Metagenome Family F083510

Basic Information
Family ID	F083510
Family Type	Metagenome
Number of Sequences	112
Average Sequence Length	41 residues
Representative Sequence	MFNGSFLRVCRILRFVKKLDFAFLSLGGPSHGARVWCL
Number of Associated Samples	64
Number of Associated Scaffolds	111

Quality Assessment
Transcriptomic Evidence	No
Most common taxonomic group	Unclassified
% of genes with valid RBS motifs	98.21 %
% of genes near scaffold ends (potentially truncated)	100.00 %
% of genes from short scaffolds (< 2000 bps)	100.00 %
Associated GOLD sequencing projects	64
AlphaFold2 3D model prediction	Yes
3D model pTM-score	0.36

Hidden Markov Model


Click on a Sequence Logo column to get its information.
Powered by Skylign

Most Common Taxonomy
Group	Unclassified (100.000 % of family members)
NCBI Taxonomy ID	N/A
Taxonomy	N/A

Most Common Ecosystem
GOLD Ecosystem	Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Switchgrass Phyllosphere (57.143 % of family members)
Environment Ontology (ENVO)	Unclassified (91.071 % of family members)
Earth Microbiome Project Ontology (EMPO)	Host-associated → Plant → Plant surface (91.071 % of family members)

Full Alignment
Alignment of all the sequences in the family.

Powered by MSAViewer

Seed Alignment
Alignment of a non-redundant set of sequences, used to build the family's HMM profile.

Powered by MSAViewer

AlphaFold2 Input Alignment
Refined alignment used as input for AlphaFold2.

Powered by MSAViewer

Predicted Topology & Secondary Structure
Classification:	Globular	Signal Peptide:	No	Secondary Structure distribution:	α-helix: 42.42% β-sheet: 0.00% Coil/Unstructured: 57.58%
Feature Viewer

Powered by Feature Viewer

Structure Viewer


Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100	pTM-score: 0.36
Secondary Structure: α-helix β-sheet Coil Turn	pTM-score: 0.36
Powered by PDBe Molstar

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	100.00 %

Visualization

Powered by ApexCharts

Scaffold	Taxonomy	Length	IMG/M Link
3300005841\|Ga0068863_101167200	Not Available	775	Open in IMG/M
3300005841\|Ga0068863_102117821	Not Available	572	Open in IMG/M
3300005841\|Ga0068863_102199679	Not Available	561	Open in IMG/M
3300005841\|Ga0068863_102394363	Not Available	537	Open in IMG/M
3300005842\|Ga0068858_101093777	Not Available	782	Open in IMG/M
3300010371\|Ga0134125_11944934	Not Available	639	Open in IMG/M
3300010399\|Ga0134127_11652324	Not Available	715	Open in IMG/M
3300010399\|Ga0134127_12445518	Not Available	602	Open in IMG/M
3300010403\|Ga0134123_12092839	Not Available	626	Open in IMG/M
3300013306\|Ga0163162_13360294	Not Available	511	Open in IMG/M
3300015280\|Ga0182100_1019363	Not Available	855	Open in IMG/M
3300015280\|Ga0182100_1042697	Not Available	672	Open in IMG/M
3300015290\|Ga0182105_1049337	Not Available	662	Open in IMG/M
3300015290\|Ga0182105_1057336	Not Available	630	Open in IMG/M
3300015293\|Ga0182103_1072349	Not Available	569	Open in IMG/M
3300015297\|Ga0182104_1089605	Not Available	561	Open in IMG/M
3300015306\|Ga0182180_1038970	Not Available	691	Open in IMG/M
3300015306\|Ga0182180_1044442	Not Available	659	Open in IMG/M
3300015310\|Ga0182162_1074383	Not Available	619	Open in IMG/M
3300015311\|Ga0182182_1124312	Not Available	500	Open in IMG/M
3300015312\|Ga0182168_1091518	Not Available	590	Open in IMG/M
3300015312\|Ga0182168_1110129	Not Available	549	Open in IMG/M
3300015313\|Ga0182164_1044981	Not Available	759	Open in IMG/M
3300015313\|Ga0182164_1048094	Not Available	742	Open in IMG/M
3300015316\|Ga0182121_1124723	Not Available	537	Open in IMG/M
3300015318\|Ga0182181_1071438	Not Available	595	Open in IMG/M
3300015319\|Ga0182130_1062353	Not Available	670	Open in IMG/M
3300015320\|Ga0182165_1147262	Not Available	501	Open in IMG/M
3300015325\|Ga0182148_1140395	Not Available	511	Open in IMG/M
3300015326\|Ga0182166_1129563	Not Available	526	Open in IMG/M
3300015327\|Ga0182114_1075072	Not Available	687	Open in IMG/M
3300015327\|Ga0182114_1075072	Not Available	687	Open in IMG/M
3300015330\|Ga0182152_1148873	Not Available	511	Open in IMG/M
3300015331\|Ga0182131_1112938	Not Available	574	Open in IMG/M
3300015332\|Ga0182117_1095745	Not Available	642	Open in IMG/M
3300015334\|Ga0182132_1069679	Not Available	721	Open in IMG/M
3300015334\|Ga0182132_1082780	Not Available	675	Open in IMG/M
3300015336\|Ga0182150_1163629	Not Available	506	Open in IMG/M
3300015338\|Ga0182137_1111672	Not Available	618	Open in IMG/M
3300015340\|Ga0182133_1184733	Not Available	511	Open in IMG/M
3300015348\|Ga0182115_1095427	Not Available	930	Open in IMG/M
3300015348\|Ga0182115_1180346	Not Available	677	Open in IMG/M
3300015348\|Ga0182115_1266291	Not Available	544	Open in IMG/M
3300015349\|Ga0182185_1052209	Not Available	1080	Open in IMG/M
3300015349\|Ga0182185_1227797	Not Available	566	Open in IMG/M
3300015350\|Ga0182163_1039006	Not Available	1294	Open in IMG/M
3300015350\|Ga0182163_1123249	Not Available	797	Open in IMG/M
3300015350\|Ga0182163_1275229	Not Available	527	Open in IMG/M
3300015352\|Ga0182169_1246099	Not Available	581	Open in IMG/M
3300015352\|Ga0182169_1264213	Not Available	558	Open in IMG/M
3300015352\|Ga0182169_1292469	Not Available	526	Open in IMG/M
3300015352\|Ga0182169_1298018	Not Available	520	Open in IMG/M
3300015353\|Ga0182179_1111236	Not Available	828	Open in IMG/M
3300015353\|Ga0182179_1205804	Not Available	627	Open in IMG/M
3300015353\|Ga0182179_1277793	Not Available	543	Open in IMG/M
3300015354\|Ga0182167_1313066	Not Available	555	Open in IMG/M
3300015354\|Ga0182167_1315750	Not Available	552	Open in IMG/M
3300015354\|Ga0182167_1328349	Not Available	538	Open in IMG/M
3300017414\|Ga0182195_1077293	Not Available	760	Open in IMG/M
3300017414\|Ga0182195_1079494	Not Available	752	Open in IMG/M
3300017414\|Ga0182195_1161613	Not Available	573	Open in IMG/M
3300017414\|Ga0182195_1167289	Not Available	565	Open in IMG/M
3300017432\|Ga0182196_1119903	Not Available	552	Open in IMG/M
3300017432\|Ga0182196_1140182	Not Available	522	Open in IMG/M
3300017435\|Ga0182194_1114116	Not Available	564	Open in IMG/M
3300017439\|Ga0182200_1158474	Not Available	509	Open in IMG/M
3300017439\|Ga0182200_1164809	Not Available	502	Open in IMG/M
3300017447\|Ga0182215_1165235	Not Available	515	Open in IMG/M
3300017692\|Ga0182210_1108805	Not Available	601	Open in IMG/M
3300017693\|Ga0182216_1076171	Not Available	768	Open in IMG/M
3300017693\|Ga0182216_1089489	Not Available	723	Open in IMG/M
3300020023\|Ga0182178_1000853	Not Available	1460	Open in IMG/M
3300020023\|Ga0182178_1004377	Not Available	878	Open in IMG/M
3300020023\|Ga0182178_1021307	Not Available	517	Open in IMG/M
3300028050\|Ga0268328_1013225	Not Available	888	Open in IMG/M
3300028051\|Ga0268344_1008096	Not Available	717	Open in IMG/M
3300028054\|Ga0268306_1018590	Not Available	619	Open in IMG/M
3300028056\|Ga0268330_1018017	Not Available	773	Open in IMG/M
3300028056\|Ga0268330_1026040	Not Available	686	Open in IMG/M
3300028056\|Ga0268330_1061098	Not Available	507	Open in IMG/M
3300028058\|Ga0268332_1055519	Not Available	575	Open in IMG/M
3300028058\|Ga0268332_1072634	Not Available	519	Open in IMG/M
3300028062\|Ga0268342_1017115	Not Available	692	Open in IMG/M
3300028064\|Ga0268340_1021556	Not Available	814	Open in IMG/M
3300028064\|Ga0268340_1032068	Not Available	717	Open in IMG/M
3300028064\|Ga0268340_1074730	Not Available	531	Open in IMG/M
3300028140\|Ga0268334_1014403	Not Available	555	Open in IMG/M
3300028141\|Ga0268326_1012737	Not Available	522	Open in IMG/M
3300028142\|Ga0268347_1021388	Not Available	587	Open in IMG/M
3300028142\|Ga0268347_1024092	Not Available	565	Open in IMG/M
3300028142\|Ga0268347_1024959	Not Available	559	Open in IMG/M
3300028151\|Ga0268308_1017798	Not Available	619	Open in IMG/M
3300028151\|Ga0268308_1019956	Not Available	597	Open in IMG/M
3300028151\|Ga0268308_1027228	Not Available	540	Open in IMG/M
3300028151\|Ga0268308_1028833	Not Available	530	Open in IMG/M
3300028154\|Ga0268341_1024667	Not Available	546	Open in IMG/M
3300028154\|Ga0268341_1031909	Not Available	503	Open in IMG/M
3300028248\|Ga0268312_1015285	Not Available	673	Open in IMG/M
3300028248\|Ga0268312_1023095	Not Available	593	Open in IMG/M
3300028248\|Ga0268312_1029594	Not Available	548	Open in IMG/M
3300028248\|Ga0268312_1036018	Not Available	513	Open in IMG/M
3300028248\|Ga0268312_1038895	Not Available	500	Open in IMG/M
3300028262\|Ga0268310_1019987	Not Available	691	Open in IMG/M
3300028262\|Ga0268310_1025171	Not Available	643	Open in IMG/M
3300028262\|Ga0268310_1029802	Not Available	609	Open in IMG/M
3300028464\|Ga0268302_106882	Not Available	548	Open in IMG/M
3300028466\|Ga0268321_106805	Not Available	587	Open in IMG/M
3300028469\|Ga0268337_1003939	Not Available	801	Open in IMG/M
3300028472\|Ga0268315_1008779	Not Available	714	Open in IMG/M
3300028473\|Ga0268319_1020041	Not Available	535	Open in IMG/M
3300028475\|Ga0268327_1019358	Not Available	560	Open in IMG/M
3300028527\|Ga0268335_1014784	Not Available	541	Open in IMG/M

Habitat	Taxonomy	Distribution
Host-Associated	Host-Associated	96.43%
Environmental	Environmental	3.57%

Habitat	Taxonomy	Distribution
Plants	Host-Associated → Plants	96.43%
Terrestrial	Environmental → Terrestrial	3.57%

Habitat	Taxonomy	Distribution
Phyllosphere	Host-Associated → Plants → Phyllosphere	91.07%
Rhizoplane	Host-Associated → Plants → Rhizoplane	5.36%
Soil	Environmental → Terrestrial → Soil	3.57%

Habitat	Taxonomy	Distribution
Unclassified	Host-Associated → Plants → Phyllosphere → Unclassified	91.07%
Epiphytes	Host-Associated → Plants → Rhizoplane → Epiphytes	5.36%
Unclassified	Environmental → Terrestrial → Soil → Unclassified	3.57%

Habitat	Taxonomy	Distribution
Unclassified	Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified	91.07%
Unclassified	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified	5.36%
Unclassified	Environmental → Terrestrial → Soil → Unclassified → Unclassified	3.57%

Habitat	Taxonomy	Distribution
Switchgrass Phyllosphere	Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Switchgrass Phyllosphere	57.14%
Phyllosphere	Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Phyllosphere	33.93%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere	4.46%
Terrestrial Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil	3.57%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere	0.89%

Visualization

Powered by ApexCharts

Associated Samples

Taxon OID	Sample Name	Habitat Type	IMG/M Link
3300005841	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2	Host-Associated	Open in IMG/M
3300005842	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2	Host-Associated	Open in IMG/M
3300010371	Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1	Environmental	Open in IMG/M
3300010399	Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3	Environmental	Open in IMG/M
3300010403	Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3	Environmental	Open in IMG/M
3300013306	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG	Host-Associated	Open in IMG/M
3300015280	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_09MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015290	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_09MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015293	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_09MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015297	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_09MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015306	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_22AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015310	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_MAIN_01AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015311	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_22AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015312	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_01AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015313	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_01AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015316	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_31MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015318	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_22AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015319	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_MAIN_20JUN2016_LD1 MG	Host-Associated	Open in IMG/M
3300015320	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_01AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015325	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_12JUL2016_LD1 MG	Host-Associated	Open in IMG/M
3300015326	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_01AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015327	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_MAIN_31MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015330	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_12JUL2016_LD1 MG	Host-Associated	Open in IMG/M
3300015331	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_20JUN2016_LD1 MG	Host-Associated	Open in IMG/M
3300015332	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_31MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015334	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_20JUN2016_LD1 MG	Host-Associated	Open in IMG/M
3300015336	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_12JUL2016_LD1 MG	Host-Associated	Open in IMG/M
3300015338	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_20JUN2016_LD1 MG	Host-Associated	Open in IMG/M
3300015340	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_20JUN2016_LD1 MG	Host-Associated	Open in IMG/M
3300015348	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_31MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015349	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_22AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015350	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_01AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015352	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_01AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015353	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_22AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015354	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_01AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300017414	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_12SEP2016_LD1 MG	Host-Associated	Open in IMG/M
3300017432	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_12SEP2016_LD1 MG	Host-Associated	Open in IMG/M
3300017435	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_MAIN_12SEP2016_LD1 MG	Host-Associated	Open in IMG/M
3300017439	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_12SEP2016_LD1 MG	Host-Associated	Open in IMG/M
3300017447	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_03OCT2016_LD1 MG	Host-Associated	Open in IMG/M
3300017692	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_MAIN_03OCT2016_LD1 MG	Host-Associated	Open in IMG/M
3300017693	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_03OCT2016_LD1 MG	Host-Associated	Open in IMG/M
3300020023	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_MAIN_22AUG2016_LD2 MG	Host-Associated	Open in IMG/M
3300028050	Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_NF_17JUL2017_LD1	Host-Associated	Open in IMG/M
3300028051	Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_NF_28AUG2017_LD1	Host-Associated	Open in IMG/M
3300028054	Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_NF_15MAY2017_LD1	Host-Associated	Open in IMG/M
3300028056	Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_NF_17JUL2017_LD1	Host-Associated	Open in IMG/M
3300028058	Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_MAIN_07AUG2017_LD1	Host-Associated	Open in IMG/M
3300028062	Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_MAIN_28AUG2017_LD1	Host-Associated	Open in IMG/M
3300028064	Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_MAIN_28AUG2017_LD1	Host-Associated	Open in IMG/M
3300028140	Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_MAIN_07AUG2017_LD1	Host-Associated	Open in IMG/M
3300028141	Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_MAIN_17JUL2017_LD1	Host-Associated	Open in IMG/M
3300028142	Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R4_NF_28AUG2017_LD1	Host-Associated	Open in IMG/M
3300028151	Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_MAIN_05JUN2017_LD1	Host-Associated	Open in IMG/M
3300028154	Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R2_MAIN_28AUG2017_LD1	Host-Associated	Open in IMG/M
3300028248	Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_NF_05JUN2017_LD1	Host-Associated	Open in IMG/M
3300028262	Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_MAIN_05JUN2017_LD1	Host-Associated	Open in IMG/M
3300028464	Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_MAIN_15MAY2017_LD1	Host-Associated	Open in IMG/M
3300028466	Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R2_NF_26JUN2017_LD1	Host-Associated	Open in IMG/M
3300028469	Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R2_NF_07AUG2017_LD1	Host-Associated	Open in IMG/M
3300028472	Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R4_NF_05JUN2017_LD1	Host-Associated	Open in IMG/M
3300028473	Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R4_MAIN_26JUN2017_LD1	Host-Associated	Open in IMG/M
3300028475	Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R4_MAIN_17JUL2017_LD1	Host-Associated	Open in IMG/M
3300028527	Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R4_MAIN_07AUG2017_LD1	Host-Associated	Open in IMG/M

Geographical Distribution

Zoom:	Powered by OpenStreetMap

Family Sequences

Protein ID	Sample Taxon ID	Habitat	Sequence
Ga0068863_1011672001	3300005841	Switchgrass Rhizosphere	GSFLRVCRILQFVKKLDFAFLSLGGPSHGARVWCLG*
Ga0068863_1021178211	3300005841	Switchgrass Rhizosphere	MFNGSFLRVCRVLQFMKKLDFPFLSLGGPRHGARVWCLGRVP
Ga0068863_1021996791	3300005841	Switchgrass Rhizosphere	MFNGSLLRVCRILRFVKKLDFAFLSLGGPSPGARVWCLG
Ga0068863_1023943631	3300005841	Switchgrass Rhizosphere	MFNGSFLRVCRILRFVKKLDFAFLSLGGPSHGARV
Ga0068858_1010937771	3300005842	Switchgrass Rhizosphere	GSFLRVCRILRFVKKLDFAFLSLGGPSHGARVWFRG*
Ga0134125_119449342	3300010371	Terrestrial Soil	MFNGSYLRACMKLRIVKKLDFAFFSLGGPSHGARAWCQGRVPKHRK
Ga0134127_116523241	3300010399	Terrestrial Soil	MFNGLFLRVCRILRFVKKLDFAFLSLGGPSHGAWVW
Ga0134127_124455181	3300010399	Terrestrial Soil	MFNGSLLRVCRILQFLKKLDFAFLSLGGPSHGARVWCLGRV
Ga0134123_120928391	3300010403	Terrestrial Soil	MLNDSFLRVCRILQFVKKLDFSFLSLGGPSHGARVW
Ga0163162_133602941	3300013306	Switchgrass Rhizosphere	MFNGSFLRVCRILQFVKKLDFAFLSLGGPSHGARVWCLGRVPKH
Ga0182100_10193631	3300015280	Switchgrass Phyllosphere	MFNGSFLRVCRILRFVKKLDFAFLSLGGPSHGARVWCL
Ga0182100_10426971	3300015280	Switchgrass Phyllosphere	MFNGSFLRVCIILWFVKKLDFAFLSLGGPSHGARVWCLGRVPKHR
Ga0182105_10493371	3300015290	Switchgrass Phyllosphere	MFNDSFLRVCRILRFVKKLDFAFLSLGGPSHGARVWCL
Ga0182105_10573361	3300015290	Switchgrass Phyllosphere	MLTGSVLRVCRILWFVKKLDFAFLSLGGPSHGARVWCLGRVPK
Ga0182103_10723492	3300015293	Switchgrass Phyllosphere	MFNGSFLRVCRTLRLVKKLDFAFLSLGGPSHGARVWCPGRVPKHRNHWQ
Ga0182104_10896051	3300015297	Switchgrass Phyllosphere	MFNGSFLRVCRILRFVKKLDFAFLSLGGPSPGARVWCL
Ga0182180_10389701	3300015306	Switchgrass Phyllosphere	MFNGSFLRVCRILWFVKKLDFAFLSLGVPSHGARVWCLGRVPKHRN
Ga0182180_10444421	3300015306	Switchgrass Phyllosphere	MCNGSFLRVCRTLRLVKKLDFAFLSLGGPSHGARVWCP
Ga0182162_10743831	3300015310	Switchgrass Phyllosphere	MFIDSYLRACRILRFVKKLDFPFMSLGGPRHGARVWC
Ga0182182_11243121	3300015311	Switchgrass Phyllosphere	MFNDSFLRVCRILQFVKKLDSAFSSLGGPSPGARVWCLGRV
Ga0182168_10915181	3300015312	Switchgrass Phyllosphere	MFNGSFLRVCRILQFVKKLDSAFSSLGGPSPGARVWCLGRVPKHRNQWQK
Ga0182168_11101291	3300015312	Switchgrass Phyllosphere	MFNGSFLRVCRILWFVKKIDFAFLSLGGPSHGARVWCLGQVPKHRN
Ga0182164_10449811	3300015313	Switchgrass Phyllosphere	MFNDSYLRACMILWFVKKLDFAFLSLGGPSHGARVWRLGRVPKHRN
Ga0182164_10480941	3300015313	Switchgrass Phyllosphere	MFNGSFLRVCRILRFVKKLDFAFLSLGGPRHGARFWCLGRVPKH
Ga0182121_11247231	3300015316	Switchgrass Phyllosphere	MFNGTFLRVCRILWFVKKIDFAFLSLGGPSHARVWYRSRVPK
Ga0182181_10714381	3300015318	Switchgrass Phyllosphere	MFNGSFLRVCSILRFVPKLDFAFLSLGGQSHGARVWCLGRVPKHRNQW
Ga0182130_10623531	3300015319	Switchgrass Phyllosphere	MFNGSFLRVCRILRFVKKLDFAFLSLGGPSPGARVWC
Ga0182165_11472621	3300015320	Switchgrass Phyllosphere	MFNGSFLSVIRILRLVKKLDFAFLSLGGPSHGARVWCLGRV
Ga0182148_11403951	3300015325	Switchgrass Phyllosphere	MFNGSFLRVCRILRFVKKLDFAFMSLGGPSHGARVSCLGRVP
Ga0182166_11295631	3300015326	Switchgrass Phyllosphere	MFNGSLLRVCRILQFVKKLDFAFLSLGGPSHGARV
Ga0182114_10750721	3300015327	Switchgrass Phyllosphere	MFNGSFLRVCSILRFVKKLDFAFLSLGGPSHSAWVWCLGRVPK
Ga0182114_10750722	3300015327	Switchgrass Phyllosphere	MFNGSYLRACRILQFVKKLDFPFLSLGGPRHGARVWCLGR
Ga0182152_11488731	3300015330	Switchgrass Phyllosphere	MFNGSFLRVCRILRFVEKLDFAFLSLGGPSHGARVWCLGRVPK
Ga0182131_11129381	3300015331	Switchgrass Phyllosphere	MFNGSFLRVCRILRFVKKLDFAFLSLGGPSHGARVW
Ga0182117_10957452	3300015332	Switchgrass Phyllosphere	MLNGSFLRVCRILQFVKKLDFAFLSLGGPSHGARVWCLGRVPK
Ga0182132_10696792	3300015334	Switchgrass Phyllosphere	MFNDSYLRACMILRFVKKLDFAFLSLGGPSHGARVWRLGRVPKHRN
Ga0182132_10827801	3300015334	Switchgrass Phyllosphere	MFNGSFLRECRILWFVKKLDFAFLSLGGASHGARVWCLG
Ga0182150_11636291	3300015336	Switchgrass Phyllosphere	MFNGSFLRVCRILRFVKKLDFPFMSLGGPRHGARVWC
Ga0182137_11116721	3300015338	Switchgrass Phyllosphere	MFNDSYLRACMKLRIVQKLDIPFLSLGGPRHGARGWVLGRVPK
Ga0182133_11847331	3300015340	Switchgrass Phyllosphere	MFNGSFLRVCRILRFVKKLDFSFLSLGGPSHGARVWCLGRVP
Ga0182115_10954271	3300015348	Switchgrass Phyllosphere	MFNGSFLRVCRILRFVKKLDFAFLSLGGPSHGARVWCLGRVPKHR
Ga0182115_11803461	3300015348	Switchgrass Phyllosphere	MFIDSYLRACRILRFVKKLDFAFMSLGGPRHGARVW
Ga0182115_12662911	3300015348	Switchgrass Phyllosphere	MFHGSFLRVCRILRFVKKLDFAFLSLGGPSHGARVW
Ga0182185_10522091	3300015349	Switchgrass Phyllosphere	MFNDSFLRVCRILWFVKKLDFPFLSLGGPSHGARVWCL
Ga0182185_12277971	3300015349	Switchgrass Phyllosphere	MFNGSSLRVCMILRFVKELDFPFFSLGRPRHGARVWCLGRVPEH
Ga0182163_10390061	3300015350	Switchgrass Phyllosphere	MFSGSYLRACRILRFVKKLDFPFLSLGGPRHGARVWCLGRVP
Ga0182163_11232491	3300015350	Switchgrass Phyllosphere	MFNGSFLRVCMILQFVKKLDFAFLSLGGPRHGARVWCLGR
Ga0182163_12752291	3300015350	Switchgrass Phyllosphere	VFNGSFLRVCRILRFVKKLDFAFLSLGGPSHGARVWCLG
Ga0182169_12460991	3300015352	Switchgrass Phyllosphere	MYNGSFLRVCRILRFVKKLDFSFLSLGGPSHGARVWCL
Ga0182169_12642131	3300015352	Switchgrass Phyllosphere	MFNGSFLRVCRILGFVSEVEVGFLSLGGLSDGAGVWCLGRVPKP
Ga0182169_12924691	3300015352	Switchgrass Phyllosphere	MFNGSFLRVCRILWFVKKLDFAFLSLGGPRHGARVWCLGRVP
Ga0182169_12980181	3300015352	Switchgrass Phyllosphere	MFNGSYLRACRILRFVKKLDFPFLSLGGPRHGARVWC
Ga0182179_11112361	3300015353	Switchgrass Phyllosphere	MFNGSFLRVCSILRFVKKLDFAFLSLGGPSHGARVWCLGA
Ga0182179_12058041	3300015353	Switchgrass Phyllosphere	MFNGSLLRVCRILRFVKKLDFAFLSLGGPRHGARVWCLNRVPKHR
Ga0182179_12777931	3300015353	Switchgrass Phyllosphere	MFNGSYLRSCMKLQIVKKLDFAFLSLGGPSHGARVWCQGRVPKHRNQWQEVEG
Ga0182167_13130661	3300015354	Switchgrass Phyllosphere	MFNGSFLRVCRILWFVKKLDFAFLSPGGPSHGARVWCLGRV
Ga0182167_13157501	3300015354	Switchgrass Phyllosphere	MFNGLFLRVCRILRFVKKLDFAFLSLGGPSHGAWVWCLG
Ga0182167_13283491	3300015354	Switchgrass Phyllosphere	MFNGSFLTVCRILRFVKKLDFAFLSLGDPAMVPGFG
Ga0182195_10772932	3300017414	Switchgrass Phyllosphere	MFNGSYLRACMKLRFVKKLDFPYMSLGGPSHGARVWCLGRVPK
Ga0182195_10794941	3300017414	Switchgrass Phyllosphere	MFNGSFLRVCRILRFVKKLDFAFLSLGVPSHGARVW
Ga0182195_11616131	3300017414	Switchgrass Phyllosphere	MFNGSFIRVCRILRFVKKLDFAFLSLGGPRHGARVWCLGRV
Ga0182195_11672891	3300017414	Switchgrass Phyllosphere	MLNDSFLRVCRILRFVKKLDFSFLSLGGPSHGARVWCLGRVPK
Ga0182196_11199031	3300017432	Switchgrass Phyllosphere	MFNGSFLRVRRILRFVIKLDFAFLSLGGPRHGARVWC
Ga0182196_11401821	3300017432	Switchgrass Phyllosphere	MFNGSFLRVCRILRFVKKLDFAFLSLGGPSHGVRF
Ga0182194_11141161	3300017435	Switchgrass Phyllosphere	MFNGSFLRACRILRFVKKLDFAFLSLGGPSHGAWVWCL
Ga0182200_11584741	3300017439	Switchgrass Phyllosphere	MFNGSFLRVCRMLWFVKKLDFAFLSLGGPSHGARVWCLGRVPKHRN
Ga0182200_11648091	3300017439	Switchgrass Phyllosphere	MFNGSFLRVCRILRFLKKLDFAFLSLGGPSHGARVWCLGR
Ga0182215_11652351	3300017447	Switchgrass Phyllosphere	MFNDSYLRACMILWLVKKLDFAFLSLGGPSHGARVWRLGRGP
Ga0182210_11088051	3300017692	Switchgrass Phyllosphere	MFNDTYLRVCRILWFVKKLDFTFLSLGGPSHGARVWCQGRVPKHRNQWQEV
Ga0182216_10761711	3300017693	Switchgrass Phyllosphere	MFNGSFLRVCRILRFLKKLDFAFLSLSGPSHGARV
Ga0182216_10894891	3300017693	Switchgrass Phyllosphere	MFNGSFLRVFRILRFVKKLDFAFLSLGGPRHGARVWC
Ga0182178_10008532	3300020023	Switchgrass Phyllosphere	MFNGSFLRVCRILRFVKKLDFAFLSLGGPSHGARVWC
Ga0182178_10043771	3300020023	Switchgrass Phyllosphere	MFNGSFLRVCRILRFVKKLDFAFSSLCGPSHGARVWCL
Ga0182178_10213071	3300020023	Switchgrass Phyllosphere	MFNGSFLRVCRILWFVKKLDFAYLSLGGPSHGARVWCLGRVPKH
Ga0268328_10132251	3300028050	Phyllosphere	MFNGSLLRVCRILRFVKKLDFAFLSLGGPRHGARVWCLNRVPK
Ga0268344_10080961	3300028051	Phyllosphere	MFIDSYLRACRILRFVKKLDFPFMSLGGPRHGARVW
Ga0268306_10185901	3300028054	Phyllosphere	MFNGSFLRVCRILRFVKKLDFAFLSLGVPSHGARVWCLSR
Ga0268330_10180171	3300028056	Phyllosphere	MFNGSFLRVCRILWFVKKLDFSFLSLGRPSHGARVWCLGRVPKHRTHWQEVE
Ga0268330_10260402	3300028056	Phyllosphere	MFNGSFLRVCRILRFVKKLDFAFLSLGGPSHGARVWCLGLVPKHR
Ga0268330_10610981	3300028056	Phyllosphere	MFNGSYLRACRILRFVKKLDFPFLSLGGPSHARVWCLGRVPK
Ga0268332_10555191	3300028058	Phyllosphere	MFNGSFLRVCRILRFVKKLDFPFMSLGGPRHGARVWCLGRVPKHRN
Ga0268332_10726341	3300028058	Phyllosphere	MFNGSFLRVCRILWFVKKLDFSFLSLGGPRHGARVWCLGRVPKHRNQWQEVG
Ga0268342_10171151	3300028062	Phyllosphere	MFNDSFLRVCRILRFVKKLDFAFLSMGRPSHGARV
Ga0268340_10215561	3300028064	Phyllosphere	MFNGSFLRVCRILWFVKKLDFAFLSLGGPSHGARVWCLGRVPKHRNQWQEV
Ga0268340_10320681	3300028064	Phyllosphere	MFNGSFLRVCRILQLVKKIDFSFLSLGGPSHGARVWCLGRVPK
Ga0268340_10747301	3300028064	Phyllosphere	MFNGSFLRVCRKLRIVKKLDFAFLSLGEPSHGARDWSLG
Ga0268334_10144031	3300028140	Phyllosphere	MFNGSFLRVCRMLWFVKKLDFAFLSLGGPSHGARVWCLGRVPKHR
Ga0268326_10127371	3300028141	Phyllosphere	MFNGSFLRVCRILQLVKKIDFSFLSLGGPSHGARVWC
Ga0268347_10213881	3300028142	Phyllosphere	MFNGSYLRACRILRFVKKLDFPFLSLGGPRHGARVWCLGRVP
Ga0268347_10240922	3300028142	Phyllosphere	MFNGSYLRVCMKLRFVKKLDFPFMSLGGPSHGARVWC
Ga0268347_10249591	3300028142	Phyllosphere	MFNGLFIRVCRILWFVKKLDFAFLSLGGPSHGAWVWCLG
Ga0268308_10177981	3300028151	Phyllosphere	MFNGSFLRVCRILRFLKKLDFAFFSLSGPSHGARVW
Ga0268308_10199562	3300028151	Phyllosphere	MFNDSFLRVCRILQFVKKLDSAFSSLGGPSLGARVWCLGR
Ga0268308_10272281	3300028151	Phyllosphere	MFNGSFLRVRRKLRIVKKLDFAFLSLGGPSHCARVWCLGRVPKHRNHW
Ga0268308_10288331	3300028151	Phyllosphere	MFNGSFLRVCRILQFVKKLDFAFLSLGGPRHGARVWCL
Ga0268341_10246671	3300028154	Phyllosphere	MFNGSFLRGCRILRFVKKKLDFAFLSLGGPSHGARFWCLGRVPMH
Ga0268341_10319091	3300028154	Phyllosphere	MFNGSFLRVCRILRFVKKLDFAFLSLGGPSHGARVWCLGRVPKHRN
Ga0268312_10152851	3300028248	Phyllosphere	MFNGSFLRVCRILRFVKKIDFAFLSLGGPSHGARV
Ga0268312_10230951	3300028248	Phyllosphere	MFYVSFLRVCRILRFVKKLDFAFLSLGGPSHGARVWCL
Ga0268312_10295941	3300028248	Phyllosphere	MFNGSLLRVCRILRFVKKLDFPFLSLGGPSHGARVW
Ga0268312_10360181	3300028248	Phyllosphere	MFNGSYLRSCMKLRIVKKLDFAFLSLGGPSHGARVWCQGRVPKHRNQWQEVE
Ga0268312_10388951	3300028248	Phyllosphere	MFNGSYLRACMKLQIVKKLDFAFLSLGGPRHGARVW
Ga0268310_10199871	3300028262	Phyllosphere	MFNGSFLRVCRILRFVKKLDFALLSLGGPSHGARVWCLGRVPKHR
Ga0268310_10251711	3300028262	Phyllosphere	MFNDSFLRVCRILWFVKKLDFPFLSLGGPSHGARVW
Ga0268310_10298021	3300028262	Phyllosphere	MFNGSFLRVCSILRFVKKLDFAFLSLGGPSHSAWVWCLGRVPKHR
Ga0268302_1068821	3300028464	Phyllosphere	MFNGSFLRVCRILQFMKKLDFPFLSLGGPRHGARVWCLGRVPN
Ga0268321_1068051	3300028466	Phyllosphere	MFNDSYLRACMILRFVKKLDFAFLSLGGPSHGARVWRLGGVP
Ga0268337_10039392	3300028469	Phyllosphere	MFNGSFLRVCRILRFLKKLDFAFFSLSGPSHGARVWCVGSGNPR
Ga0268315_10087791	3300028472	Phyllosphere	MFNGSFLGVCRILRFVKKIDFAFLSLGGPSHGARVWCLG
Ga0268319_10200411	3300028473	Phyllosphere	MFNGSFLRVCRTLWFVKKKIDFAFLSLGGPSHGAPVWCLDQVPKHR
Ga0268327_10193581	3300028475	Phyllosphere	MFSGSFLRVCRILRFVKKIDFAFLSLGGTSHGARVWCLGRVP
Ga0268335_10147841	3300028527	Phyllosphere	MFNGSLLRVCRILRFVKKLDFPFLSLGGPSHGARVWCLG

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

Metagenome Family F083510

Overview

Multiple Sequence Alignments

Structure & Topology

Predicted Secondary Structure and Topology

Predicted 3D Structure

Low Quality Model:

Phylogeny

NCBI Taxonomy

Associated Scaffolds

Environmental Properties

Associated Habitat Types

Associated Samples

Family Sequences