NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F083300

Metagenome / Metatranscriptome Family F083300

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F083300
Family Type Metagenome / Metatranscriptome
Number of Sequences 113
Average Sequence Length 43 residues
Representative Sequence RWRYQPGSLTRELAEKLAALAEVTDRLPQPVRVPPGEEFVA
Number of Associated Samples 104
Number of Associated Scaffolds 113

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 0.00 %
% of genes near scaffold ends (potentially truncated) 92.04 %
% of genes from short scaffolds (< 2000 bps) 83.19 %
Associated GOLD sequencing projects 100
AlphaFold2 3D model prediction Yes
3D model pTM-score0.39

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (66.372 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil
(10.620 % of family members)
Environment Ontology (ENVO) Unclassified
(24.779 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(52.212 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 20.29%    β-sheet: 0.00%    Coil/Unstructured: 79.71%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  		pTM-score: 0.39
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 113 Family Scaffolds
PF13393tRNA-synt_His 13.27
PF01381HTH_3 13.27
PF00005ABC_tran 11.50
PF00528BPD_transp_1 6.19
PF13444Acetyltransf_5 6.19
PF01553Acyltransferase 3.54
PF00171Aldedh 2.65
PF01966HD 1.77
PF16321Ribosom_S30AE_C 1.77
PF00575S1 1.77
PF10543ORF6N 0.88
PF13432TPR_16 0.88
PF01713Smr 0.88
PF01416PseudoU_synth_1 0.88
PF00221Lyase_aromatic 0.88
PF00378ECH_1 0.88
PF02661Fic 0.88
PF09821AAA_assoc_C 0.88
PF02735Ku 0.88
PF03030H_PPase 0.88
PF00069Pkinase 0.88
PF00587tRNA-synt_2b 0.88
PF13419HAD_2 0.88

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 113 Family Scaffolds
COG0515Serine/threonine protein kinaseSignal transduction mechanisms [T] 3.54
COG0014Gamma-glutamyl phosphate reductaseAmino acid transport and metabolism [E] 2.65
COG1012Acyl-CoA reductase or other NAD-dependent aldehyde dehydrogenaseLipid transport and metabolism [I] 2.65
COG4230Delta 1-pyrroline-5-carboxylate dehydrogenaseAmino acid transport and metabolism [E] 2.65
COG0101tRNA U38,U39,U40 pseudouridine synthase TruATranslation, ribosomal structure and biogenesis [J] 0.88
COG1273Non-homologous end joining protein Ku, dsDNA break repairReplication, recombination and repair [L] 0.88
COG2986Histidine ammonia-lyaseAmino acid transport and metabolism [E] 0.88
COG3808Na+ or H+-translocating membrane pyrophosphataseEnergy production and conversion [C] 0.88

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms66.37 %
UnclassifiedrootN/A33.63 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2170459005|F1BAP7Q01CTZDFAll Organisms → cellular organisms → Bacteria → Acidobacteria509Open in IMG/M
3300001661|JGI12053J15887_10351199All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae713Open in IMG/M
3300004091|Ga0062387_101568930All Organisms → cellular organisms → Bacteria → Acidobacteria530Open in IMG/M
3300005166|Ga0066674_10410862Not Available625Open in IMG/M
3300005167|Ga0066672_10013279All Organisms → cellular organisms → Bacteria4070Open in IMG/M
3300005337|Ga0070682_100221091All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae1348Open in IMG/M
3300005343|Ga0070687_101445749All Organisms → cellular organisms → Bacteria515Open in IMG/M
3300005436|Ga0070713_100160165All Organisms → cellular organisms → Bacteria2008Open in IMG/M
3300005445|Ga0070708_101024075All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter774Open in IMG/M
3300005458|Ga0070681_10700020Not Available929Open in IMG/M
3300005468|Ga0070707_100822806All Organisms → cellular organisms → Bacteria893Open in IMG/M
3300005534|Ga0070735_10555955All Organisms → cellular organisms → Bacteria682Open in IMG/M
3300005541|Ga0070733_10377432All Organisms → cellular organisms → Bacteria942Open in IMG/M
3300005546|Ga0070696_100224492All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter1411Open in IMG/M
3300005554|Ga0066661_10894074All Organisms → cellular organisms → Bacteria519Open in IMG/M
3300005556|Ga0066707_10396692All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae898Open in IMG/M
3300005557|Ga0066704_10180370All Organisms → cellular organisms → Bacteria1424Open in IMG/M
3300005563|Ga0068855_102512196All Organisms → cellular organisms → Bacteria → Acidobacteria512Open in IMG/M
3300005764|Ga0066903_105635561Not Available659Open in IMG/M
3300005944|Ga0066788_10006046All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter2461Open in IMG/M
3300005993|Ga0080027_10316359All Organisms → cellular organisms → Bacteria622Open in IMG/M
3300006028|Ga0070717_10437115All Organisms → cellular organisms → Bacteria1178Open in IMG/M
3300006047|Ga0075024_100532702All Organisms → cellular organisms → Bacteria → Acidobacteria621Open in IMG/M
3300006163|Ga0070715_10781619All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium578Open in IMG/M
3300006176|Ga0070765_100496333All Organisms → cellular organisms → Bacteria1147Open in IMG/M
3300006854|Ga0075425_102515568All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → unclassified Terriglobales → Acidobacteriales bacterium 13_2_20CM_55_8570Open in IMG/M
3300006854|Ga0075425_102909660All Organisms → cellular organisms → Bacteria525Open in IMG/M
3300006903|Ga0075426_10914512All Organisms → cellular organisms → Bacteria662Open in IMG/M
3300007255|Ga0099791_10159112All Organisms → cellular organisms → Bacteria → Acidobacteria1057Open in IMG/M
3300009092|Ga0105250_10407904All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae604Open in IMG/M
3300009093|Ga0105240_10443617All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1454Open in IMG/M
3300009174|Ga0105241_10246176All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1514Open in IMG/M
3300009174|Ga0105241_10255437All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1488Open in IMG/M
3300009698|Ga0116216_10620924All Organisms → cellular organisms → Bacteria → Acidobacteria651Open in IMG/M
3300009700|Ga0116217_10125255All Organisms → cellular organisms → Bacteria → Acidobacteria1735Open in IMG/M
3300010320|Ga0134109_10259327Not Available658Open in IMG/M
3300010359|Ga0126376_10279961All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → unclassified Terriglobales → Acidobacteriales bacterium 13_2_20CM_55_81438Open in IMG/M
3300010379|Ga0136449_101596396All Organisms → cellular organisms → Bacteria → Acidobacteria991Open in IMG/M
3300010401|Ga0134121_12505898Not Available558Open in IMG/M
3300011269|Ga0137392_11243068Not Available603Open in IMG/M
3300011444|Ga0137463_1351292Not Available530Open in IMG/M
3300012096|Ga0137389_10079538All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis2558Open in IMG/M
3300012209|Ga0137379_10246353All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter1700Open in IMG/M
3300012210|Ga0137378_11099849Not Available710Open in IMG/M
3300012210|Ga0137378_11339352Not Available631Open in IMG/M
3300012224|Ga0134028_1191900Not Available639Open in IMG/M
3300012363|Ga0137390_10580626All Organisms → cellular organisms → Bacteria → Acidobacteria1090Open in IMG/M
3300012377|Ga0134029_1084641Not Available587Open in IMG/M
3300012403|Ga0134049_1105921Not Available630Open in IMG/M
3300012405|Ga0134041_1069162Not Available611Open in IMG/M
3300012918|Ga0137396_10151158All Organisms → cellular organisms → Bacteria → Acidobacteria1690Open in IMG/M
3300012929|Ga0137404_10131275All Organisms → cellular organisms → Bacteria2061Open in IMG/M
3300012929|Ga0137404_11885369All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → unclassified Terriglobales → Acidobacteriales bacterium 13_2_20CM_55_8556Open in IMG/M
3300012930|Ga0137407_10177079All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae1901Open in IMG/M
3300012971|Ga0126369_13164631Not Available539Open in IMG/M
3300012986|Ga0164304_10151266All Organisms → cellular organisms → Bacteria1462Open in IMG/M
3300012987|Ga0164307_11470612Not Available575Open in IMG/M
3300013307|Ga0157372_10436075All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1527Open in IMG/M
3300014157|Ga0134078_10416598Not Available606Open in IMG/M
3300014495|Ga0182015_10817960Not Available585Open in IMG/M
3300015199|Ga0167647_1061970All Organisms → cellular organisms → Bacteria → Acidobacteria1010Open in IMG/M
3300015357|Ga0134072_10344648Not Available570Open in IMG/M
3300017955|Ga0187817_10710295All Organisms → cellular organisms → Bacteria → Acidobacteria641Open in IMG/M
3300017961|Ga0187778_10165199All Organisms → cellular organisms → Bacteria → Acidobacteria1401Open in IMG/M
3300017975|Ga0187782_10040847All Organisms → cellular organisms → Bacteria3376Open in IMG/M
3300018012|Ga0187810_10411787Not Available569Open in IMG/M
3300018027|Ga0184605_10333598All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → unclassified Terriglobales → Acidobacteriales bacterium 13_2_20CM_55_8685Open in IMG/M
3300018034|Ga0187863_10151216All Organisms → cellular organisms → Bacteria → Acidobacteria1295Open in IMG/M
3300018046|Ga0187851_10544528All Organisms → cellular organisms → Bacteria → Acidobacteria657Open in IMG/M
3300018064|Ga0187773_10891271All Organisms → cellular organisms → Bacteria574Open in IMG/M
3300018085|Ga0187772_10399008Not Available957Open in IMG/M
3300019278|Ga0187800_1304803All Organisms → cellular organisms → Bacteria → Acidobacteria702Open in IMG/M
3300019879|Ga0193723_1086574All Organisms → cellular organisms → Bacteria → Acidobacteria894Open in IMG/M
3300019881|Ga0193707_1164476All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → unclassified Terriglobales → Acidobacteriales bacterium 13_2_20CM_55_8605Open in IMG/M
3300020580|Ga0210403_11494650Not Available508Open in IMG/M
3300020581|Ga0210399_11609639Not Available500Open in IMG/M
3300021170|Ga0210400_10867789All Organisms → cellular organisms → Bacteria → Acidobacteria738Open in IMG/M
3300021170|Ga0210400_10891396All Organisms → cellular organisms → Bacteria → Acidobacteria726Open in IMG/M
3300021171|Ga0210405_10291208Not Available1291Open in IMG/M
3300021405|Ga0210387_11186629All Organisms → cellular organisms → Bacteria → Acidobacteria663Open in IMG/M
3300021407|Ga0210383_10707575Not Available866Open in IMG/M
3300021433|Ga0210391_10418908Not Available1051Open in IMG/M
3300021433|Ga0210391_10986082Not Available656Open in IMG/M
3300022533|Ga0242662_10191130All Organisms → cellular organisms → Bacteria → Acidobacteria640Open in IMG/M
3300022722|Ga0242657_1156300All Organisms → cellular organisms → Bacteria → Acidobacteria604Open in IMG/M
3300025854|Ga0209176_10064429All Organisms → cellular organisms → Bacteria → Acidobacteria831Open in IMG/M
3300025911|Ga0207654_10073343All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium2040Open in IMG/M
3300025911|Ga0207654_10433991All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium919Open in IMG/M
3300025912|Ga0207707_10628232All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium907Open in IMG/M
3300025928|Ga0207700_10873896All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae805Open in IMG/M
3300025939|Ga0207665_10054749All Organisms → cellular organisms → Bacteria2691Open in IMG/M
3300025941|Ga0207711_11415480All Organisms → cellular organisms → Bacteria → Acidobacteria638Open in IMG/M
3300026297|Ga0209237_1011634All Organisms → cellular organisms → Bacteria → Acidobacteria5221Open in IMG/M
3300026497|Ga0257164_1076699All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → unclassified Terriglobales → Acidobacteriales bacterium 13_2_20CM_55_8561Open in IMG/M
3300027047|Ga0208730_1001916All Organisms → cellular organisms → Bacteria → Acidobacteria1846Open in IMG/M
3300027548|Ga0209523_1007516All Organisms → cellular organisms → Bacteria → Acidobacteria1930Open in IMG/M
3300027625|Ga0208044_1018386All Organisms → cellular organisms → Bacteria → Acidobacteria2530Open in IMG/M
3300027915|Ga0209069_10233474All Organisms → cellular organisms → Bacteria → Acidobacteria950Open in IMG/M
3300028381|Ga0268264_12025768Not Available585Open in IMG/M
3300031708|Ga0310686_117151778Not Available615Open in IMG/M
3300031715|Ga0307476_10529636Not Available873Open in IMG/M
3300031820|Ga0307473_10122192All Organisms → cellular organisms → Bacteria1431Open in IMG/M
3300032770|Ga0335085_11723073All Organisms → cellular organisms → Bacteria → Acidobacteria645Open in IMG/M
3300032783|Ga0335079_12192521All Organisms → cellular organisms → Bacteria → Acidobacteria527Open in IMG/M


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil10.62%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil9.73%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere7.96%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil6.19%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil5.31%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil5.31%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil4.42%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere4.42%
Peatlands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil3.54%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland3.54%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil2.65%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil2.65%
Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil2.65%
Corn RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere2.65%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere2.65%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Peatland1.77%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment1.77%
WatershedsEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds1.77%
Surface SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil1.77%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere1.77%
Bog Forest SoilEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil0.89%
SoilEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Soil0.89%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment0.89%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil0.89%
Glacier Forefield SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soil0.89%
Arctic Peat SoilEnvironmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil0.89%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil0.89%
Grass SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grass Soil0.89%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil0.89%
PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Peatland0.89%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Soil0.89%
Prmafrost SoilEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Prmafrost Soil0.89%
PalsaEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Palsa0.89%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil0.89%
SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Soil0.89%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere0.89%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere0.89%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere0.89%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere0.89%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
2170459005Grass soil microbial communities from Rothamsted Park, UK - July 2009 direct MP BIO1O1 lysis 0-21cmEnvironmentalOpen in IMG/M
3300000955Soil microbial communities from Great Prairies - Iowa, Native Prairie soilEnvironmentalOpen in IMG/M
3300001661Mediterranean Blodgett CA OM1_O3 (Mediterranean Blodgett coassembly)EnvironmentalOpen in IMG/M
3300004091Coassembly of ECP14_OM1, ECP14_OM2, ECP14_OM3EnvironmentalOpen in IMG/M
3300005166Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_123EnvironmentalOpen in IMG/M
3300005167Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_121EnvironmentalOpen in IMG/M
3300005337Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaGEnvironmentalOpen in IMG/M
3300005343Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaGEnvironmentalOpen in IMG/M
3300005434Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaGEnvironmentalOpen in IMG/M
3300005436Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaGEnvironmentalOpen in IMG/M
3300005445Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaGEnvironmentalOpen in IMG/M
3300005458Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaGEnvironmentalOpen in IMG/M
3300005468Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaGEnvironmentalOpen in IMG/M
3300005534Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen07_05102014_R1EnvironmentalOpen in IMG/M
3300005541Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1EnvironmentalOpen in IMG/M
3300005546Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaGEnvironmentalOpen in IMG/M
3300005554Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110EnvironmentalOpen in IMG/M
3300005556Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156EnvironmentalOpen in IMG/M
3300005557Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_153EnvironmentalOpen in IMG/M
3300005563Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2Host-AssociatedOpen in IMG/M
3300005764Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)EnvironmentalOpen in IMG/M
3300005944Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 2 DNA2013-048EnvironmentalOpen in IMG/M
3300005993Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 1 DNA2013-046EnvironmentalOpen in IMG/M
3300006028Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaGEnvironmentalOpen in IMG/M
3300006047Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2013EnvironmentalOpen in IMG/M
3300006163Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaGEnvironmentalOpen in IMG/M
3300006176Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5EnvironmentalOpen in IMG/M
3300006854Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4Host-AssociatedOpen in IMG/M
3300006903Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD5Host-AssociatedOpen in IMG/M
3300007255Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1EnvironmentalOpen in IMG/M
3300009092Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaGHost-AssociatedOpen in IMG/M
3300009093Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaGHost-AssociatedOpen in IMG/M
3300009174Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaGHost-AssociatedOpen in IMG/M
3300009698Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_3_AS metaGEnvironmentalOpen in IMG/M
3300009700Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_4_PS metaGEnvironmentalOpen in IMG/M
3300010043Tropical forest soil microbial communities from Panama - MetaG Plot_26EnvironmentalOpen in IMG/M
3300010320Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_11112015EnvironmentalOpen in IMG/M
3300010359Tropical forest soil microbial communities from Panama - MetaG Plot_15EnvironmentalOpen in IMG/M
3300010360Tropical forest soil microbial communities from Panama - MetaG Plot_6EnvironmentalOpen in IMG/M
3300010379Sb_50d combined assemblyEnvironmentalOpen in IMG/M
3300010401Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1EnvironmentalOpen in IMG/M
3300011269Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaGEnvironmentalOpen in IMG/M
3300011444Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT800_2EnvironmentalOpen in IMG/M
3300012096Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaGEnvironmentalOpen in IMG/M
3300012209Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaGEnvironmentalOpen in IMG/M
3300012210Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaGEnvironmentalOpen in IMG/M
3300012224Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_20cm_2_4_2 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012363Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaGEnvironmentalOpen in IMG/M
3300012377Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_20cm_2_8_2 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012403Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_2_8_2 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012405Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_20cm_5_24_2 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012918Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaGEnvironmentalOpen in IMG/M
3300012929Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012930Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012971Tropical forest soil microbial communities from Panama - MetaG Plot_1EnvironmentalOpen in IMG/M
3300012986Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_217_MGEnvironmentalOpen in IMG/M
3300012987Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_243_MGEnvironmentalOpen in IMG/M
3300012989Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MGEnvironmentalOpen in IMG/M
3300013307Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaGHost-AssociatedOpen in IMG/M
3300014157Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_20cm_2_24_1 metaGEnvironmentalOpen in IMG/M
3300014495Permafrost microbial communities from Stordalen Mire, Sweden - 712P3M metaGEnvironmentalOpen in IMG/M
3300015199Arctic soil microbial communities from a glacier forefield, Storglaci?ren, Tarfala, Sweden (Sample st-2c, rock/snow interface)EnvironmentalOpen in IMG/M
3300015357Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_5_0_1 metaGEnvironmentalOpen in IMG/M
3300017955Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_2EnvironmentalOpen in IMG/M
3300017961Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_20_MGEnvironmentalOpen in IMG/M
3300017975Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP15_20_MGEnvironmentalOpen in IMG/M
3300018012Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_5EnvironmentalOpen in IMG/M
3300018027Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30_coexEnvironmentalOpen in IMG/M
3300018034Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_11_10EnvironmentalOpen in IMG/M
3300018046Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_6_10EnvironmentalOpen in IMG/M
3300018064Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP05_10_MGEnvironmentalOpen in IMG/M
3300018085Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_20_MGEnvironmentalOpen in IMG/M
3300019278Metatranscriptome of tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP12_20_MT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300019879Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2m2EnvironmentalOpen in IMG/M
3300019881Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U3c2EnvironmentalOpen in IMG/M
3300020580Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-MEnvironmentalOpen in IMG/M
3300020581Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-MEnvironmentalOpen in IMG/M
3300021170Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-MEnvironmentalOpen in IMG/M
3300021171Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-MEnvironmentalOpen in IMG/M
3300021405Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-OEnvironmentalOpen in IMG/M
3300021407Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-OEnvironmentalOpen in IMG/M
3300021433Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-OEnvironmentalOpen in IMG/M
3300022533Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-7-M (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300022722Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-12-M (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300025854Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE Permafrost305-11B (SPAdes)EnvironmentalOpen in IMG/M
3300025911Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025912Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025928Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025939Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025941Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026297Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_1_40cm (SPAdes)EnvironmentalOpen in IMG/M
3300026497Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - CO-08-BEnvironmentalOpen in IMG/M
3300027047Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF042 (SPAdes)EnvironmentalOpen in IMG/M
3300027548Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM3H0_M1 (SPAdes)EnvironmentalOpen in IMG/M
3300027625Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_c_BC metaG (SPAdes)EnvironmentalOpen in IMG/M
3300027915Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2013 (SPAdes)EnvironmentalOpen in IMG/M
3300028381Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300031708FICUS49499 Metagenome Czech Republic combined assemblyEnvironmentalOpen in IMG/M
3300031715Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_05EnvironmentalOpen in IMG/M
3300031820Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515EnvironmentalOpen in IMG/M
3300031890Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2)EnvironmentalOpen in IMG/M
3300032180Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515EnvironmentalOpen in IMG/M
3300032770Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5EnvironmentalOpen in IMG/M
3300032783Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.3EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
E41_041356602170459005Grass SoilTGNYHWRYQAGSLTHDLAERLANLAEVTDRLPQPVSLPPSEDFIA
JGI1027J12803_10080930113300000955SoilRGGNWRWRLQPGALTPGLAKKMALLAEVSDRLPEPPPQPADHDFAA*
JGI12053J15887_1035119923300001661Forest SoilSVTDGNFRWRYQPGSLTRALAEKLAALAEVTDRVPPSMPVPRDEDFAA*
Ga0062387_10156893023300004091Bog Forest SoilRWRYQPGSLTQQLAGRLAGLAEVTDRLPPAVPAPPAEDFSA*
Ga0066674_1041086213300005166SoilLNTPSKHDGNYHWRMQPGSLTRELADKLSRLAEVTDRLPQPVPVQNEEDFMA*
Ga0066672_1001327963300005167SoilWRLQPGALTQELAAKLARLAEVTDRLPQPLPVPPEEEFAA*
Ga0070682_10022109113300005337Corn RhizosphereVSEGNFLWRYQPGSLTRALAEKLAALAEVTDRVPPPMPVPQDEDFAA*
Ga0070687_10144574923300005343Switchgrass RhizosphereYEGNYHWRYQPGSLTRNLSEKLAALAEVTDRLPQRVPLPAEEDFAA*
Ga0070709_1002432353300005434Corn, Switchgrass And Miscanthus RhizosphereNWRWRLQPGVLTPELAKKMAALAEVTDRSPEPLPEPPAEEFAA*
Ga0070713_10016016523300005436Corn, Switchgrass And Miscanthus RhizosphereWRWRLRPGALTQGLAEKMALLAEVTDRLPQPVPVPPEEDFAA*
Ga0070708_10102407523300005445Corn, Switchgrass And Miscanthus RhizosphereLNTPSVHDGNYRWRYQPGSPTRHMAEKLAILAEVTDRLPQPVPIPSGEDFAA*
Ga0070681_1070002023300005458Corn RhizosphereFLWRYQPGSLTRALAEKLAALAEVTDRVPPPMPVPQDEDFAA*
Ga0070707_10082280623300005468Corn, Switchgrass And Miscanthus RhizosphereIHEGNYRWRYQPGVLTRDLAEKLAQLAEVTDRLPQPVPVPPSEDFAA*
Ga0070735_1055595513300005534Surface SoilKTGNYHWRYQPGSLTRDLVNRLANLAEVTDRLPQPVSMPPGEDFVA*
Ga0070733_1037743223300005541Surface SoilRLNTPSVKTGNYLWRCQPGSLTPSLAERLVNLAEVTDRLPQPVSVPSSEDFIA*
Ga0070696_10022449223300005546Corn, Switchgrass And Miscanthus RhizosphereTPSVSEGNFRWRYQPGSLTRALAEKLAALAEVTDRVPPPMPVPPDEEFGA*
Ga0066661_1089407423300005554SoilRLNTPSVCEGNFRWRYSPGLLTGALAEKLAALAAVTDRLPQHFPPPPSEDFVA*
Ga0066707_1039669213300005556SoilEGNYHWRYQPGSLTRNLSEKLAALAEVTDRLPQPVPLPAEEDFAA*
Ga0066704_1018037033300005557SoilGNWRWRLQPGALTQELAAKLAQLAEVTDRLPQPLPVPPEEEFAA*
Ga0068855_10251219623300005563Corn RhizosphereNALQSYMAERLAQIAEVTDRLPTPAPIPPNEDFVA*
Ga0066903_10563556113300005764Tropical Forest SoilGSLTRELAERLARLAELTDRLPDPVPLPTGQDFVA*
Ga0066788_1000604613300005944SoilALTPQLAERLATLAEVTDRLPPPVPLPPSQVFVA*
Ga0080027_1031635913300005993Prmafrost SoilTEGNYHWRYQPGSLTPELAQRLADLAEVTDRLPKAINERQGENFPA*
Ga0070717_1043711513300006028Corn, Switchgrass And Miscanthus RhizospherePGAYTPKMAEELAKLAEVTDRLPQPLPMPPEEEFSA*
Ga0075024_10053270223300006047WatershedsRLQPGVLTQELTAKLALLAEVTDRLPQPIPEPPAEEFAA*
Ga0070715_1078161933300006163Corn, Switchgrass And Miscanthus RhizosphereALTQKLAAKLARLAEVTDRLPQPLPVPAEEEFAA*
Ga0070765_10049633323300006176SoilPSVPNGNFRWRYQPGVLTPGLAERLATLAVVTDRLAPPVPLPSGEDFVA*
Ga0075425_10251556823300006854Populus RhizosphereWRYQPGSLTRNLSEKLAALAEVTDRLPQRVPLPAEEDFAA*
Ga0075425_10290966023300006854Populus RhizosphereNGNFLWRYQLGSLTRELSDKLAALAEVSDRLPSVVPAPPAEEFVA*
Ga0075426_1091451223300006903Populus RhizosphereNTPSVSEGNFRWRYQPGSLTRALAEKLAALAEVTDRVPPPMPVPHDEDFAA*
Ga0099791_1015911213300007255Vadose Zone SoilNYHWRYQPGSLTRNLSEKLAALAEVTDRLPQPVPPPAEEDFAA*
Ga0105250_1040790413300009092Switchgrass RhizosphereGRLNTPSVTDGNFRWRYQPASLTSALAEKLAALAEVTDRVPPPMLVPRDEEFAA*
Ga0105240_1044361713300009093Corn RhizosphereNFRWRYQPGSLTRALAEKLAALAEVTDRVPPPMPVPQHEDFAA*
Ga0105241_1024617613300009174Corn RhizosphereVSEGNFRWRYQPGSLTRALAEKLAALAEVTDRVPPPMPVPHDEDFAA*
Ga0105241_1025543713300009174Corn RhizosphereVSEGNFRWRYQPGSLTRALAEKLAALAEVTDRVPPPMPVPQHEDFAA*
Ga0116216_1062092423300009698Peatlands SoilVANGSFRWRYQPGSLTRELADRLERLDEVTERTPKPMPAPPGEDFSA*
Ga0116217_1012525513300009700Peatlands SoilNYLWRYQPGSLTPALAAKLASLAEVTDRLPQPLPVPPSEDFAA*
Ga0126380_1122847413300010043Tropical Forest SoilWRWRLQPGALMPELAKEMAALSEVTDRSPESLPEPSTEEFAA*
Ga0134109_1025932723300010320Grasslands SoilSLTRELADKLSRLAEVTDRLPQPIQVPTEQDFFA*
Ga0126376_1017620423300010359Tropical Forest SoilQPGSLTPELAEKMADLSEVTDRSPEPLPEPPAEEFAA*
Ga0126376_1027996143300010359Tropical Forest SoilYHWRYQPGSLKPELAEKLARIAEVTDRLPQPVAQPAPEDFVA*
Ga0126372_1046553013300010360Tropical Forest SoilPGSLTPELAEKMADLSEVTDRSPEPLPEPPAEEFAA*
Ga0136449_10159639613300010379Peatlands SoilGSFRWRYQPGSLTRDLAERLASLAEVTDRLPPPVLVPLVEDFAA*
Ga0134121_1250589813300010401Terrestrial SoilPGSLTDRLAEKLAALATVTDRLPSHVLPPPSEDFAA*
Ga0137392_1124306813300011269Vadose Zone SoilRWRYQPGSLTRHMAEKLAILAEVTDRLPQPVPIPPGEDFAA*
Ga0137463_135129213300011444SoilGNFRWRYQPGSLTRALAEKLAALAEVTDRVPPPMPVPQDEEFAA*
Ga0137389_1007953843300012096Vadose Zone SoilLNTPSVSEGNFRWRYQPGSLTRALAEKLAALAAVTDRLPPHVLPPPSEDFVA*
Ga0137379_1024635313300012209Vadose Zone SoilPEGSLRPELADKLAALAEVTDRLPELIPVPSHADFFA*
Ga0137378_1109984913300012210Vadose Zone SoilRLNTPSKHDGNYHWRMQPGSLTRELADKLSRLAEVTDRLPRPIQLPTEQEFFA*
Ga0137378_1133935213300012210Vadose Zone SoilRLNTPSKHDGNYHWRMQPGSLTRELADKLSRLAEVTDRLPQPVPVQNEEDFMA*
Ga0134028_119190013300012224Grasslands SoilGKHDGNYHWRMQPGSLTRELADKLSRLAEVTDRLPRPIQLPTEQEFFA*
Ga0137390_1058062613300012363Vadose Zone SoilHWRYLPGSLKSELAEKLAALAEVTDRVPESFPVRVPEDFVA*
Ga0134029_108464113300012377Grasslands SoilHDGNYHWRMQPGSLTRELADKLSRLAEVTDRLPRPIQLPTEQEFFA*
Ga0134049_110592123300012403Grasslands SoilYHWRMQPGSLTRELAEKLARLAEVTDRLPQPIQLPTEQEFFA*
Ga0134041_106916223300012405Grasslands SoilQPGSLTRELADKLSRLAEVTDRLPRPIQLPTEQEFFA*
Ga0137396_1015115813300012918Vadose Zone SoilPGALNPGLAAKLAHLAEVTDRLPEPIAALGPDEFVA*
Ga0137404_1013127513300012929Vadose Zone SoilMQPGSLTRELADKLSRLAEVTDRLPQPVPVQNEEDFMA*
Ga0137404_1188536923300012929Vadose Zone SoilNTPSHHEGNYHWRYQPGSLTRALSEKLAALAEVTDRLPQHVPLLPEEDFAA*
Ga0137407_1017707913300012930Vadose Zone SoilSTINGNFLWRFKPGSLTRELSEKLAALAEVSDRLPTSMPVPQAEEFVA*
Ga0126369_1316463123300012971Tropical Forest SoilNTPSTHEGNYRWRMQPGSLMPAVRDKLAQLAEVCDRLPQPVPVPSKDNFVA*
Ga0164304_1015126613300012986SoilIGNYHWRCQPGSLKAELAQKLASLAEVTDRLPHPKPL*
Ga0164307_1147061223300012987SoilNFRWRYQPGSLTPALATKLAALAEVTDRVRTPMPVPEDEDFAA*
Ga0164305_1215129023300012989SoilQPGVLTSDLAKKMASLSEVADRLPQPLPQPPAEEFAA*
Ga0157372_1043607513300013307Corn RhizosphereTPSVSEGNFRWRYQPGSLTRALAEKLAALAEVTDRVPPPMPVPQHEDFAA*
Ga0134078_1041659823300014157Grasslands SoilYHWRMQPGSLTRELADKLSRLAEVTDRLPQPVPVQNEEDFMA*
Ga0182015_1081796023300014495PalsaWRYQPGSLDHSLAERLANLAEVTDRLPQPVPEPPNEDFVA*
Ga0167647_106197013300015199Glacier Forefield SoilNYHWRFQAGSLTKKLAEQLAALAEVTDRLPAKIPIPPNENFAA*
Ga0134072_1034464823300015357Grasslands SoilWRMQPGSFTRDLADKLARLAEVTDRLPQPVPVQNEEDFMA*
Ga0187817_1071029513300017955Freshwater SedimentSVANGSFRWRYQPGSLTRELADRLACLAEVTDRTPPPMPSPPAEDFAA
Ga0187778_1016519943300017961Tropical PeatlandGSLKPELAQKLAALAEVTDRLPQPVRVPPSEEFLA
Ga0187782_1004084713300017975Tropical PeatlandAGSLTPSLAEKLANLAEVTDRLPQPVPVPADEGFVA
Ga0187810_1041178723300018012Freshwater SedimentHWRYLPGSLTRDLAERLASLAELTDRLPPPVPVPPAEDFAA
Ga0184605_1033359823300018027Groundwater SedimentTPSRHEGNYHWRYQPGSLTHNLSEKLAALAEVTDRLPQPVPLPAEEDFAA
Ga0187863_1015121623300018034PeatlandHGNYHWRMQPGALTSQMAEKLANLAEVTDRLPQPVPIPPAEDFIA
Ga0187851_1054452813300018046PeatlandFRWRMASGSLTPALAEKLADLAEVTDRLPQKTPVPADEGFVA
Ga0187773_1089127123300018064Tropical PeatlandRWRYQPGSLTRELAEKLAALAEVTDRLPQPVRVPPGEEFVA
Ga0187772_1039900823300018085Tropical PeatlandFNIPSTKQGNFRWRYAEGSLARPLAEKLAALAEVTDRLPQAFPGPPDEEFAA
Ga0187800_130480323300019278PeatlandGNFHWRFQADALTRPLAEKLANLAEVTDRIPQPVPVPPSENFAA
Ga0193723_108657413300019879SoilQPGSLTRNLSEKLAALAEVTDRLPQPVPVPKEEDFAA
Ga0193707_116447613300019881SoilGNYHWRYQPGSLTRNLSEKLAALAEVTDRLPQPVPLPKEEDFAT
Ga0210403_1149465023300020580SoilVKTGNYLWRCKPGALTRDLAQHLSRLAEVADRLPQPVSVPPGEDFVA
Ga0210399_1160963913300020581SoilGNWRWRFSLAQITPELIAKLAQLAELTDRLPQPLSVRPDEDFAA
Ga0210400_1086778913300021170SoilFQPGALTPALAAKLASLAEVTDRLPQPLTIPRAEEWVA
Ga0210400_1089139623300021170SoilSVKTGNYLWRYQPGALTRERAERLANLAAVTDRLPQPVSVPPAEEFVA
Ga0210405_1029120823300021171SoilPGLLTPNLAERLANLAEVTDRLPQPVTVPSSEGFIA
Ga0210387_1118662923300021405SoilEPGSLTRDLSERLANLAEVTDRLPQPVSLPASEDFIA
Ga0210383_1070757513300021407SoilLNIPSVASGNFRWRFQPDALTGDLAQRLATLAEVTDRLPQPVPAPPNEDFAA
Ga0210391_1041890823300021433SoilSVTNGNYRWRYQPGSLTRELAERLASLAEVADRQAQSVPVPPEEDFVA
Ga0210391_1098608223300021433SoilKTCNYLWRYQPGLLTPNLAERLANLAEVTDRLPQPVTVPSSEGFIA
Ga0242662_1019113023300022533SoilGALTPALAAKLASLAEVTDRLPQLLTIPRAEEWVA
Ga0242657_115630023300022722SoilRWRYQRGALTPALAAKLALLAEVTDRLPQPLPVPPDETFVA
Ga0209176_1006442913300025854Arctic Peat SoilTGNYRWRYQPGSLTPQLAERLASLAEVTDRLPPAVSVPPNEDFAA
Ga0207654_1007334333300025911Corn RhizosphereSVSEGNFRWRYQPGSLTRALAEKLAALAEVTDRVPPPMPVPHDEDFAA
Ga0207654_1043399113300025911Corn RhizosphereSVSEGNFRWRYQPGSLTRALAEKLAALAEVTDRVPPPMPVPQHEDFAA
Ga0207707_1062823223300025912Corn RhizosphereGNFLWRYQPGSLTRALAEKLAALAEVTDRVPPPMPVPQDEDFAA
Ga0207700_1087389623300025928Corn, Switchgrass And Miscanthus RhizosphereRPGALTQGLAEKMALLAEVTDRLPQPVPVPPEEDFAA
Ga0207665_1005474943300025939Corn, Switchgrass And Miscanthus RhizosphereGSLKDALAQKLAALATVTDRLPPHVLPPPSEDFVA
Ga0207711_1141548013300025941Switchgrass RhizosphereTPSTSVGNYLWRFQPNALQSYMAERLAQIAEVTDRLPTPAPIPPNEDFVA
Ga0209237_101163483300026297Grasslands SoilKHDGNYHWRMQPGSLTRELADKLSRLAEVTDRLPRPIQLPTEQEFFA
Ga0257164_107669913300026497SoilRWRYQPGSLTRALAEKLAALAAVTDRLPPHVLPPPSEDFVA
Ga0208730_100191613300027047Forest SoilRLQPGALTQELAAKLARLAEVTDRLPQPLPVPPEEEFAA
Ga0209523_100751613300027548Forest SoilPGALTQELAAKLALLAEVTDRLPQPLPVPGQEEFAA
Ga0208044_101838613300027625Peatlands SoilQPGSLTAALAEKLANLAEVTDRVPQPLPVPPSEHFIA
Ga0209069_1023347423300027915WatershedsRWRLKPGVLTQELTAKLALLAEVTDRLPQPIPEPPAEEFAA
Ga0268264_1202576823300028381Switchgrass RhizosphereRLNTPSVTDGNFRWRYQPASLTSALAEKLAALAEVTDRVPPPMLVPRDEEFAA
Ga0310686_11715177823300031708SoilWRYQPGSLTRELAERLASLAEVSDRLPQPVSVPPTEDFVA
Ga0307476_1052963613300031715Hardwood Forest SoilPGSLTHSLAERLANLAEVTDRLPQPVPKPPSEDFIA
Ga0307473_1012219243300031820Hardwood Forest SoilHWRMQPRSLTRELAEKLARLAEVTDRLPQPIQVPMEQDFFA
Ga0306925_1005012713300031890SoilKEVGNYHWRCAPGMLTAPLAEKLAALAEVADRLPQPFAVPPDEPFLA
Ga0307471_10103526913300032180Hardwood Forest SoilGGNWRWRLQPGVLTPELAKQMAALAEVTDRLPEPLPEPPAEEFAA
Ga0335085_1172307323300032770SoilYRWRLQSGALTSALAAKLASMAEVTDRLPQALPVPADEPFAA
Ga0335079_1090132323300032783SoilVGNYHWRYQPGSLKPELAQKLAALAEVSDRLPPPVRVPPSEEFLA
Ga0335079_1219252113300032783SoilKWRFEASALTSELAEKLAQLAEVTDRLPQPAKPQKDEDFAA

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.