NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F083017

Metagenome / Metatranscriptome Family F083017

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F083017
Family Type Metagenome / Metatranscriptome
Number of Sequences 113
Average Sequence Length 47 residues
Representative Sequence MRERARDQGGPGTLTDDLVIPEVDPSSLADEPLAELAARYRLRPSAAR
Number of Associated Samples 106
Number of Associated Scaffolds 113

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 96.46 %
% of genes near scaffold ends (potentially truncated) 100.00 %
% of genes from short scaffolds (< 2000 bps) 92.04 %
Associated GOLD sequencing projects 104
AlphaFold2 3D model prediction Yes
3D model pTM-score0.33

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (73.451 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil
(26.549 % of family members)
Environment Ontology (ENVO) Unclassified
(24.779 % of family members)
Earth Microbiome Project Ontology (EMPO) Unclassified
(38.938 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 18.42%    β-sheet: 0.00%    Coil/Unstructured: 81.58%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  		pTM-score: 0.33
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 113 Family Scaffolds
PF13581HATPase_c_2 55.75
PF00535Glycos_transf_2 4.42
PF13466STAS_2 3.54
PF02274ADI 1.77
PF01656CbiA 0.88

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 113 Family Scaffolds
COG1834N-Dimethylarginine dimethylaminohydrolaseAmino acid transport and metabolism [E] 1.77
COG2235Arginine deiminaseAmino acid transport and metabolism [E] 1.77
COG4874Uncharacterized conserved proteinFunction unknown [S] 1.77

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms73.45 %
UnclassifiedrootN/A26.55 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2166559006|FI_contig23899All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia620Open in IMG/M
3300001979|JGI24740J21852_10112161All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia687Open in IMG/M
3300002245|JGIcombinedJ26739_100806113All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia819Open in IMG/M
3300003219|JGI26341J46601_10125958All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia729Open in IMG/M
3300004092|Ga0062389_101122879All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia972Open in IMG/M
3300005163|Ga0066823_10114988Not Available566Open in IMG/M
3300005176|Ga0066679_10288421All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae1065Open in IMG/M
3300005437|Ga0070710_10268451All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1102Open in IMG/M
3300005555|Ga0066692_10918750Not Available536Open in IMG/M
3300005563|Ga0068855_102453724Not Available519Open in IMG/M
3300005578|Ga0068854_100560370All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia970Open in IMG/M
3300006031|Ga0066651_10395176All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia738Open in IMG/M
3300006047|Ga0075024_100491054Not Available642Open in IMG/M
3300006162|Ga0075030_101294744Not Available572Open in IMG/M
3300006175|Ga0070712_101669426All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia557Open in IMG/M
3300006574|Ga0074056_11794455Not Available582Open in IMG/M
3300006579|Ga0074054_12104479Not Available506Open in IMG/M
3300006755|Ga0079222_10523105All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia877Open in IMG/M
3300006791|Ga0066653_10048969All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales1751Open in IMG/M
3300006806|Ga0079220_10656699All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia760Open in IMG/M
3300006852|Ga0075433_10798625All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia825Open in IMG/M
3300006871|Ga0075434_102406958Not Available529Open in IMG/M
3300006904|Ga0075424_101363684All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia753Open in IMG/M
3300009551|Ga0105238_10605486All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae1104Open in IMG/M
3300009665|Ga0116135_1263514All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia672Open in IMG/M
3300009683|Ga0116224_10474024Not Available596Open in IMG/M
3300009700|Ga0116217_10576588Not Available702Open in IMG/M
3300009792|Ga0126374_11168016All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia614Open in IMG/M
3300010360|Ga0126372_13306982Not Available501Open in IMG/M
3300010397|Ga0134124_12784892Not Available533Open in IMG/M
3300011269|Ga0137392_10429331All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae → Thermomonospora → Thermomonospora curvata1097Open in IMG/M
3300011271|Ga0137393_10047946All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia3330Open in IMG/M
3300012207|Ga0137381_10319244All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales1353Open in IMG/M
3300012350|Ga0137372_10008302All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia10031Open in IMG/M
3300012357|Ga0137384_10189886All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1720Open in IMG/M
3300012398|Ga0134051_1087746Not Available572Open in IMG/M
3300012683|Ga0137398_11122073Not Available540Open in IMG/M
3300012925|Ga0137419_10861956Not Available744Open in IMG/M
3300012961|Ga0164302_10399687All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia937Open in IMG/M
3300013307|Ga0157372_11092696All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia923Open in IMG/M
3300014499|Ga0182012_10271202All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales1154Open in IMG/M
3300015373|Ga0132257_101098876All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1004Open in IMG/M
3300015374|Ga0132255_105028319Not Available560Open in IMG/M
3300016357|Ga0182032_11830475Not Available531Open in IMG/M
3300017926|Ga0187807_1004575All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia4234Open in IMG/M
3300017937|Ga0187809_10239832All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia653Open in IMG/M
3300017961|Ga0187778_11045242Not Available567Open in IMG/M
3300017972|Ga0187781_10884966All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia650Open in IMG/M
3300018058|Ga0187766_10586257All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia760Open in IMG/M
3300018058|Ga0187766_10998219All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia596Open in IMG/M
3300019877|Ga0193722_1108488All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia655Open in IMG/M
3300021374|Ga0213881_10044821All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales1868Open in IMG/M
3300021374|Ga0213881_10057372All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales1654Open in IMG/M
3300021403|Ga0210397_11319716Not Available560Open in IMG/M
3300021474|Ga0210390_11616408Not Available510Open in IMG/M
3300021478|Ga0210402_10498114All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales1131Open in IMG/M
3300024245|Ga0247677_1023931All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia874Open in IMG/M
3300025932|Ga0207690_10161069All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1672Open in IMG/M
3300026035|Ga0207703_12142311Not Available535Open in IMG/M
3300027765|Ga0209073_10026856All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales1753Open in IMG/M
3300027768|Ga0209772_10295501Not Available513Open in IMG/M
3300027775|Ga0209177_10053588All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales1152Open in IMG/M
3300027855|Ga0209693_10323622All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia750Open in IMG/M
3300028801|Ga0302226_10021840All Organisms → cellular organisms → Bacteria → Terrabacteria group3401Open in IMG/M
3300028801|Ga0302226_10320130All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia652Open in IMG/M
3300028806|Ga0302221_10469930Not Available548Open in IMG/M
3300028877|Ga0302235_10355092All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia630Open in IMG/M
3300029943|Ga0311340_10950122All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia710Open in IMG/M
3300030013|Ga0302178_10189654All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia995Open in IMG/M
3300030053|Ga0302177_10022771All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales3989Open in IMG/M
3300030057|Ga0302176_10461602Not Available513Open in IMG/M
3300030520|Ga0311372_10765969All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae1329Open in IMG/M
3300030760|Ga0265762_1108163All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria624Open in IMG/M
3300031236|Ga0302324_100510833All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae → Actinomadura1751Open in IMG/M
3300031474|Ga0170818_111085170All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia593Open in IMG/M
3300031543|Ga0318516_10299535All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia929Open in IMG/M
3300031561|Ga0318528_10669697All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia556Open in IMG/M
3300031708|Ga0310686_107441649All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales1460Open in IMG/M
3300031718|Ga0307474_11032732All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia651Open in IMG/M
3300031736|Ga0318501_10564428All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia623Open in IMG/M
3300031748|Ga0318492_10209588All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia999Open in IMG/M
3300031751|Ga0318494_10690370Not Available597Open in IMG/M
3300031751|Ga0318494_10698993All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Nocardioidaceae → Aeromicrobium → Aeromicrobium massiliense593Open in IMG/M
3300031765|Ga0318554_10263200All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia982Open in IMG/M
3300031771|Ga0318546_10854556All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia640Open in IMG/M
3300031799|Ga0318565_10218156All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia927Open in IMG/M
3300031819|Ga0318568_10691492All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Nocardiopsaceae634Open in IMG/M
3300031832|Ga0318499_10089893All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales1182Open in IMG/M
3300031833|Ga0310917_10568379All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia770Open in IMG/M
3300031846|Ga0318512_10353590All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia735Open in IMG/M
3300031894|Ga0318522_10146226All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia890Open in IMG/M
3300031954|Ga0306926_11479754All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia784Open in IMG/M
3300031959|Ga0318530_10347323All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia614Open in IMG/M
3300031962|Ga0307479_11027021All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia793Open in IMG/M
3300031981|Ga0318531_10322610All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia698Open in IMG/M
3300032009|Ga0318563_10110596All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales1458Open in IMG/M
3300032009|Ga0318563_10144923All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae1272Open in IMG/M
3300032025|Ga0318507_10313948All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia682Open in IMG/M
3300032063|Ga0318504_10648024Not Available508Open in IMG/M
3300032066|Ga0318514_10028397All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales2603Open in IMG/M
3300032066|Ga0318514_10659542Not Available557Open in IMG/M
3300032067|Ga0318524_10045396All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales2077Open in IMG/M
3300032067|Ga0318524_10703262Not Available533Open in IMG/M
3300032068|Ga0318553_10059699All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1893Open in IMG/M
3300032074|Ga0308173_12353710Not Available502Open in IMG/M
3300032174|Ga0307470_11090691All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia641Open in IMG/M
3300032770|Ga0335085_12584263Not Available502Open in IMG/M
3300032805|Ga0335078_10981791All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1003Open in IMG/M
3300032828|Ga0335080_10141256All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales2668Open in IMG/M
3300032893|Ga0335069_10022504All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia8686Open in IMG/M
3300032896|Ga0335075_10931853All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia791Open in IMG/M
3300033290|Ga0318519_10273317All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia983Open in IMG/M
3300033412|Ga0310810_10456304All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales1292Open in IMG/M


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil26.55%
PalsaEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa8.85%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil6.19%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil4.42%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil4.42%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil3.54%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil3.54%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland3.54%
Bog Forest SoilEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil2.65%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil2.65%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil2.65%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere2.65%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere2.65%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment1.77%
WatershedsEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds1.77%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil1.77%
Peatlands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil1.77%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil1.77%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere1.77%
Exposed RockEnvironmental → Terrestrial → Rock-Dwelling (Subaerial Biofilms) → Unclassified → Unclassified → Exposed Rock1.77%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere1.77%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland0.89%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil0.89%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil0.89%
Grass SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grass Soil0.89%
Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil0.89%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil0.89%
BogEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Bog0.89%
Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil0.89%
SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Soil0.89%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere0.89%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere0.89%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere0.89%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere0.89%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
2166559006Grass soil microbial communities from Rothamsted Park, UK - FI (heavy metals 2g/kg) assembledEnvironmentalOpen in IMG/M
3300001979Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6Host-AssociatedOpen in IMG/M
3300002245Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027)EnvironmentalOpen in IMG/M
3300003219Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM3EnvironmentalOpen in IMG/M
3300004092Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3, ECP14_OM1, ECP14_OM2, ECP14_OM3EnvironmentalOpen in IMG/M
3300005163Soil and rhizosphere microbial communities from Laval, Canada - mgHMBEnvironmentalOpen in IMG/M
3300005176Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_128EnvironmentalOpen in IMG/M
3300005437Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaGEnvironmentalOpen in IMG/M
3300005555Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141EnvironmentalOpen in IMG/M
3300005563Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2Host-AssociatedOpen in IMG/M
3300005578Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2Host-AssociatedOpen in IMG/M
3300006031Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Angelo_100EnvironmentalOpen in IMG/M
3300006047Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2013EnvironmentalOpen in IMG/M
3300006162Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012EnvironmentalOpen in IMG/M
3300006175Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaGEnvironmentalOpen in IMG/M
3300006574Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHAA (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006579Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLAB (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006755Agricultural soil microbial communities from Georgia to study Nitrogen management - GA PlitterEnvironmentalOpen in IMG/M
3300006791Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_102EnvironmentalOpen in IMG/M
3300006806Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100EnvironmentalOpen in IMG/M
3300006852Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2Host-AssociatedOpen in IMG/M
3300006871Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3Host-AssociatedOpen in IMG/M
3300006904Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3Host-AssociatedOpen in IMG/M
3300009551Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaGHost-AssociatedOpen in IMG/M
3300009665Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_20_10EnvironmentalOpen in IMG/M
3300009683Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_b_LC metaGEnvironmentalOpen in IMG/M
3300009700Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_4_PS metaGEnvironmentalOpen in IMG/M
3300009792Tropical forest soil microbial communities from Panama - MetaG Plot_12EnvironmentalOpen in IMG/M
3300010360Tropical forest soil microbial communities from Panama - MetaG Plot_6EnvironmentalOpen in IMG/M
3300010397Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4EnvironmentalOpen in IMG/M
3300011269Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaGEnvironmentalOpen in IMG/M
3300011271Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaGEnvironmentalOpen in IMG/M
3300012207Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaGEnvironmentalOpen in IMG/M
3300012350Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_60_16 metaGEnvironmentalOpen in IMG/M
3300012357Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaGEnvironmentalOpen in IMG/M
3300012398Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_2_24_2 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012683Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz2.16 metaGEnvironmentalOpen in IMG/M
3300012925Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012961Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_202_MGEnvironmentalOpen in IMG/M
3300013307Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaGHost-AssociatedOpen in IMG/M
3300014499Permafrost microbial communities from Stordalen Mire, Sweden - 612S2S metaGEnvironmentalOpen in IMG/M
3300015373Combined assembly of cpr5 rhizosphereHost-AssociatedOpen in IMG/M
3300015374Col-0 rhizosphere combined assemblyHost-AssociatedOpen in IMG/M
3300016357Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000EnvironmentalOpen in IMG/M
3300017926Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_2EnvironmentalOpen in IMG/M
3300017937Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_4EnvironmentalOpen in IMG/M
3300017961Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_20_MGEnvironmentalOpen in IMG/M
3300017972Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP02_20_MGEnvironmentalOpen in IMG/M
3300018058Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_20_MGEnvironmentalOpen in IMG/M
3300019877Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2m1EnvironmentalOpen in IMG/M
3300021374Barbacenia macrantha exposed rock microbial communities from rupestrian grasslands, the National Park of Serra do Cipo, Brazil - ER_R08EnvironmentalOpen in IMG/M
3300021403Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-OEnvironmentalOpen in IMG/M
3300021474Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-OEnvironmentalOpen in IMG/M
3300021478Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-MEnvironmentalOpen in IMG/M
3300024245Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK18EnvironmentalOpen in IMG/M
3300025932Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026035Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300027765Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 (SPAdes)EnvironmentalOpen in IMG/M
3300027768Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP03_OM1 (SPAdes)EnvironmentalOpen in IMG/M
3300027775Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control (SPAdes)EnvironmentalOpen in IMG/M
3300027855Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 (SPAdes)EnvironmentalOpen in IMG/M
3300028801Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E3_3EnvironmentalOpen in IMG/M
3300028806Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E2_1EnvironmentalOpen in IMG/M
3300028877Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N3_3EnvironmentalOpen in IMG/M
3300029943I_Palsa_N3 coassemblyEnvironmentalOpen in IMG/M
3300030013Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E1_3EnvironmentalOpen in IMG/M
3300030053Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E1_2EnvironmentalOpen in IMG/M
3300030057Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E1_1EnvironmentalOpen in IMG/M
3300030520III_Palsa_N2 coassemblyEnvironmentalOpen in IMG/M
3300030760Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031236Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_1EnvironmentalOpen in IMG/M
3300031474Fir Coassembly Site 11 - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031543Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f20EnvironmentalOpen in IMG/M
3300031561Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f26EnvironmentalOpen in IMG/M
3300031708FICUS49499 Metagenome Czech Republic combined assemblyEnvironmentalOpen in IMG/M
3300031718Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05EnvironmentalOpen in IMG/M
3300031736Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f21EnvironmentalOpen in IMG/M
3300031748Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f22EnvironmentalOpen in IMG/M
3300031751Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f24EnvironmentalOpen in IMG/M
3300031765Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f22EnvironmentalOpen in IMG/M
3300031771Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f19EnvironmentalOpen in IMG/M
3300031799Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f21EnvironmentalOpen in IMG/M
3300031819Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f21EnvironmentalOpen in IMG/M
3300031832Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f25EnvironmentalOpen in IMG/M
3300031833Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF178EnvironmentalOpen in IMG/M
3300031846Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f19EnvironmentalOpen in IMG/M
3300031894Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f18EnvironmentalOpen in IMG/M
3300031954Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2)EnvironmentalOpen in IMG/M
3300031959Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f24EnvironmentalOpen in IMG/M
3300031962Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515EnvironmentalOpen in IMG/M
3300031981Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f25EnvironmentalOpen in IMG/M
3300032009Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f19EnvironmentalOpen in IMG/M
3300032025Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f20EnvironmentalOpen in IMG/M
3300032063Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f17EnvironmentalOpen in IMG/M
3300032066Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f18EnvironmentalOpen in IMG/M
3300032067Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f22EnvironmentalOpen in IMG/M
3300032068Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f21EnvironmentalOpen in IMG/M
3300032074Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.P.R1EnvironmentalOpen in IMG/M
3300032174Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05EnvironmentalOpen in IMG/M
3300032770Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5EnvironmentalOpen in IMG/M
3300032805Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.2EnvironmentalOpen in IMG/M
3300032828Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.4EnvironmentalOpen in IMG/M
3300032893Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.1EnvironmentalOpen in IMG/M
3300032896Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.4EnvironmentalOpen in IMG/M
3300033290Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f15EnvironmentalOpen in IMG/M
3300033412Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - NCEnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
FI_004458402166559006Grass SoilMRERARDQGGPGTLTDDLVIPEVDPSSLADEPLADLAARHGLRPSAIRPGVFAYAR
JGI24740J21852_1011216113300001979Corn RhizosphereMKERTRDQGGPGTLTDDLVVPEIDASTLADEPLADLAARYRLRPSAARP
JGIcombinedJ26739_10080611323300002245Forest SoilMRERARDQGGPGTLTDDLAPPEADDEPPDEPLADLAARYRLRPSA
JGI26341J46601_1012595823300003219Bog Forest SoilMKERARDQGGPGTLTDDLAIPEVDQAALANEPLAELAARYRLKPSAARPGIFAYA
Ga0062389_10112287923300004092Bog Forest SoilMKERARDQGGPGTLTDDLAIPEVDQAALADEPLAELAARY
Ga0066823_1011498813300005163SoilMRERARDQGGPGTLTDDLVIPEVDPSSLADEPLAELAARYGLRPSAIRPG
Ga0066679_1028842133300005176SoilMKERTRDQGGPGTLSDDLVIPEIDASTLAGEPLADLAARYRL
Ga0070710_1026845123300005437Corn, Switchgrass And Miscanthus RhizosphereMRERARDQGGPGTLTDELVIPDTDPSALADEPLAELAARYGLRPSA
Ga0066692_1091875013300005555SoilMKERARDQGGPGTLTDDLVIPEIDPATLADEPLADLAARY
Ga0068855_10245372413300005563Corn RhizosphereMRERARDQGGPGTLTDDLVIPEVDPSSLADEPLADLAAR
Ga0068854_10056037013300005578Corn RhizosphereMKERTRDQGGPGTLTDDLVVPEIDASTLADEPLADLAARYRLRPSAARPGVFVY
Ga0066651_1039517613300006031SoilMKERTRDQGGPGTLTDDLVIPEIDASTLAGEPLADLAARYRLRPSAARPGVFVYARQ
Ga0075024_10049105423300006047WatershedsMKERARDQGGPGTLTDDLAIPEVDQAALAGEPLAELAARYQLR
Ga0075030_10129474423300006162WatershedsMKERARDQGGPGTLTDDLAIPEVDPSAWADEPLAELAARYR
Ga0070712_10166942623300006175Corn, Switchgrass And Miscanthus RhizosphereMRERARDQGGPGTLTDELVIPDTDPSALADEPLAELAARYGLRPS
Ga0074056_1179445513300006574SoilMRERARDQGGPGTLTDDLVIPEVDPSSLADEPLAELAARYGLRPSAARPGVF
Ga0074054_1210447923300006579SoilMRERARDQGGPGTLTDDLVIPEVDPSSLADEPLAELAARY
Ga0079222_1052310513300006755Agricultural SoilMKERARDQGGPGTLTDYLVIPDGDLATLADEPLADLAASYRLRPSAYSPGVIVYARQLRERRHFIL
Ga0066653_1004896943300006791SoilMKERTRDQGGPGTLTDDLVIPEIDASTLAGEPLADLAARY
Ga0079220_1065669923300006806Agricultural SoilMKERARDQGGPGTLTDDLVIPEIDPATLADEPLADLAA
Ga0075433_1079862513300006852Populus RhizosphereMKERTRDQGGPGTLTDDLVVPEIDASTLADEPLADLAARYRLRPSAARPGVFV
Ga0075434_10240695823300006871Populus RhizosphereMKERARDQGGPGTLTDDLVIPDIDPATLADEPLADLAARYRLRPSAARP
Ga0075424_10136368423300006904Populus RhizosphereMKERARDQGGPGTLTDDLVIPDIDPATLADEPLADLAARYRL
Ga0105238_1060548633300009551Corn RhizosphereMKERTRDQGGPGTLTDDLVVPEIDASTLADEPLAD
Ga0116135_126351423300009665PeatlandMKELARDQGGPGTLTDELATPDVTEGLPPGESLAELAAEY
Ga0116224_1047402423300009683Peatlands SoilMKERARDQGGPGTLTDDLAIPEVDQAALADEPLAELAA
Ga0116217_1057658823300009700Peatlands SoilMKERARDQGGPGTLTDDLVIPEVDPSVLGDEPLAELAARYRLRPSAARPG
Ga0126374_1116801613300009792Tropical Forest SoilMRERARDQGGPGTLTDDLEIPEVDPSTLAEEQLAELA
Ga0126372_1330698223300010360Tropical Forest SoilMRERARDQGGPGTLTDDLEIPEVDPSTLAEEPLAELAA
Ga0134124_1278489213300010397Terrestrial SoilMRERARDQGGPGTLTDDLVIPEVDPATLADEPLADLAARYQLRPSAA
Ga0137392_1042933113300011269Vadose Zone SoilMRERARDQGGPGTLTDDLAIPEDDPSALAGEPLAELAARYRLRPSAARPGVFA
Ga0137393_1004794663300011271Vadose Zone SoilMRERARDQGGPGTLTDDLAPPEVDDTPPDEPLAELAARYRLRPSAARPG
Ga0137381_1031924413300012207Vadose Zone SoilMRERARDQGGPGTLTDDLVIPEVDPSALSDEPLAELAARYQ
Ga0137372_1000830213300012350Vadose Zone SoilMRERARDQGGPGTLTDDLVIPEVDPSSLADEPLAELA
Ga0137384_1018988643300012357Vadose Zone SoilMKERARDQGGPGTLTDDLVIPEIDPATLADEPLADLAARYRLRPSAARPGVFVYA
Ga0134051_108774613300012398Grasslands SoilMRERARDQGGPGTLTDDLVIPEIDPSSLADEPLADLAARYRLRPSAARPGVFVYARQLWDQR
Ga0137398_1112207313300012683Vadose Zone SoilMKERTRDQGGPGTLTDDLVIPDIDPATLADEPLADLAARYRLRPSAARPG
Ga0137419_1086195613300012925Vadose Zone SoilMKERTRDQGGPGTLTDDLVIPDIDPATLADEPLADLAARYRLRPSAARPGVFVYARQLW
Ga0164302_1039968723300012961SoilMRERARDQGGPGTLTDDLVIPEVDPSSLADEPLADLAARHGLR
Ga0157372_1109269613300013307Corn RhizosphereMKERTRDQGGPGTLTDDLVVPEIDASTLADEPLADL
Ga0182012_1027120213300014499BogMKERVREAGGPGTLTDDPVAPDASGTLPDEPLAELAARYKLR
Ga0132257_10109887623300015373Arabidopsis RhizosphereMRERARDQGGPGTLTDDLVIPEVDPSSLADEPLAELAARYRLRPSAARP
Ga0132255_10502831923300015374Arabidopsis RhizosphereMRERARDQGGPGTLTDDLVIPEVDPSSLADEPLAELAARYRL
Ga0182032_1183047523300016357SoilMRERARDQGGPGTLTDDLVIPEVDPSSLAGEPLAELAARYRLRPSAARPGVFTYA
Ga0187807_100457513300017926Freshwater SedimentMKERARDQGGPGTLTDDLAIPEVDQAALADEPLAELAARYRLRPSAARPGVLT
Ga0187809_1023983213300017937Freshwater SedimentMRERARDQGGPGTLTDDLVIPEVDPSSLADEPLAELAARYRLRPSAARPGVFVYARQLW
Ga0187778_1104524213300017961Tropical PeatlandMRERARDPGGPGTLTDDLVIPEVDQGSLPDEPLAELAARYRLRPSAARPGIFAY
Ga0187781_1088496623300017972Tropical PeatlandMRERTRDQGGPGTLTDELAIPEADPSALPAEPLAELAARYRLRPSAARPGLFAYA
Ga0187766_1058625713300018058Tropical PeatlandMRERARDQGGPGTLTDDLAIPEVDPSALPDEPLAELAARYQLRPSAARPGVIAYAGQL
Ga0187766_1099821913300018058Tropical PeatlandMKERPRDPGGPGTLTDDLAIPQVDQGSLPDEPLAELAARYRLRPSAARPGVFAYARLL
Ga0193722_110848823300019877SoilMRERSRDQGGPGTLTDDLVIPEVDPSSLADEPLADLAARHGLR
Ga0213881_1004482143300021374Exposed RockMRQRARDHGAPGTLTDDLSLPETDQASLPAEPLAELA
Ga0213881_1005737213300021374Exposed RockMRERARDQGGPGTLTDDLVIPEIDPATLADEPLADLA
Ga0210397_1131971623300021403SoilMKERARDQGGPGTLTDDLVIPEIDPATLADEPLADLAARYRLRPSAARPGVFVY
Ga0210390_1161640823300021474SoilMRERAGDQQGGPGTLTDDLLPPEDSQADLPDEPLAELAARYRLRPSAARPG
Ga0210402_1049811433300021478SoilMKERARDQGGPGTLTDDLAIPEIDPATLADEPLADLAARYRLRPSAARPGVFVYA
Ga0247677_102393123300024245SoilMKERTRDQGGPGTLTDDLVVPEIDASTLADEPLADLAARYRLRPSAARPGVFVYARQ
Ga0207690_1016106913300025932Corn RhizosphereMKERTRDQGGPGTLTDDLVVPEIDASTLADEPLADLA
Ga0207703_1214231113300026035Switchgrass RhizosphereVRRRLARMKERTRDQGGPGTLTDDLVVPEIDASTLAGEPLADL
Ga0209073_1002685643300027765Agricultural SoilMRERARDQGGPGTLTDDLVIPEVDPATLADEPLAD
Ga0209772_1029550123300027768Bog Forest SoilMIERVRDQEGGPGTLTDELIPADDSAEPLSDIPLADLAAEYNL
Ga0209177_1005358813300027775Agricultural SoilMKERTRDQGGPGTLTDDLVIPEIDASTLAGEPLADLAARYGLRPSAA
Ga0209693_1032362223300027855SoilMRDRAGDQQGGPGTLTDDLIPPQDSQADLPDEPLAE
Ga0302226_1002184013300028801PalsaMKDRARDQGGPGTLTDELATPDLTEEPAPGESLAELAAEYNLRPSSARPS
Ga0302226_1032013023300028801PalsaMKERARDQGGPGTLTDELATPDLTEGPPPGESLAELAAEYQLRPSSA
Ga0302221_1046993013300028806PalsaMKDRARDQGGPGTLTDELATPDLTEEPAPGESLAELAAEYNLRPSSARPSV
Ga0302235_1035509213300028877PalsaVRHRLASMKERARDQGGPGTLTDELATPDVIEGPPPGESLAELAAEYQLRPSSAR
Ga0311340_1095012223300029943PalsaVRHRLASMKERARDQGGPGTLTDELATPDLTEGLPPGESLAELAAEYQLRPSSARPGVFAYAGQLWA
Ga0302178_1018965413300030013PalsaMKERARDQGGPGTLTDELATPDVIERPPPGESLAELAAEYRLRPSSARPGMFAYAGQLWA
Ga0302177_1002277153300030053PalsaMKDRARDQGGPGTLTDELATPDLTEEPAPGESLAELAAEYNLRPSSA
Ga0302176_1046160213300030057PalsaMKERARDQGGPGTLTDELATPDVIERPPPGESLAELA
Ga0311372_1076596933300030520PalsaMKERARDQGGPGTLTDELATPDLTEGLPPGESLAELAAEYQLRPSSARPGVFAYAGQ
Ga0265762_110816323300030760SoilMSERVRDTGGPGTLTDDLVIPEVDPSALSDEPLAELAARYRLLPSAARPGIFAFAGQLWARR
Ga0302324_10051083333300031236PalsaMKERARDQGGPGTLTDELATPDVTEGLPSGESLAELAAEYRLRPSSARPGVFAYA
Ga0170818_11108517023300031474Forest SoilMRERTRDQGGPGTLTDDLVIPEVDPSSLADEPLAELAARYGLRP
Ga0318516_1029953523300031543SoilMRERARDQGGPGTLTDDLVIPEVDPSSLADEPLAE
Ga0318528_1066969713300031561SoilMRERARDQGGPGTLTDDLVIPEVDPSSLAGEPLAELAARYR
Ga0310686_10744164933300031708SoilMRDRARDQGGPGTLTDELATPEVSDETAPGEPLAELAARYSLRPSAARPSVFA
Ga0307474_1103273223300031718Hardwood Forest SoilMRERARDQGGPGTLTDDLVIPEVDPSSLADEPLAELAARYRLRP
Ga0318501_1056442823300031736SoilMRERARDQGGPGTLTDDLVIPEVDPSSLAGEPLAELAARYRLRPSAARP
Ga0318492_1020958813300031748SoilMRERARDQGGPGTLTDDLVIPEVDPSSLADEPLAELAARYGLRPSAARPG
Ga0318494_1069037023300031751SoilMRERARDQGGPGTLTDELAIPEVDPSALPDEPLAELAARYRLRP
Ga0318494_1069899313300031751SoilMRERARDQGGPGTLTDDLAIPEVDPSALPDEPLAELAAR
Ga0318554_1026320023300031765SoilMRERARDQGGPGTLTDDLVIPEIDPSTLADEPLAELAARYRLRPSAARPGIFAYA
Ga0318546_1085455613300031771SoilMRERARDQGGPGTLTDDLVIPEVDPSSLAGEPLAELAARYRLRPSAARPGVFAYAR
Ga0318565_1021815623300031799SoilMRERARDQGGPGTLTDDLAIPEVDPSALADEPLAELAARYRLRPSAARPGVFAYARQL
Ga0318568_1069149213300031819SoilMRERARDQGGPGTLTDDLAIPEVDPSALPDEPLAE
Ga0318499_1008989333300031832SoilMRERARDQGGPGTLTDDLVIPEVDPSSLAGEPLAELAARYRLRPSAARPGVLTYARQL
Ga0310917_1056837923300031833SoilMRERARDQGGPGTLTDDLVIPEVDPSSLADEPLAELAARYGLRPSAA
Ga0318512_1035359013300031846SoilMRERARDQGGPGTLTDDLVIPEVDPSSLADEPLAELAARYG
Ga0318522_1014622613300031894SoilMRERARDQGGPGTLTDDLVIPEVDPSSLAGEPLAE
Ga0306926_1147975413300031954SoilMRERARDQGGPGTLTDDLVIPEVDPSSLADEPLAEMAARYRLRPSAARP
Ga0318530_1034732323300031959SoilMRERARDQGGPGTLTDDLVIPEVDPSSLADEPLAELAARYGLRP
Ga0307479_1102702113300031962Hardwood Forest SoilMKERARDQGGPGTLTDDLVIPEIDASTLAGEPLADLAARYRLRPSA
Ga0318531_1032261023300031981SoilMRERARDQGGPGTLTDDLVIPEVDPSSLAGEPLAELAARYRLRPSAARPGVFAYARQLW
Ga0318563_1011059613300032009SoilMRERARDQGGPGTLTDDLAIPEVDPSALPDEPLAELAARYQL
Ga0318563_1014492313300032009SoilMRERARDQGGPGTLTDDLVIPEVDPSSLADEPLAELAARYRLRPSAAR
Ga0318507_1031394813300032025SoilMRERARDQGGPGTLTDDLVIPEVDPSSLAGEPLAELAARYRLRPSAARPGV
Ga0318504_1064802423300032063SoilMRERARDQGGPGTLTDDLVIPEVDPSSLADEPLAELAARYRLRPSAARPGVF
Ga0318514_1002839753300032066SoilMRERARDQGGPGTLTDDLEIPEVDPSTLAEEPLAELAARYRLR
Ga0318514_1065954213300032066SoilMRERARDQGGPGTLTDALVIPEVDPSSLADEPLAELAARYGLRPSAARPGVFTYARQL
Ga0318524_1004539643300032067SoilMRERARDQGGPGTLTDDLEIPEVDPSTLAEEPLAELAARY
Ga0318524_1070326213300032067SoilMRERARDQGGPGTLTDDLVIPEVDPSSLADEPLAELAA
Ga0318553_1005969913300032068SoilMRERARDQGGPGTLTDDLVIPEVDPSSLADEPLAELAARYR
Ga0308173_1235371013300032074SoilMKERTRDQGGPGTLTDDLVIPEIDASTLAGEPLADLAAR
Ga0307470_1109069123300032174Hardwood Forest SoilMKERARDQGGPGTLTDDLVIPDIDPATLADEPLAD
Ga0335085_1258426313300032770SoilMKERTRDQGGPGTLTDDLVIPEIDASTLAGEPLADLAARYQLRPSAARPG
Ga0335078_1098179133300032805SoilMRERARDQGGPGTLTDDLVIPEVDPATLADEPLADLAARYQL
Ga0335080_1014125643300032828SoilMRERARDQGGPGTLTDDLAIPEVDPSTLADEPLAELAARYQLRPSAARAGLFAYA
Ga0335069_1002250413300032893SoilMRERARDQGGPGTLTDDLVIPEVDPSSLADEPLAELAARYRLRPSAARPGVFAY
Ga0335075_1093185323300032896SoilMKQRARDQGGPGTLTEELTAPESAASDLPDRPLAELAAEYHLRP
Ga0318519_1027331713300033290SoilMRERARDQGGPGTLTDDLVIPEVDPSSLAGEPLAELAARYRLRPSAARPGVF
Ga0310810_1045630433300033412SoilMKERTRDQGGPGTLTDDLVVPEIDASTLAGEPLADLAARYRL

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.