Metagenome Family F083554

Basic Information
Family ID	F083554
Family Type	Metagenome
Number of Sequences	112
Average Sequence Length	39 residues
Representative Sequence	MEPEGSLPHSQASATCLYPGPAQSSPYTHIPPPGDPS
Number of Associated Samples	17
Number of Associated Scaffolds	112

Quality Assessment
Transcriptomic Evidence	No
Most common taxonomic group	Eukaryota
% of genes with valid RBS motifs	2.78 %
% of genes near scaffold ends (potentially truncated)	83.93 %
% of genes from short scaffolds (< 2000 bps)	63.39 %
Associated GOLD sequencing projects	15
AlphaFold2 3D model prediction	Yes
3D model pTM-score	0.14

Most Common Taxonomy
Group	Eukaryota (89.286 % of family members)
NCBI Taxonomy ID	2759
Taxonomy	All Organisms → cellular organisms → Eukaryota

Most Common Ecosystem
GOLD Ecosystem	Host-Associated → Arthropoda → Digestive System → Gut → Unclassified → Termite Gut (100.000 % of family members)
Environment Ontology (ENVO)	Unclassified (100.000 % of family members)
Earth Microbiome Project Ontology (EMPO)	Host-associated → Animal → Animal proximal gut (100.000 % of family members)

Full Alignment
Alignment of all the sequences in the family.

Powered by MSAViewer

Seed Alignment
Alignment of a non-redundant set of sequences, used to build the family's HMM profile.

Powered by MSAViewer

AlphaFold2 Input Alignment
Refined alignment used as input for AlphaFold2.

Powered by MSAViewer

Predicted Topology & Secondary Structure
Classification:	Fibrous	Signal Peptide:	No	Secondary Structure distribution:	α-helix: 0.00% β-sheet: 0.00% Coil/Unstructured: 100.00%
Feature Viewer

Powered by Feature Viewer

Pfam ID	Name	% Frequency in 112 Family Scaffolds
PF14051	DPF1-3_N	0.89
PF02089	Palm_thioest	0.89
PF01359	Transposase_1	0.89
PF13843	DDE_Tnp_1_7	0.89

NCBI Taxonomy

Select NCBI taxonomy Level:

Name	Rank	Taxonomy	Distribution
All Organisms	root	All Organisms	91.07 %
Unclassified	root	N/A	8.93 %

Name	Rank	Taxonomy	Distribution
cellular organisms	root	All Organisms → cellular organisms	89.29 %
Unclassified	root	N/A	8.93 %
Viruses	superkingdom	All Organisms → Viruses	1.79 %

Name	Rank	Taxonomy	Distribution
Eukaryota	superkingdom	All Organisms → cellular organisms → Eukaryota	89.29 %
Unclassified	root	N/A	8.93 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	1.79 %

Name	Rank	Taxonomy	Distribution
Opisthokonta	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta	80.36 %
Unclassified	root	N/A	8.93 %
Viridiplantae	kingdom	All Organisms → cellular organisms → Eukaryota → Viridiplantae	8.04 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	1.79 %

Name	Rank	Taxonomy	Distribution
Metazoa	kingdom	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa	79.46 %
Unclassified	root	N/A	8.93 %
Streptophyta	phylum	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta	8.04 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	1.79 %

Name	Rank	Taxonomy	Distribution
Eumetazoa	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa	79.46 %
Unclassified	root	N/A	8.93 %
Streptophytina	subphylum	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina	8.04 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	1.79 %

Name	Rank	Taxonomy	Distribution
Bilateria	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria	79.46 %
Unclassified	root	N/A	8.93 %
Embryophyta	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	8.04 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	1.79 %

Name	Rank	Taxonomy	Distribution
Protostomia	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia	79.46 %
Unclassified	root	N/A	8.93 %
Tracheophyta	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta	8.04 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	1.79 %

Name	Rank	Taxonomy	Distribution
Ecdysozoa	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa	79.46 %
Unclassified	root	N/A	8.93 %
Euphyllophyta	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta	8.04 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	1.79 %

Name	Rank	Taxonomy	Distribution
Panarthropoda	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda	79.46 %
Unclassified	root	N/A	8.93 %
Spermatophyta	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta	8.04 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	1.79 %

Name	Rank	Taxonomy	Distribution
Arthropoda	phylum	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda	79.46 %
Unclassified	root	N/A	8.93 %
Magnoliopsida	class	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida	8.04 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	1.79 %

Name	Rank	Taxonomy	Distribution
Mandibulata	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata	77.68 %
Unclassified	root	N/A	8.93 %
Mesangiospermae	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae	8.04 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	1.79 %

Name	Rank	Taxonomy	Distribution
Pancrustacea	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea	77.68 %
Unclassified	root	N/A	8.93 %
eudicotyledons	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons	8.04 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	1.79 %

Name	Rank	Taxonomy	Distribution
Hexapoda	subphylum	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda	77.68 %
Unclassified	root	N/A	8.93 %
Gunneridae	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae	8.04 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	1.79 %

Name	Rank	Taxonomy	Distribution
Insecta	class	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta	77.68 %
Unclassified	root	N/A	8.93 %
Pentapetalae	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae	8.04 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	1.79 %

Name	Rank	Taxonomy	Distribution
Dicondylia	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia	77.68 %
Unclassified	root	N/A	8.93 %
rosids	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids	8.04 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	1.79 %

Name	Rank	Taxonomy	Distribution
Pterygota	subclass	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota	77.68 %
Unclassified	root	N/A	8.93 %
malvids	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids	8.04 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	1.79 %

Name	Rank	Taxonomy	Distribution
Neoptera	infraclass	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera	77.68 %
Unclassified	root	N/A	8.93 %
Malvales	order	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Malvales	8.04 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	1.79 %

Name	Rank	Taxonomy	Distribution
Polyneoptera	cohort	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Polyneoptera	37.50 %
Unclassified	root	N/A	8.93 %
Malvaceae	family	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Malvales → Malvaceae	8.04 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	1.79 %
Endopterygota	cohort	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Endopterygota	0.89 %

Name	Rank	Taxonomy	Distribution
Dictyoptera	superorder	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Polyneoptera → Dictyoptera	37.50 %
Unclassified	root	N/A	8.93 %
Sterculioideae	subfamily	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Malvales → Malvaceae → Sterculioideae	8.04 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	1.79 %
Hymenoptera	order	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Endopterygota → Hymenoptera	0.89 %

Name	Rank	Taxonomy	Distribution
Blattodea	order	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Polyneoptera → Dictyoptera → Blattodea	37.50 %
Unclassified	root	N/A	8.93 %
Pterygota	genus	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Malvales → Malvaceae → Sterculioideae → Pterygota	8.04 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	1.79 %
Apocrita	suborder	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Endopterygota → Hymenoptera → Apocrita	0.89 %

Name	Rank	Taxonomy	Distribution
Blattoidea	superfamily	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Polyneoptera → Dictyoptera → Blattodea → Blattoidea	36.61 %
Unclassified	root	N/A	8.93 %
Pterygota	genus	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Malvales → Malvaceae → Sterculioideae → Pterygota	8.04 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	1.79 %
Parasitoida	infraorder	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Endopterygota → Hymenoptera → Apocrita → Parasitoida	0.89 %

Name	Rank	Taxonomy	Distribution
Termitoidae	no rank	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Polyneoptera → Dictyoptera → Blattodea → Blattoidea → Termitoidae	14.29 %
Unclassified	root	N/A	8.93 %
Pterygota	genus	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Malvales → Malvaceae → Sterculioideae → Pterygota	8.04 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	1.79 %
Chalcidoidea	superfamily	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Endopterygota → Hymenoptera → Apocrita → Parasitoida → Chalcidoidea	0.89 %

Name	Rank	Taxonomy	Distribution
Kalotermitidae	family	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Polyneoptera → Dictyoptera → Blattodea → Blattoidea → Termitoidae → Kalotermitidae	14.29 %
Unclassified	root	N/A	8.93 %
Pterygota	genus	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Malvales → Malvaceae → Sterculioideae → Pterygota	8.04 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	1.79 %
Pteromalidae	family	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Endopterygota → Hymenoptera → Apocrita → Parasitoida → Chalcidoidea → Pteromalidae	0.89 %

Name	Rank	Taxonomy	Distribution
Cryptotermitinae	subfamily	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Polyneoptera → Dictyoptera → Blattodea → Blattoidea → Termitoidae → Kalotermitidae → Cryptotermitinae	14.29 %
Unclassified	root	N/A	8.93 %
Pterygota	genus	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Malvales → Malvaceae → Sterculioideae → Pterygota	8.04 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	1.79 %
Pteromalinae	subfamily	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Endopterygota → Hymenoptera → Apocrita → Parasitoida → Chalcidoidea → Pteromalidae → Pteromalinae	0.89 %

Name	Rank	Taxonomy	Distribution
Cryptotermes	genus	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Polyneoptera → Dictyoptera → Blattodea → Blattoidea → Termitoidae → Kalotermitidae → Cryptotermitinae → Cryptotermes	14.29 %
Unclassified	root	N/A	8.93 %
Pterygota	genus	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Malvales → Malvaceae → Sterculioideae → Pterygota	8.04 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	1.79 %
Nasonia	genus	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Endopterygota → Hymenoptera → Apocrita → Parasitoida → Chalcidoidea → Pteromalidae → Pteromalinae → Nasonia	0.89 %

Name	Rank	Taxonomy	Distribution
Cryptotermes secundus	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Polyneoptera → Dictyoptera → Blattodea → Blattoidea → Termitoidae → Kalotermitidae → Cryptotermitinae → Cryptotermes → Cryptotermes secundus	14.29 %
Unclassified	root	N/A	8.93 %
Pterygota	genus	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Malvales → Malvaceae → Sterculioideae → Pterygota	8.04 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	1.79 %
Nasonia vitripennis	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Endopterygota → Hymenoptera → Apocrita → Parasitoida → Chalcidoidea → Pteromalidae → Pteromalinae → Nasonia → Nasonia vitripennis	0.89 %

Visualization

Powered by ApexCharts

Associated Scaffolds

Scaffold	Taxonomy	Length	IMG/M Link
3300002450\|JGI24695J34938_10452843	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Polyneoptera → Dictyoptera → Blattodea → Blattoidea	580	Open in IMG/M
3300002501\|JGI24703J35330_10756132	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Polyneoptera → Dictyoptera → Blattodea → Blattoidea	518	Open in IMG/M
3300002501\|JGI24703J35330_10820481	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera	544	Open in IMG/M
3300002501\|JGI24703J35330_10974155	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera	617	Open in IMG/M
3300002501\|JGI24703J35330_11063609	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera	668	Open in IMG/M
3300002501\|JGI24703J35330_11123771	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera	707	Open in IMG/M
3300002501\|JGI24703J35330_11130499	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Polyneoptera → Dictyoptera → Blattodea → Blattoidea	711	Open in IMG/M
3300002501\|JGI24703J35330_11187940	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera	752	Open in IMG/M
3300002501\|JGI24703J35330_11188503	Not Available	752	Open in IMG/M
3300002501\|JGI24703J35330_11258171	Not Available	809	Open in IMG/M
3300002501\|JGI24703J35330_11396568	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Polyneoptera → Dictyoptera → Blattodea → Blattoidea	956	Open in IMG/M
3300002501\|JGI24703J35330_11547383	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Malvales → Malvaceae → Sterculioideae → Pterygota	1218	Open in IMG/M
3300002504\|JGI24705J35276_11784142	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera	675	Open in IMG/M
3300002504\|JGI24705J35276_11912083	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Malvales → Malvaceae → Sterculioideae → Pterygota	761	Open in IMG/M
3300002507\|JGI24697J35500_10543876	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Malvales → Malvaceae → Sterculioideae → Pterygota	554	Open in IMG/M
3300002507\|JGI24697J35500_10628474	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Malvales → Malvaceae → Sterculioideae → Pterygota	597	Open in IMG/M
3300002507\|JGI24697J35500_10891623	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Polyneoptera → Dictyoptera → Blattodea → Blattoidea → Termitoidae → Kalotermitidae → Cryptotermitinae → Cryptotermes → Cryptotermes secundus	799	Open in IMG/M
3300002507\|JGI24697J35500_10970924	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera	899	Open in IMG/M
3300002507\|JGI24697J35500_11045680	Not Available	1028	Open in IMG/M
3300002507\|JGI24697J35500_11097868	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Polyneoptera → Dictyoptera → Blattodea → Blattoidea → Termitoidae → Kalotermitidae → Cryptotermitinae → Cryptotermes → Cryptotermes secundus	1158	Open in IMG/M
3300002507\|JGI24697J35500_11145069	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Polyneoptera → Dictyoptera → Blattodea → Blattoidea	1326	Open in IMG/M
3300002509\|JGI24699J35502_10343070	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera	537	Open in IMG/M
3300002509\|JGI24699J35502_10603299	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Polyneoptera → Dictyoptera → Blattodea → Blattoidea	684	Open in IMG/M
3300002509\|JGI24699J35502_10611950	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera	691	Open in IMG/M
3300002509\|JGI24699J35502_10650631	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Polyneoptera → Dictyoptera → Blattodea → Blattoidea	721	Open in IMG/M
3300002509\|JGI24699J35502_10922216	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Polyneoptera → Dictyoptera → Blattodea → Blattoidea → Termitoidae → Kalotermitidae → Cryptotermitinae → Cryptotermes → Cryptotermes secundus	1097	Open in IMG/M
3300002509\|JGI24699J35502_10928402	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Polyneoptera → Dictyoptera → Blattodea → Blattoidea → Termitoidae → Kalotermitidae → Cryptotermitinae → Cryptotermes → Cryptotermes secundus	1112	Open in IMG/M
3300002509\|JGI24699J35502_10956370	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Endopterygota → Hymenoptera → Apocrita → Parasitoida → Chalcidoidea → Pteromalidae → Pteromalinae → Nasonia → Nasonia vitripennis	1189	Open in IMG/M
3300002552\|JGI24694J35173_10205981	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Malvales → Malvaceae → Sterculioideae → Pterygota	1008	Open in IMG/M
3300002552\|JGI24694J35173_10498459	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Polyneoptera → Dictyoptera → Blattodea → Blattoidea → Termitoidae → Kalotermitidae → Cryptotermitinae → Cryptotermes → Cryptotermes secundus	677	Open in IMG/M
3300002834\|JGI24696J40584_12386805	Not Available	549	Open in IMG/M
3300002834\|JGI24696J40584_12470777	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Polyneoptera → Dictyoptera → Blattodea → Blattoidea	585	Open in IMG/M
3300002834\|JGI24696J40584_12487049	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera	593	Open in IMG/M
3300002834\|JGI24696J40584_12494376	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera	596	Open in IMG/M
3300002834\|JGI24696J40584_12638129	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera	684	Open in IMG/M
3300002834\|JGI24696J40584_12669990	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera	710	Open in IMG/M
3300002834\|JGI24696J40584_12922955	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Polyneoptera → Dictyoptera → Blattodea → Blattoidea	1370	Open in IMG/M
3300006045\|Ga0082212_10065845	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Polyneoptera → Dictyoptera → Blattodea → Blattoidea	3767	Open in IMG/M
3300006045\|Ga0082212_10071825	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera	3567	Open in IMG/M
3300006045\|Ga0082212_10075899	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera	3441	Open in IMG/M
3300006045\|Ga0082212_10099667	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Polyneoptera → Dictyoptera → Blattodea → Blattoidea → Termitoidae → Kalotermitidae → Cryptotermitinae → Cryptotermes → Cryptotermes secundus	2892	Open in IMG/M
3300006045\|Ga0082212_10137116	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Polyneoptera → Dictyoptera → Blattodea → Blattoidea → Termitoidae → Kalotermitidae → Cryptotermitinae → Cryptotermes → Cryptotermes secundus	2366	Open in IMG/M
3300006045\|Ga0082212_10154566	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Polyneoptera → Dictyoptera → Blattodea → Blattoidea	2198	Open in IMG/M
3300006045\|Ga0082212_10230874	Not Available	1722	Open in IMG/M
3300006045\|Ga0082212_10337235	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Polyneoptera → Dictyoptera → Blattodea → Blattoidea	1370	Open in IMG/M
3300006045\|Ga0082212_10447798	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Malvales → Malvaceae → Sterculioideae → Pterygota	1156	Open in IMG/M
3300006045\|Ga0082212_10471560	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera	1121	Open in IMG/M
3300006045\|Ga0082212_10524348	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Malvales → Malvaceae → Sterculioideae → Pterygota	1051	Open in IMG/M
3300006045\|Ga0082212_10544376	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Polyneoptera → Dictyoptera → Blattodea → Blattoidea → Termitoidae → Kalotermitidae → Cryptotermitinae → Cryptotermes → Cryptotermes secundus	1027	Open in IMG/M
3300006045\|Ga0082212_10578513	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera	989	Open in IMG/M
3300006045\|Ga0082212_10656872	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera	912	Open in IMG/M
3300006045\|Ga0082212_11224985	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Malvales → Malvaceae → Sterculioideae → Pterygota	584	Open in IMG/M
3300006045\|Ga0082212_11541087	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Polyneoptera → Dictyoptera → Blattodea → Blattoidea	503	Open in IMG/M
3300009784\|Ga0123357_10082003	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda	4237	Open in IMG/M
3300009784\|Ga0123357_10180763	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera	2463	Open in IMG/M
3300009784\|Ga0123357_10369182	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Polyneoptera → Dictyoptera → Blattodea → Blattoidea	1347	Open in IMG/M
3300009784\|Ga0123357_11037088	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera	504	Open in IMG/M
3300009826\|Ga0123355_10112288	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera	4254	Open in IMG/M
3300009826\|Ga0123355_10117970	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera	4125	Open in IMG/M
3300009826\|Ga0123355_10124228	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera	3993	Open in IMG/M
3300009826\|Ga0123355_10190341	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera	3024	Open in IMG/M
3300009826\|Ga0123355_10538840	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera	1418	Open in IMG/M
3300009826\|Ga0123355_10633791	All Organisms → Viruses → Predicted Viral	1255	Open in IMG/M
3300009826\|Ga0123355_11620272	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera	622	Open in IMG/M
3300010049\|Ga0123356_10160920	All Organisms → Viruses → Predicted Viral	2242	Open in IMG/M
3300010049\|Ga0123356_10418722	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera	1481	Open in IMG/M
3300010049\|Ga0123356_10498150	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Polyneoptera → Dictyoptera → Blattodea → Blattoidea	1374	Open in IMG/M
3300010049\|Ga0123356_10779020	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera	1127	Open in IMG/M
3300010049\|Ga0123356_12036860	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Polyneoptera → Dictyoptera → Blattodea → Blattoidea → Termitoidae → Kalotermitidae → Cryptotermitinae → Cryptotermes → Cryptotermes secundus	716	Open in IMG/M
3300010162\|Ga0131853_10025057	All Organisms → cellular organisms → Eukaryota → Opisthokonta	10751	Open in IMG/M
3300010162\|Ga0131853_10047655	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda	7299	Open in IMG/M
3300010162\|Ga0131853_10073006	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Polyneoptera → Dictyoptera → Blattodea → Blattoidea → Termitoidae → Kalotermitidae → Cryptotermitinae → Cryptotermes → Cryptotermes secundus	5447	Open in IMG/M
3300010162\|Ga0131853_10086908	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Polyneoptera → Dictyoptera → Blattodea → Blattoidea → Termitoidae → Kalotermitidae → Cryptotermitinae → Cryptotermes → Cryptotermes secundus	4787	Open in IMG/M
3300010162\|Ga0131853_10130318	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Polyneoptera → Dictyoptera → Blattodea → Blattoidea	3478	Open in IMG/M
3300010162\|Ga0131853_10499966	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera	1098	Open in IMG/M
3300010167\|Ga0123353_10006574	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Polyneoptera → Dictyoptera → Blattodea → Blattoidea	15508	Open in IMG/M
3300010167\|Ga0123353_10014194	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera	11467	Open in IMG/M
3300010167\|Ga0123353_10042099	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera	7220	Open in IMG/M
3300010167\|Ga0123353_10132379	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera	4001	Open in IMG/M
3300010167\|Ga0123353_10134750	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera	3962	Open in IMG/M
3300010167\|Ga0123353_10344595	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera	2249	Open in IMG/M
3300010167\|Ga0123353_10512816	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera	1743	Open in IMG/M
3300010167\|Ga0123353_10806019	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera	1295	Open in IMG/M
3300010167\|Ga0123353_11487660	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Polyneoptera → Dictyoptera → Blattodea → Blattoidea	863	Open in IMG/M
3300010369\|Ga0136643_10051502	Not Available	5944	Open in IMG/M
3300010369\|Ga0136643_10071909	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Polyneoptera → Dictyoptera → Blattodea	4749	Open in IMG/M
3300010369\|Ga0136643_10079635	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Polyneoptera → Dictyoptera → Blattodea → Blattoidea → Termitoidae → Kalotermitidae → Cryptotermitinae → Cryptotermes → Cryptotermes secundus	4418	Open in IMG/M
3300010369\|Ga0136643_10110525	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Polyneoptera → Dictyoptera → Blattodea → Blattoidea → Termitoidae → Kalotermitidae → Cryptotermitinae → Cryptotermes → Cryptotermes secundus	3441	Open in IMG/M
3300010369\|Ga0136643_10110944	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Polyneoptera → Dictyoptera → Blattodea → Blattoidea	3431	Open in IMG/M
3300010369\|Ga0136643_10129668	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera	3023	Open in IMG/M
3300010369\|Ga0136643_10143212	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera	2779	Open in IMG/M
3300010369\|Ga0136643_10570237	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera	730	Open in IMG/M
3300010882\|Ga0123354_10014973	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera	12086	Open in IMG/M
3300010882\|Ga0123354_10070864	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Malvales → Malvaceae → Sterculioideae → Pterygota	5036	Open in IMG/M
3300010882\|Ga0123354_10134761	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Polyneoptera → Dictyoptera → Blattodea → Blattoidea	3095	Open in IMG/M
3300010882\|Ga0123354_10368612	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera	1256	Open in IMG/M
3300027864\|Ga0209755_10013764	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera	8377	Open in IMG/M
3300027864\|Ga0209755_10052434	All Organisms → cellular organisms → Eukaryota	4140	Open in IMG/M
3300027864\|Ga0209755_10090253	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera	3108	Open in IMG/M
3300027864\|Ga0209755_10234272	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Polyneoptera → Dictyoptera → Blattodea → Blattoidea	1819	Open in IMG/M
3300027864\|Ga0209755_10312101	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera	1518	Open in IMG/M
3300027864\|Ga0209755_10466801	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Polyneoptera → Dictyoptera → Blattodea → Blattoidea	1152	Open in IMG/M
3300027864\|Ga0209755_10468158	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Polyneoptera → Dictyoptera → Blattodea → Blattoidea → Termitoidae → Kalotermitidae → Cryptotermitinae → Cryptotermes → Cryptotermes secundus	1150	Open in IMG/M
3300027864\|Ga0209755_10602172	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Polyneoptera → Dictyoptera → Blattodea → Blattoidea	956	Open in IMG/M
3300027864\|Ga0209755_10723440	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Polyneoptera → Dictyoptera → Blattodea → Blattoidea → Termitoidae → Kalotermitidae → Cryptotermitinae → Cryptotermes → Cryptotermes secundus	827	Open in IMG/M
3300027864\|Ga0209755_10908186	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Polyneoptera → Dictyoptera → Blattodea → Blattoidea	679	Open in IMG/M
3300027864\|Ga0209755_11144173	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Polyneoptera → Dictyoptera → Blattodea → Blattoidea	545	Open in IMG/M
3300027891\|Ga0209628_11130822	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Polyneoptera → Dictyoptera → Blattodea → Blattoidea → Termitoidae → Kalotermitidae → Cryptotermitinae → Cryptotermes → Cryptotermes secundus	672	Open in IMG/M

Structure Viewer


Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100	pTM-score: 0.14
Secondary Structure: α-helix β-sheet Coil Turn	pTM-score: 0.14
Powered by PDBe Molstar

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

Metagenome Family F083554

Overview

Multiple Sequence Alignments

Structure & Topology

Predicted Secondary Structure and Topology

Predicted 3D Structure

Low Quality Model:

Gene Neighborhood

Neighboring Pfam domains

Phylogeny

NCBI Taxonomy

Associated Scaffolds

Environmental Properties

Associated Habitat Types

Associated Samples

Family Sequences

Habitat	Taxonomy	Distribution
Host-Associated	Host-Associated	100.00%

Taxon OID	Sample Name	Habitat Type	IMG/M Link
3300002450	Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3	Host-Associated	Open in IMG/M
3300002501	Neocapritermes taracua P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P1	Host-Associated	Open in IMG/M
3300002504	Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4	Host-Associated	Open in IMG/M
3300002507	Microcerotermes parvus P1 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P1	Host-Associated	Open in IMG/M
3300002509	Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4	Host-Associated	Open in IMG/M
3300002552	Cornitermes sp. P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P1	Host-Associated	Open in IMG/M
3300002834	Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4	Host-Associated	Open in IMG/M
3300006045	Neocapritermes taracua P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P3	Host-Associated	Open in IMG/M
3300009784	Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4	Host-Associated	Open in IMG/M
3300009826	Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1	Host-Associated	Open in IMG/M
3300010049	Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3	Host-Associated	Open in IMG/M
3300010162	Labiotermes labralis P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P1 (version 2)	Host-Associated	Open in IMG/M
3300010167	Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3	Host-Associated	Open in IMG/M
3300010369	Labiotermes labralis P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P1 (version 3)	Host-Associated	Open in IMG/M
3300010882	Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4	Host-Associated	Open in IMG/M
3300027864	Cornitermes sp. P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P1 (SPAdes)	Host-Associated	Open in IMG/M
3300027891	Cubitermes ugandensis P4 segment gut microbial communities from Kakamega Forest, Kenya - Cu122 P4 (SPAdes)	Host-Associated	Open in IMG/M

Protein ID	Sample Taxon ID	Habitat	Sequence
JGI24695J34938_104528431	3300002450	Termite Gut	HFTEPEGSLPHSQASANCLYPEPAQSSPYIHIPPPREPS*
JGI24703J35330_107561321	3300002501	Termite Gut	NSPHFMEPEGSLPHSQASATRPYSGLAQSSPHTHNPPPGDPS*
JGI24703J35330_108204811	3300002501	Termite Gut	RNSPHFMEPEGSLPHSQASATRPYPELAQSSPRSHNPPPGDPS*
JGI24703J35330_109741551	3300002501	Termite Gut	FAASQEIPHFMEPEGSLPHSQASATRPYPGLAQSSPHAHNPPPGDPS*
JGI24703J35330_110636092	3300002501	Termite Gut	RNSPHFMEPKGSLPHSQASATRPYPGLAQSSPHTHNPPPGDPS*
JGI24703J35330_111237711	3300002501	Termite Gut	NSPHFMEPEGSLPHSQASATRPYRGLAQSSPHAHNPPPGDPF*
JGI24703J35330_111304991	3300002501	Termite Gut	MEPEGSLPHSQASATRPYPVLAQSSPHTHNQPRGDLFAFT*
JGI24703J35330_111879401	3300002501	Termite Gut	NSPHFMEPEGSLPHSQASAIRPYPGLAQSSPHNHTQPPGDPS*
JGI24703J35330_111885031	3300002501	Termite Gut	RNSPHFMEPEGSLPHSQASATRPYPGLAQSSALTHNPFAFRNFYG*
JGI24703J35330_112581712	3300002501	Termite Gut	MEPEGSLPHSEASVTCPYPGLAQSSPHAHNPPPGDPPNIIHP
JGI24703J35330_113965681	3300002501	Termite Gut	MEPEGSLPHSQASATRPYPGLAQSSPHAHNAPPADIFIIY*
JGI24703J35330_115473833	3300002501	Termite Gut	RNSPHFMEPEGSLLHSQASATRPYPGLAQSSPHTHNPPPGDPS*
JGI24705J35276_117841422	3300002504	Termite Gut	PHFMEPEGSLPHSQASATRPYPELAQSSPRSHNPPPGDPS*
JGI24705J35276_119120832	3300002504	Termite Gut	SPHFMEPEGSLPHSQASATHPYPGLAQSSTHAHNPPPGDPSIYA*
JGI24697J35500_104616382	3300002507	Termite Gut	MELEGSLQHSQASATCPCPGPAQSSPHTHITPPADPPNIIH
JGI24697J35500_105438761	3300002507	Termite Gut	FLWNPEGSLPHSQASATCRYPGPAQSSPHTHIPPPGDPS*
JGI24697J35500_106216122	3300002507	Termite Gut	ANWFAASQEIPRIFMEPEGSLPHSQTSATCPYPGPAQSSPRTHIPPPGDPS*
JGI24697J35500_106284741	3300002507	Termite Gut	RIFMEPEGLLPHSQASATCPYPGPAQSSPHTHILLPGDPS*
JGI24697J35500_108916231	3300002507	Termite Gut	NSPHFMEPEGSLLHSQASATCPYPGPAQSSPHTYIPPPGDPS*
JGI24697J35500_109709242	3300002507	Termite Gut	QEIPRIFMEPEGSLPHSQASATCPYPGPAQSSPRTHIAPPGEPS*
JGI24697J35500_110456801	3300002507	Termite Gut	MEPESSLAHPQASANSPYPGPAQSSPHTRIPLPANPSYSY
JGI24697J35500_110954961	3300002507	Termite Gut	AASQEIPRIFMEPEGSLPHSQASATCPYHVPAQSSPHTHIPPPGDPS*
JGI24697J35500_110978681	3300002507	Termite Gut	RNSPHFMEPEGSLPHSQASATCPYPVPAQSSPHTHIPPTGDPS*
JGI24697J35500_111450694	3300002507	Termite Gut	NSPHFMEPEGLLPHSQASATCPYPGPAQSSPHTHIPPPGDTS*
JGI24699J35502_103430701	3300002509	Termite Gut	HFMEPEGSSPHSQASATCPYPGPAQSSPHTHIQPPGDPS*
JGI24699J35502_106032992	3300002509	Termite Gut	QEIPRIFMEPEGSLPHSQASATCPYPGPAQSSSHTHIPPPADPT*
JGI24699J35502_106119502	3300002509	Termite Gut	EIPRIFMEPEGSLPHSQASATCPYPGPAQSSPRTHIAPPGEPS*
JGI24699J35502_106506311	3300002509	Termite Gut	HFMEPEGSLPHSQASATCPYPGPAQSSPHTHIQPPAYRKIIK*
JGI24699J35502_109222161	3300002509	Termite Gut	RFMEPEGSSPHSQASATCPYPEPAQSSPHTLIPPPEGQS*
JGI24699J35502_109284023	3300002509	Termite Gut	SPHFMEPEGSLPHSQASATCPYPVPAQSSPHTHIPPTGDPS*
JGI24699J35502_109563701	3300002509	Termite Gut	SPHFMEPESSLPHSQASAICPYPVPAQSSPHTHIPPPGDPS*
JGI24694J35173_102059811	3300002552	Termite Gut	SQEIPHFTEPEGSLPHSQESATCLYPGPAQSSPYTHIPPPGDPS*
JGI24694J35173_104984591	3300002552	Termite Gut	HFTEPEGSLPHSQASATCPYPGPVQSXXYTHIPPPGDPS*
JGI24696J40584_123522612	3300002834	Termite Gut	PHFTEPEGSLPHSQASATCLYPGPAQSSPHTNIQPHGDPS*
JGI24696J40584_123868051	3300002834	Termite Gut	SPHFTEPEGSLPHSQASVTCPYPGPAQSSPHTHIPPPGDPA*
JGI24696J40584_124707772	3300002834	Termite Gut	HFTEPEGSLPHSQASATCLYPEPAQSSPYTQTPLPGDPSLY*
JGI24696J40584_124870491	3300002834	Termite Gut	PHFTEPEGSLPHSQPSANCLYPGPAQSSPHTEIPPPGDPS*
JGI24696J40584_124943761	3300002834	Termite Gut	PHFTEPEGSLPHLQASATCLYPGPAQSSPHTDIPPPGDSS*
JGI24696J40584_126381291	3300002834	Termite Gut	SPHFTEGSLPHSQASVTCLYPGPAQSSPYTHIPPPGDPS*
JGI24696J40584_126699901	3300002834	Termite Gut	SRNSPHFTEPEGSLPYSQASAIYLYPGPAQSSPYTHIPTPGDHS*
JGI24696J40584_129229554	3300002834	Termite Gut	HFTEPEGSLPHSQASATCLYPGPAQSSPHTHIPPTGDPS*
Ga0082212_100658451	3300006045	Termite Gut	MEPEGSLPHSQASATRSYPGLAQSSPHTRNPPPADPS
Ga0082212_100718256	3300006045	Termite Gut	MEPEGSLPHSQASTTRPYPGLAQSSPHAHNQPSGDPSYYYPP
Ga0082212_100758995	3300006045	Termite Gut	MEPEGSLPHSQASATRPYPGLAQSSPHAHNPPPGD
Ga0082212_100996671	3300006045	Termite Gut	MEPEGSLPHSQASATRPYPGLAQSSPHTHNPPPGDPS*
Ga0082212_101371164	3300006045	Termite Gut	MEPEGSLPHSQASTTHPYPGLAQSSPHAHNPPPGDP
Ga0082212_101545661	3300006045	Termite Gut	MEPEGSLPHSQASATRPYPGLAQSSPHTHNPPPADPS
Ga0082212_102308745	3300006045	Termite Gut	MESEGSLTHSQASTTRPYPGLAQSSPHAHNPPPGDP
Ga0082212_103372351	3300006045	Termite Gut	MEPEGSLPHSQASATRPYPGLAQSSPHTHNPPPADPSKY
Ga0082212_104477983	3300006045	Termite Gut	MEPEGSLPHSQASATRPYPGLAQSSPHTHNQPPADPFQ
Ga0082212_104715601	3300006045	Termite Gut	MEPEGSLPHSQASATRPYLGLAQTSPHAHNPPPGN
Ga0082212_105243482	3300006045	Termite Gut	SPHFMEPEGSLPHSQASATRPYPGLAQYSPHTRNPPPADSS*
Ga0082212_105443762	3300006045	Termite Gut	MEPEGSFPHSQASATRPYPGLAQSSPHAHNPPPGDP
Ga0082212_105785131	3300006045	Termite Gut	METEGSLPHSQTSATRPYPGLAQSSPHTHNPPPGDP
Ga0082212_106568721	3300006045	Termite Gut	MEPEGSLPRSQASATRPYLELAQSSPHAHNPPPGDPS
Ga0082212_112249851	3300006045	Termite Gut	HFMEPEGSLPHSQASATRHYPEIAQSSPHAHNPPPGDPS*
Ga0082212_115410871	3300006045	Termite Gut	MEPKGSLPHSQASATRPYTGLAQSSPHTHNPPPAD
Ga0123357_100820033	3300009784	Termite Gut	MEPEGSLPYSQASATRSYPGPAKSSPYTQIPPPGEPS*
Ga0123357_101807631	3300009784	Termite Gut	MEPEGSLPHSQASATCLYPGPAQTSPYTHIPLPGD
Ga0123357_103691821	3300009784	Termite Gut	MEPEGSLPYSQASATCLYPGPAQSSPYTHIPPPGD
Ga0123357_110370881	3300009784	Termite Gut	MEPEGSLPHSQASANRLYPGPAQSSPYTHIPPPGD
Ga0123355_101122882	3300009826	Termite Gut	MEPEGSLPHSQASATCLYPGPAQSSPYTHIPPSGDPA
Ga0123355_101179704	3300009826	Termite Gut	MEPEGSLPHSQAPATCLYPGPAQSSPYTHIPPPGDLS*
Ga0123355_101242287	3300009826	Termite Gut	MEPKGSLPHSQASATCLYPGPTQSSPYTHIPPPGDPS
Ga0123355_101903412	3300009826	Termite Gut	METENSLLHSQASANCPYPGPAQSSPYTHIPPNADTS*
Ga0123355_105388401	3300009826	Termite Gut	MEPEGSLPHSQASAICLYPGPAQSSPYTYIPPPGDP
Ga0123355_106337912	3300009826	Termite Gut	MEPEGSLLHSQASATCLYPGPAQSSPYTHIPLPGDP
Ga0123355_116202721	3300009826	Termite Gut	MESEGSLLHSQASANCLYPGPAQSSPYTHIPPPGDPT
Ga0123356_101609201	3300010049	Termite Gut	MEPEGSLPHSQASATRLYPGPTQSSPYTHIPPPGDL
Ga0123356_104187221	3300010049	Termite Gut	MEPEGSLPHSQASATCLYPGPAQSSPYTHIPSPAD
Ga0123356_104981501	3300010049	Termite Gut	MEPEGSLPHSQASANCLYPGPAQSSPYTHIPPPADP
Ga0123356_107790201	3300010049	Termite Gut	MEPEGSLPHSQASATCLYPGPTQSSPYTHIPPPGDP
Ga0123356_120368601	3300010049	Termite Gut	MEPEVSLPHSQASATRPYPGPAQSSPHTHTPTSLI
Ga0131853_100250571	3300010162	Termite Gut	MEPEGSLPHSQASATYLYPGPAQSSPYIHILPPGDPS*
Ga0131853_100476554	3300010162	Termite Gut	MEPEGSLPHSQASATYLYPEPAQSSPYTHIPPPGDPS*
Ga0131853_100730063	3300010162	Termite Gut	MEPEGSLPHSQASATCLYPEPAQSSQYTHIPLPGDSS*
Ga0131853_100869085	3300010162	Termite Gut	MEPEGSLQYSQASATRPYPGPAQSSPYTHISPPGDPS*
Ga0131853_101303183	3300010162	Termite Gut	MEPEGSLPHSQASATYPYPGTTQSSPHTHIPPPGDPS
Ga0131853_104999662	3300010162	Termite Gut	MEPEGSLPYSQASATYPYPGPTQSSPHSHIPPPGD
Ga0123353_1000657413	3300010167	Termite Gut	MEPEGSLPHSQASATYLYPGPAQSSPYTHIPPPGD
Ga0123353_100141949	3300010167	Termite Gut	MEPECSLPHSQASANCLYPGPAQSSPYTHIPPPGDP
Ga0123353_100420994	3300010167	Termite Gut	MEPEGSLPHLQASATCLYPGPAQSSPYTHIPPTGDPS*
Ga0123353_101323793	3300010167	Termite Gut	METEGSLPHSQASATYLYPGPAQSSPYTHILPPGDPS*
Ga0123353_101347503	3300010167	Termite Gut	TEPEGSLPHSQASATCPYPGPAQSSPYTHIPPPGDPS*
Ga0123353_103445951	3300010167	Termite Gut	MEPEGSLPHSQASATCPYPGPTQSSPHTHIPPIYI
Ga0123353_105128161	3300010167	Termite Gut	MEPEGSLPYSQASATYPYPGPTQSSPHTHIPPPGD
Ga0123353_108060191	3300010167	Termite Gut	MEPEGSLPHSQASATYPYPGPTQSSPHTHIPPPGD
Ga0123353_114876601	3300010167	Termite Gut	MEPEGSLQHSQASANCPYPGPTQSSPYTHIPPPGDPS
Ga0136643_100515021	3300010369	Termite Gut	MEPEGSLPHSQASATCPYLGPTQSSPHTHIPPPGDPS
Ga0136643_100719094	3300010369	Termite Gut	FTEPEGSLPHSQASATRLYPGPAQSSPYTYIPPPGDPS*
Ga0136643_100796351	3300010369	Termite Gut	MEPEGSLPHSQASATYLYPGPAQSSPYNHTLPPGDPS*
Ga0136643_101105253	3300010369	Termite Gut	MEAEGSLPHSQASATGPYPGPAQSSPYTHIPPPGDPS*
Ga0136643_101109444	3300010369	Termite Gut	MEPEGSLLHSQASATCLYPAPAQSSPYTHIPPPGDPS
Ga0136643_101296682	3300010369	Termite Gut	MEPEGSLPHSQASATCPYPGPAQSSSYTHIPPTGDPSSYNPPIYA*
Ga0136643_101432122	3300010369	Termite Gut	MEPEGSLPYSQASAIYPYPGPTQSSPHTHMPPPEDP
Ga0136643_105702371	3300010369	Termite Gut	MEPEGSLSYSQASATCPYPGPTQSSPHTHIPPPGDPS
Ga0123354_1001497314	3300010882	Termite Gut	MEPEGSLPHSQASAICPYPGPAQSSPYTHIPPPGDP
Ga0123354_100708641	3300010882	Termite Gut	METEGSLPHSQASATYLYPGPAQSSPYTHILPPGDP
Ga0123354_101347611	3300010882	Termite Gut	MEPEGSLPHSQASATCSYPGPTQSSPHTHIPPTGDP
Ga0123354_103686121	3300010882	Termite Gut	MEPEGSLPHSQASANCLYAGPAQSSPYTHIPPPGD
Ga0209755_100137645	3300027864	Termite Gut	MEPEGSLLHSQASATHPYLGPAQSSLYTHIPPAGDPS
Ga0209755_100524341	3300027864	Termite Gut	MEPEGSLPHSQASATCLYPGPAQSSPYTHIPPPGDPS
Ga0209755_100902531	3300027864	Termite Gut	MEPEGSLPHSQASATCLYPGPAKSSPYTHIPPSGDPS
Ga0209755_102342722	3300027864	Termite Gut	MEPEGSLWHSQASATCLYPGPAQSSPYTHIPPPGDPSKYY
Ga0209755_103121011	3300027864	Termite Gut	MEPEGSLPHSQAYATCLYPGPAQSSPYTHIPSPGD
Ga0209755_104668011	3300027864	Termite Gut	MEPEGSLAHSQASATCLYPGPAQSSPYTHIPPPGDPS
Ga0209755_104681581	3300027864	Termite Gut	MEPEGSLPHSQPSATCLYPGPAQSSPYTHIPPPGDP
Ga0209755_106021721	3300027864	Termite Gut	MEPESSLPHSQAYATCLYPGPAQSSPHAHIPPPGDPS
Ga0209755_107234401	3300027864	Termite Gut	MEPEGSLPHSQASATCPYPGPAQSSPYAHIPPPGDP
Ga0209755_109081861	3300027864	Termite Gut	FTEPEGSLAHSQAYATCPYPGPAQSSPHTHIPPPGDPS
Ga0209755_111441731	3300027864	Termite Gut	MEPEGSLPHSQASATCPYPGPAQSSPHTHIPPPGD
Ga0209628_111308222	3300027891	Termite Gut	MEPEGSLPHSQVPATCPYPESARSSPYTHIPLPEKSI

Hidden Markov Model


Click on a Sequence Logo column to get its information.
Powered by Skylign