphere	MLCATSASVVAHDETLIRIAVFPCHEVPPHQQVPSCWIRAMT
Ga0247663_10764631	3300028145	Soil	MAARLSWMSASVVAQLETDTRIAVWPCHSVGPHQQVPSAWTSRIT
Ga0268265_101904881	3300028380	Switchgrass Rhizosphere	MASTERSTSSSVVAQEITLTRIAVTPCQTVTPHQH
Ga0268264_104011492	3300028381	Switchgrass Rhizosphere	MASTLRSTSASVVAHEHTLMRIAVRFCQTVTPHQQVPSV
Ga0302267_101548271	3300028745	Bog	MAARLRSTSSVVVAQLDTLMRMAVCPCHTVDPHQHVPTACKRA
Ga0302231_101535901	3300028775	Palsa	MRTMAAMLRSTSAPVVDQLLTLILMAVRPCQTVIPHQQVPSA
Ga0302157_107265051	3300028813	Bog	MAARLRSTSSLVVAHDDTLMRIAVFPCHTVGPHQQVPS
Ga0307310_100318351	3300028824	Soil	MAARLRSTSSSVVAQDETLIRIAVRPCQTVPPHQHVPS
Ga0311346_1002672710	3300029952	Bog	MAATLLSTSSSVVAHELTLMRMAVLPCHTVMPHQQVPSAWIASIA
Ga0311339_112843182	3300029999	Palsa	MAAALRSTSASVVAHELTLIRIAVRPCQTVMPHQQVP
Ga0302313_100310271	3300030693	Palsa	MAAMLRVTSSSVVAHEQTLMRIAVRPCQRVGPHQH
Ga0311366_106948541	3300030943	Fen	MAARLASTSSLVVAHDETLIRIAVRPCHSVPPHQQVP
Ga0265330_101098572	3300031235	Rhizosphere	VAAVSCRAERIIASRLRSTSAAVVAQDETLIRIAARPCQTVPPHQHVPS
Ga0310123_106118732	3300031802	Marine	MRTMASRLFATSASVVAQEETLMRIAVIPCHWVPPHQV
Ga0307478_110279491	3300031823	Hardwood Forest Soil	MRIIASKLRSTSFSVVAQEDTLIRIAVFPCQTVPPHQ
Ga0307410_105167841	3300031852	Rhizosphere	MRIIASSERSTSSSVVAHDETLMRITARPFHTLPPHQLVP
Ga0307409_1018540701	3300031995	Rhizosphere	MRIIASSERSTSSSVVAHDETLMRITARPFHTLPPHQHVPSR
Ga0310903_105011071	3300032000	Soil	MRSIAARLRSTSSSVVAHETTLIRIAVRPCHVDGPHQHVPSSWM
Ga0318563_104727591	3300032009	Soil	MARSTSSAVVAQQLTLIRIAARPRQAVPPHQQVPASWM
Ga0306920_1037364161	3300032261	Soil	MTAMLRSTSASVVAQEDTLIRIATRPCQSVPPHQQV
Ga0326727_104049121	3300033405	Peat Soil	MAARLRSTSSFVVAQLDTLMRMAVCPCHTVDPHQQVP
Ga0316603_108780963	3300033413	Soil	MLSSTSASVVAQEQTLMRMAVRPCQTVPPHQQVPSSCT
Ga0316627_1027567931	3300033482	Soil	MLSSTSASVVAQEQTLMRMAVRPCQTVPPHQHVPSSCTAAI

Hidden Markov Model


Click on a Sequence Logo column to get its information.
Powered by Skylign