NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome Family F083621

Metagenome Family F083621

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F083621
Family Type Metagenome
Number of Sequences 112
Average Sequence Length 56 residues
Representative Sequence MKAQYLHCPWNTSLDDWYKKWFYIHEEPNTITLCDVGYIPEKRTSWSEKPEHLE
Number of Associated Samples 57
Number of Associated Scaffolds 112

Quality Assessment
Transcriptomic Evidence No
Most common taxonomic group Eukaryota
% of genes with valid RBS motifs 16.51 %
% of genes near scaffold ends (potentially truncated) 42.86 %
% of genes from short scaffolds (< 2000 bps) 92.86 %
Associated GOLD sequencing projects 57
AlphaFold2 3D model prediction Yes
3D model pTM-score0.29

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Eukaryota (97.321 % of family members)
NCBI Taxonomy ID 2759
Taxonomy All Organisms → cellular organisms → Eukaryota

Most Common Ecosystem
GOLD Ecosystem Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Miscanthus Phyllosphere
(83.036 % of family members)
Environment Ontology (ENVO) Unclassified
(91.964 % of family members)
Earth Microbiome Project Ontology (EMPO) Host-associated → Plant → Plant surface
(83.036 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 9.76%    β-sheet: 14.63%    Coil/Unstructured: 75.61%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.29
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 112 Family Scaffolds
PF04195Transposase_28 30.36
PF13456RVT_3 0.89
PF03732Retrotrans_gag 0.89
PF00665rve 0.89

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 112 Family Scaffolds
COG2801Transposase InsO and inactivated derivativesMobilome: prophages, transposons [X] 0.89
COG2826Transposase and inactivated derivatives, IS30 familyMobilome: prophages, transposons [X] 0.89
COG3316Transposase (or an inactivated derivative), DDE domainMobilome: prophages, transposons [X] 0.89
COG4584TransposaseMobilome: prophages, transposons [X] 0.89


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms97.32 %
UnclassifiedrootN/A2.68 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300009098|Ga0105245_11642380All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor695Open in IMG/M
3300009148|Ga0105243_11767611All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor649Open in IMG/M
3300009148|Ga0105243_12110856All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor599Open in IMG/M
3300009148|Ga0105243_13033539All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor509Open in IMG/M
3300011119|Ga0105246_10247373All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor1413Open in IMG/M
3300013296|Ga0157374_10558149All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor1153Open in IMG/M
3300013296|Ga0157374_12173403All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor582Open in IMG/M
3300014486|Ga0182004_10003709All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor12196Open in IMG/M
3300014486|Ga0182004_10005985All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor9922Open in IMG/M
3300014486|Ga0182004_10015412All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor5964Open in IMG/M
3300014486|Ga0182004_10056265All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor2202Open in IMG/M
3300014486|Ga0182004_10056439All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor2197Open in IMG/M
3300014486|Ga0182004_10079439All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor1591Open in IMG/M
3300014486|Ga0182004_10089585All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor1420Open in IMG/M
3300014486|Ga0182004_10122383All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor1059Open in IMG/M
3300014486|Ga0182004_10257487All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor562Open in IMG/M
3300014969|Ga0157376_11862498All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum638Open in IMG/M
3300015267|Ga0182122_1019843All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor717Open in IMG/M
3300015267|Ga0182122_1026551All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor664Open in IMG/M
3300015267|Ga0182122_1063570All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor522Open in IMG/M
3300015268|Ga0182154_1054020All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor550Open in IMG/M
3300015268|Ga0182154_1064639All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor522Open in IMG/M
3300015268|Ga0182154_1065798All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor520Open in IMG/M
3300015269|Ga0182113_1081326All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor532Open in IMG/M
3300015269|Ga0182113_1087831All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor519Open in IMG/M
3300015274|Ga0182188_1018657All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor688Open in IMG/M
3300015274|Ga0182188_1031710All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor601Open in IMG/M
3300015274|Ga0182188_1038558All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor572Open in IMG/M
3300015274|Ga0182188_1061248All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor505Open in IMG/M
3300015275|Ga0182172_1032241All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor646Open in IMG/M
3300015275|Ga0182172_1053086All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor562Open in IMG/M
3300015276|Ga0182170_1036830All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor624Open in IMG/M
3300015276|Ga0182170_1059257All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor545Open in IMG/M
3300015279|Ga0182174_1055027All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor576Open in IMG/M
3300015279|Ga0182174_1073554All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor527Open in IMG/M
3300015281|Ga0182160_1071466All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor528Open in IMG/M
3300015281|Ga0182160_1083313All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor503Open in IMG/M
3300015283|Ga0182156_1029058All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor694Open in IMG/M
3300015283|Ga0182156_1077967All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor521Open in IMG/M
3300015285|Ga0182186_1083195All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor502Open in IMG/M
3300015286|Ga0182176_1055103All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor579Open in IMG/M
3300015286|Ga0182176_1077913All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor518Open in IMG/M
3300015286|Ga0182176_1079016All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor516Open in IMG/M
3300015287|Ga0182171_1079997All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor519Open in IMG/M
3300015288|Ga0182173_1025835All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor709Open in IMG/M
3300015288|Ga0182173_1048045All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor598Open in IMG/M
3300015288|Ga0182173_1049452All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor593Open in IMG/M
3300015288|Ga0182173_1068462All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor539Open in IMG/M
3300015288|Ga0182173_1086050All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor502Open in IMG/M
3300015292|Ga0182141_1090484All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor509Open in IMG/M
3300015294|Ga0182126_1063887All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor569Open in IMG/M
3300015295|Ga0182175_1043179All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor644Open in IMG/M
3300015296|Ga0182157_1066766All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor575Open in IMG/M
3300015296|Ga0182157_1068101All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor572Open in IMG/M
3300015296|Ga0182157_1075668All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor553Open in IMG/M
3300015299|Ga0182107_1085716All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor535Open in IMG/M
3300015300|Ga0182108_1025889All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor766Open in IMG/M
3300015300|Ga0182108_1052476All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor625Open in IMG/M
3300015300|Ga0182108_1066511All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor583Open in IMG/M
3300015300|Ga0182108_1104755All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor505Open in IMG/M
3300015302|Ga0182143_1060522All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor595Open in IMG/M
3300015303|Ga0182123_1027971All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor720Open in IMG/M
3300015304|Ga0182112_1074428All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor561Open in IMG/M
3300015305|Ga0182158_1026868All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor748Open in IMG/M
3300015307|Ga0182144_1026417All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor764Open in IMG/M
3300015308|Ga0182142_1058667All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor620Open in IMG/M
3300015314|Ga0182140_1021199All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor831Open in IMG/M
3300015314|Ga0182140_1057085All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor626Open in IMG/M
3300015314|Ga0182140_1061316All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor613Open in IMG/M
3300015314|Ga0182140_1099989All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor527Open in IMG/M
3300015321|Ga0182127_1121638All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor506Open in IMG/M
3300015322|Ga0182110_1026025All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor807Open in IMG/M
3300015322|Ga0182110_1076718All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor587Open in IMG/M
3300015322|Ga0182110_1080132All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor579Open in IMG/M
3300015323|Ga0182129_1050536All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor646Open in IMG/M
3300015341|Ga0182187_1196804All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor505Open in IMG/M
3300015342|Ga0182109_1088852All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor710Open in IMG/M
3300015342|Ga0182109_1131336All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor616Open in IMG/M
3300015343|Ga0182155_1048060All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor868Open in IMG/M
3300015343|Ga0182155_1162103All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor569Open in IMG/M
3300015345|Ga0182111_1124810All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor653Open in IMG/M
3300015345|Ga0182111_1170669All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor579Open in IMG/M
3300015346|Ga0182139_1043904All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor953Open in IMG/M
3300015346|Ga0182139_1153488All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor604Open in IMG/M
3300015346|Ga0182139_1154255All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor603Open in IMG/M
3300015346|Ga0182139_1164413All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor588Open in IMG/M
3300015346|Ga0182139_1243386All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor503Open in IMG/M
3300015355|Ga0182159_1179056All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor674Open in IMG/M
3300015355|Ga0182159_1330760All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor516Open in IMG/M
3300015355|Ga0182159_1339343All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor510Open in IMG/M
3300015361|Ga0182145_1100017All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor629Open in IMG/M
3300015361|Ga0182145_1137846All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor565Open in IMG/M
3300017404|Ga0182203_1078066All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor640Open in IMG/M
3300017409|Ga0182204_1072692All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor587Open in IMG/M
3300017410|Ga0182207_1164362All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor515Open in IMG/M
3300017411|Ga0182208_1024495All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor831Open in IMG/M
3300017417|Ga0182230_1064554All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor651Open in IMG/M
3300017424|Ga0182219_1122495All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor525Open in IMG/M
3300017425|Ga0182224_1137040All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor535Open in IMG/M
3300017427|Ga0182190_1089437All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor621Open in IMG/M
3300017436|Ga0182209_1085500All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor633Open in IMG/M
3300017683|Ga0182218_1123606All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor538Open in IMG/M
3300017683|Ga0182218_1147062All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor509Open in IMG/M
3300017686|Ga0182205_1108488All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor588Open in IMG/M
3300017686|Ga0182205_1157160All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor518Open in IMG/M
3300017689|Ga0182231_1100350All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor558Open in IMG/M
3300017690|Ga0182223_1079887All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor569Open in IMG/M
3300017690|Ga0182223_1122045All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor505Open in IMG/M
3300025934|Ga0207686_11697878All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor522Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
Miscanthus PhyllosphereHost-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Miscanthus Phyllosphere83.04%
RootHost-Associated → Plants → Roots → Unclassified → Unclassified → Root8.93%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere5.36%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere2.68%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300009098Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaGHost-AssociatedOpen in IMG/M
3300009148Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaGHost-AssociatedOpen in IMG/M
3300011119Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaGHost-AssociatedOpen in IMG/M
3300013296Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaGHost-AssociatedOpen in IMG/M
3300014486Endophyte microbial communities from Sorghum bicolor roots, Mead, Nebraska, USA - 072115-40_1 MetaGHost-AssociatedOpen in IMG/M
3300014969Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaGHost-AssociatedOpen in IMG/M
3300015267Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_31MAY2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015268Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_12JUL2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015269Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_09MAY2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015274Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_22AUG2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015275Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_01AUG2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015276Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_01AUG2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015279Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_01AUG2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015281Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_12JUL2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015283Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_12JUL2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015285Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_22AUG2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015286Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_01AUG2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015287Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_01AUG2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015288Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_01AUG2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015292Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_20JUN2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015294Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_31MAY2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015295Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_01AUG2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015296Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_12JUL2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015299Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_09MAY2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015300Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_09MAY2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015302Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_20JUN2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015303Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_31MAY2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015304Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_09MAY2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015305Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_12JUL2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015307Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_20JUN2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015308Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_20JUN2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015314Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_20JUN2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015321Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_31MAY2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015322Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_09MAY2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015323Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_31MAY2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015341Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_22AUG2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015342Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_09MAY2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015343Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_12JUL2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015345Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_09MAY2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015346Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_20JUN2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015347Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_01AUG2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015355Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_12JUL2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015361Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_20JUN2016_LD1 MGHost-AssociatedOpen in IMG/M
3300017404Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_12SEP2016_LD1 MGHost-AssociatedOpen in IMG/M
3300017409Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_12SEP2016_LD1 MGHost-AssociatedOpen in IMG/M
3300017410Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_12SEP2016_LD1 MGHost-AssociatedOpen in IMG/M
3300017411Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_12SEP2016_LD1 MGHost-AssociatedOpen in IMG/M
3300017417Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_07NOV2016_LD1 MGHost-AssociatedOpen in IMG/M
3300017424Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_03OCT2016_LD1 MGHost-AssociatedOpen in IMG/M
3300017425Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_03OCT2016_LD1 MGHost-AssociatedOpen in IMG/M
3300017427Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_22AUG2016_LD1 MGHost-AssociatedOpen in IMG/M
3300017436Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_12SEP2016_LD1 MGHost-AssociatedOpen in IMG/M
3300017683Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_03OCT2016_LD1 MGHost-AssociatedOpen in IMG/M
3300017686Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_12SEP2016_LD1 MGHost-AssociatedOpen in IMG/M
3300017689Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_07NOV2016_LD1 MGHost-AssociatedOpen in IMG/M
3300017690Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_03OCT2016_LD1 MGHost-AssociatedOpen in IMG/M
3300025934Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
Ga0105245_1164238013300009098Miscanthus RhizosphereMKAQYLHYPWNTSLDEWYKKWFYIHEEPNTITLCDVGFIPEKKNSWSEKPKHLE*
Ga0105243_1176761123300009148Miscanthus RhizosphereMKAQYLHCPWNMSLDDWYKKWFYIHEEPNTITLCDTGYIPEKKTSWSEKPKHLEQIQEIFGMIP*
Ga0105243_1211085623300009148Miscanthus RhizosphereVYLNLHDGMKAQYLRYPWNTSLDDWYKKWFYIREEPNTITLCDVGYIPEKRTSWSEKPEHLE*
Ga0105243_1303353923300009148Miscanthus RhizosphereMKAQYLHCPWNMSLDDWYKKWFYIREEPNTITLCDAGYIPKKKTSWSEKP
Ga0105246_1024737333300011119Miscanthus RhizosphereMRAQYLHCPWNTSLDEWYKKWFYIREEPNTITLCDVGLIPEKKNS*
Ga0157374_1055814923300013296Miscanthus RhizosphereMKAQYLHCPWNTSLDDWYKKWFYIREEPNTITLCDAGYIPEKKTSWSKKPEHLGQIPEIFGMIP*
Ga0157374_1217340323300013296Miscanthus RhizosphereMKAQDLHCPWNTSLDDWYKKWFYIREEPNTITLCDVGLIPEKKNSWSEKPEHLE*
Ga0182004_10003709103300014486RootMKNRYLNCPWNTSLTEWYKKWFYVREEPCSSTFCDVGYIPEKRVSWTDRPAFAG*
Ga0182004_1000598593300014486RootMKNRYLSCPWNTSLTEWYKMWFYIREEPGSVTFCDVGYIPEKRVS*
Ga0182004_1001541213300014486RootVYLNLCDGMKNRYLSCPWNTSLTEWYKKWFYIREEPGSAMFCDVGYIPEKRSAR*
Ga0182004_1005626513300014486RootMKNRYLNCPWNTSLTEWYKKWFYISEEPGSSTFCDVGYIPEKRVS*
Ga0182004_1005643953300014486RootLNCPWNTSLTEWYKKWFYVREEPGSSTFCDVGYIPEKRVS*
Ga0182004_1006444513300014486RootGVYLNLHDGMKNRYLNCPWNTSLTEWYKKWFYVREEPGSSTFCDVGYIPEKRVS*
Ga0182004_1007943913300014486RootNRYLHCPWNTSLTEWYRKWFYVREEPGSSTFCDVGYIPEKRVS*
Ga0182004_1008958513300014486RootMRNRYLNCPWNTSLTEWYKKWFYVREEPGSSTFCDVGYIPEK
Ga0182004_1012238313300014486RootLVFKIAGGVYLNLRDGMKNQYLSFPWNTSLTKWYKRWFYIREEPGSATFCDIG
Ga0182004_1025748713300014486RootLSCSWNTSLTEWYKKWFYVREEPGSSTFCDVGYIPEKRVS*
Ga0157376_1186249823300014969Miscanthus RhizosphereVYLNLHDGIKAQYLHCPWNTSLDDWYKKWFYIHEEPNTITLCDVGYIPEKRTSWSKKPEHLG*
Ga0182122_101984313300015267Miscanthus PhyllosphereMKAQYLHCPWNTLLDDWYKKWFYILEEPNTITLCDVGFIPEKRTSWSEKPEHLEQIPKIF
Ga0182122_102655123300015267Miscanthus PhyllosphereMKAQYLHCPWNTSLDDWYKKWFYIHEEPSTITLCDVGFFPEKKNSWSEKPEHLE*
Ga0182122_106357023300015267Miscanthus PhyllosphereMKPQYLHCPWNTSLDDWYKKWFYIREELSTITLCDMGYILEKRTSGQRSPST*
Ga0182122_106951713300015267Miscanthus PhyllosphereHCPWNTSLDDWYKKWFYIHEELNTITLCDMGYIPEKRTSWSEKPEHLE*
Ga0182154_105402013300015268Miscanthus PhyllosphereMKAQYLHCPWNTSLDDWYKKWFYICEEPNMITLCDVGFIPEKKNS*
Ga0182154_106463913300015268Miscanthus PhyllosphereKIVEGVYLNLHDGMKAQYLHCPWNTSLDDWYKKWFYIREEPNTITLCDMGYIPKKRTSWSEKPEHLE*
Ga0182154_106579823300015268Miscanthus PhyllosphereMKAQYLHCPWNTSLDDWYKKWFYIHEEPNMITLCDVGFILEKRTSWSEKPEHLE*
Ga0182113_108132623300015269Miscanthus PhyllosphereVYLNLHDGMKAQYLHCPWNTSLDDWYKKWFYIREEPNTITLCDVGYIPEKKTSWSEKPEHLG*
Ga0182113_108783113300015269Miscanthus PhyllosphereLNLHDGMKAQYLHCPWNTSLDDWYKKWFYIREEPNTITLCDVGYILEKKTSWSEKPEHLG
Ga0182188_101865723300015274Miscanthus PhyllosphereMKAQYLHYPWNTSLDDWYKKWFYIHEELNTITLCDAGYIPKKKMS*
Ga0182188_103171023300015274Miscanthus PhyllosphereLNLRDEMKAQYLHCPWNTSLEDWYKKWFYIHEEPNTITLCDVGFIPEKKNSWSEKPKHLE
Ga0182188_103855813300015274Miscanthus PhyllosphereLNLCDGMKAQYLHCPWNTSLDDWYKKWFYIREELNTIILCDVGYILEKRTS*
Ga0182188_106124823300015274Miscanthus PhyllosphereMKAQYLHCPWNTSLDEWYKKWFYIREEPNTITLCDVGLIPEKKNSWSEKPENLEQIAELLGMIPWG
Ga0182172_103224133300015275Miscanthus PhyllosphereVYLNLRDGMKAQYLHCPWNMSLDDWYKKRFYVREEPNTITLCDVGYIPEKRTSW
Ga0182172_105308613300015275Miscanthus PhyllosphereVYLNLRDGMKAQYLHCPWNTSLDDWYKKWFYIREEPNTITLCDVGFILEKRTSWSEKPEHLEQIPE
Ga0182170_103683023300015276Miscanthus PhyllosphereMIAGGVYLNLRDGMKAQYLHCPWNTSLDDWYKKWFYIHEEPNTITLCDAGYIPKKKMSWSEKPEHLG*
Ga0182170_105925723300015276Miscanthus PhyllosphereMKAQYLHCPWNTSLDDWYKKWFYIREELNTITLCDVGYIPEKRTSWSEKPEHLEQISKILGMIP*
Ga0182174_105502723300015279Miscanthus PhyllosphereMKAQYLHYPWNTSLDGWCKKWFYIQEEPNTITLCDAGYIPEKKTS*
Ga0182174_107355423300015279Miscanthus PhyllosphereVYLNLRDGMKAKYLHCPWNTSLDDWYKKWFYIHEEPNTTTLCDVGYIPEKRTSWSEKPEHLE*
Ga0182160_107146623300015281Miscanthus PhyllosphereLKIAGGVYLNLRDGMKAQYLHCPWNTSLDDWYKKWFYIHKEPNTITLCDVGYIPEKRTSWLEKPEHLE*
Ga0182160_108331313300015281Miscanthus PhyllosphereMKAQYLHYPWNTSLDDWYKKWFYICEETNMIMLCDVGFIPEKKTSWSEKPEHLEQIPKLLGMI
Ga0182156_102905823300015283Miscanthus PhyllosphereMKAQYLHCPWNTSLEDWYKKWFYIREEPNTITLCDAGFIPENKNSWSEKPEHLE*
Ga0182156_107796713300015283Miscanthus PhyllosphereMKAQYLHCPWNTSLDDWYKKWFYIHEEPNTITLCDVGYIPEKRTSWSEKPEHLE*
Ga0182186_108319513300015285Miscanthus PhyllosphereMKAQYLHCPWNTSLDNWYKKWFYIHEEPNTITLCDVGFILEKKNSWSEKPEHLE*
Ga0182176_105510313300015286Miscanthus PhyllosphereVYLNLHDGMKAQYLHCPWNTSLDDWYKKWFYIREEPNTITLCDVGFIPEKRTS*
Ga0182176_107791313300015286Miscanthus PhyllosphereMKAQYLHCPWNTSLDDWYKKWFYIREEPNTITLCDVGFISEKKNS*
Ga0182176_107901613300015286Miscanthus PhyllosphereYLHCPWNTSLEDWYKKWFYIREEPNTITLCDVGFISKKKNSWSEKPDHLE*
Ga0182171_107999713300015287Miscanthus PhyllosphereMKAQYLHYPWNTSLDDWYKKWFYIRKEPNTITLCDMGFIPEKRTS*
Ga0182173_102583523300015288Miscanthus PhyllosphereMKAQYLHCPWTTSLEDWYKKWFYIHEEPNTITLCDVGFIPEKKNSWSEKPKHLE*
Ga0182173_104804523300015288Miscanthus PhyllosphereMKAQYLHCPWNTSLDDWYKKWFYIREEPNTITLCDVGYIPEKKTSWSERPEHL*
Ga0182173_104945223300015288Miscanthus PhyllosphereMKAQYLHCPWNTLLDDWYKKLFYIREEPNTIMLCDVGYISEKKTS*
Ga0182173_106846213300015288Miscanthus PhyllosphereVYLNLHDGMKAQYLHCPWNTLLDDWYKKWFYICEEPNTITLCNAGYILEKSWSEKPEHLGQIPEIFG
Ga0182173_108605013300015288Miscanthus PhyllosphereVYLNLHDGMKAQYLHCPWNTSLDDWYKKWFYIREEPNTITLCDTGYIPEKKTS*
Ga0182141_109048413300015292Miscanthus PhyllosphereMKAQYLHYPWNTSLDDWYKKWFYIREEPNTITLCDVGFISEKKNSWSKKPEHLEQI*
Ga0182126_106388713300015294Miscanthus PhyllosphereVYLNLRDGMKAQYLHCPWNTSLDDWYKKWFYIREEPNTITLCDVGYIPEKRTSWTEKPEH
Ga0182175_104317923300015295Miscanthus PhyllosphereVYLNLCDDMKAQYLHCPWNTSLDDWYKKWFYIHEELNTITLCDVGYIPEKKTSWS*
Ga0182157_106676623300015296Miscanthus PhyllosphereVYLNLHDGMKPQYLHCPWNMSLDDWYKKWFYIREEPNTITLCDVGFILEKKTSWSEKPKHLE*
Ga0182157_106810113300015296Miscanthus PhyllosphereMKAQYLHCPWNTSLDEWYKKWFYIREEPNTITLCDVGYILEKRTS*
Ga0182157_107566823300015296Miscanthus PhyllosphereMKAQYLHCPWNTSLDEWYKKWFYIREEPNTITLCDVGLIPKKKNSWSEKPERLEQI
Ga0182107_108571623300015299Miscanthus PhyllosphereMKAQYLHCPWNTSLNDWYKKWFYIREEPNTITLCDVGFILEKKNSWSEKPEHLE*
Ga0182108_102588913300015300Miscanthus PhyllosphereGGVYLNLHDGMKAQYLHCPWNTSLDDWYKKWFYIREEPNTITLCDVGYIPKKRTS*
Ga0182108_105247623300015300Miscanthus PhyllosphereVYLNLCAGIKAQYLHCPWNTSLDDWYKKWFYIREEPNTITLCDVGYIPEKRTSWSEKPEH
Ga0182108_106651113300015300Miscanthus PhyllosphereHDGMKAQYLHCPWNTSLDDWYKKWFYIHEEPNTITLCDAGYIPEKKTS*
Ga0182108_110475513300015300Miscanthus PhyllosphereLHCPWNTSLDDWYKKWFYIHEEPSTITLCDVGFIPEKKNSWSEKPEHLE*
Ga0182143_106052223300015302Miscanthus PhyllosphereMKAQYLHYPWNTSLDEWYKKWFYIHEEPNTITLCDVGLIPEKKNIWSEKPEHL*
Ga0182123_102797113300015303Miscanthus PhyllosphereVYLNLRDGMKAQYLHCPWNTLLDDWYKKWFYIHKEPNMITLCDMGFIPEKRTSWSEKPKHLE*
Ga0182112_107442813300015304Miscanthus PhyllosphereVYLNLRDGMKAQYLHSPWNMSLDDWYKKWFYIHEEPNTITLCDVGYISEKRTS*
Ga0182158_102686823300015305Miscanthus PhyllosphereLKIARGVYLNLRDGMKAQYLHCPWNTSLDDWYKKWFYIREEPNTITLCDMGFIPEKWTSWLKKPKHLE*
Ga0182144_102641723300015307Miscanthus PhyllosphereVYLNLHDGMKAQYLHCPWNTSLDDWYKKWFYIHEEPNTITLCDVGYIPEKRTSWSEKPKHLE*
Ga0182142_105866723300015308Miscanthus PhyllosphereVYLNLHDGMKAQYLHCPWNTSLDDWYKKWFYIREEPNMITLCDVGYILEKRTSWSEKPEHLE*
Ga0182140_102119913300015314Miscanthus PhyllosphereLFEIAGGVYLNLHDDMKAQYLHCPWNTSLNNWYKKWFYIHEEPNTITLCDAGYIPEKKTSWSKKPEHLG*
Ga0182140_105708513300015314Miscanthus PhyllosphereMKTQYLHCPWNTSLDEWYKKWFYIREEPNTITLCDVGLIPERKNSWSEKPENLEQIAELLGMIP*
Ga0182140_106131613300015314Miscanthus PhyllosphereMKAQYLHCPWNTSLDDWYKKWFYIHEELNTITLCDVGFIPEKKNSWSEKPEHLE*
Ga0182140_109998913300015314Miscanthus PhyllosphereLKIARGVYLNLHDSMKAQYLHYPWNTSLDNWYKKWFYIREEPNTITLCDAVYISE
Ga0182127_112163813300015321Miscanthus PhyllosphereMKAQYLHCPWNTSLDDWYKKWFYIHEEPNTITLCDVGYIPEKRTSWSEKPEHLG*
Ga0182110_102602523300015322Miscanthus PhyllosphereLKIAGGVYLNLYDGMKAQYLHYPWNMSLDDWYKKWFYIHEEPNTITLCDVGYILEKRTSWTEKPEHLE*
Ga0182110_107671823300015322Miscanthus PhyllosphereMKAQYLHCPWNTSLDDWYKKWFYICEEPNTITLCDVGFISEKKTS*
Ga0182110_108013223300015322Miscanthus PhyllosphereMKAQYLHCPWNTSLEDWYKKWFYIRKEPNTITLCDVGFIPEKKNSWSEKPEHLE*
Ga0182129_105053623300015323Miscanthus PhyllosphereVYLNLHDDMKAQYLHYTWNTSLDDWYKKWFYIREEPNTITLCDMGYIPEKRTSWTEKPEHLEQILEIFGMIP*
Ga0182187_119680413300015341Miscanthus PhyllosphereVYLNLHDDMKAQYLHYPWNTSLNDWYKKWFYIHEEPNTITLCNVSYILEKKISWSEKPEHLG*
Ga0182109_108885213300015342Miscanthus PhyllosphereMKAQYLHCPWNTSLDDWYKKWFYIREEPNTITLCDAGYILEKKTSWSERPEHLGQILEIFGMIP*
Ga0182109_113133623300015342Miscanthus PhyllosphereWKKGSGGSKIAGGVYLNLCDGMKAQYLHCPWNTSLDDWYKKWFYICEELNIITLCDVGFISEKKNSWSEKPEHLE*
Ga0182155_104806023300015343Miscanthus PhyllosphereVYLNLHDGMKDQYLHCPWNTSLNDWYKKWFYNHEEPNMITLCDVGYILEKRTSWSEKPKH
Ga0182155_116210323300015343Miscanthus PhyllosphereMKPQYLHCPWNTSLDDWYKKWFYIHEEPNTITLCDVGFIPEKRTS*
Ga0182111_112481023300015345Miscanthus PhyllosphereMKAQYLHCPSNTSLDDWYKKWLYVREELNTITLCDTGYIPEKKTSWSEKPEHLG*
Ga0182111_117066913300015345Miscanthus PhyllosphereLWKKGSGGSKIVGGVYLNLRDGMKPQYLHYPWNTSLDDWYKKWFYIREEPNIITLCDVGFIPEKKTSWSEKPEHLE*
Ga0182139_104390423300015346Miscanthus PhyllosphereCDGMKAQYLHCPWNTSLDDWYKKWFYIREEPNTITLCDVGYIPEKKMSWSEKPEHLG*
Ga0182139_115348823300015346Miscanthus PhyllosphereVYLNLRDGMKPQYLHCPWNTSLDDWYKKWFYIREEPNTITLCDVGFIPEKRTS*
Ga0182139_115425513300015346Miscanthus PhyllosphereVYLNLRDDMKAQYVHCPWNTSLDDWYKKWFYICEEPNTITLCDAGYILEKKTSWSERPEHLGQIP*
Ga0182139_116441313300015346Miscanthus PhyllosphereMKAQYLHCPWNTSLDDWYKKWFYIREEPNTITLCDVGFISEKKNSWSEKPEHLE*
Ga0182139_124338613300015346Miscanthus PhyllosphereIAGGVYLNLRDGMKAQYLHCPWNTSLDDWYKKWFYIHEELNTITLCDAGYIP*
Ga0182177_115795923300015347Miscanthus PhyllosphereLHYPWNTSLDEWYKKWFYIHEEPNTITLCDVGLIPEKKNSWSEKPENLE*
Ga0182159_117905623300015355Miscanthus PhyllosphereLYLNLCDGMKAQYLHCPWNTSLDDWYKKWFYIREEPNTITLCDVGYIPEKRTSWSEKPEHLEQIPEIFGMIP*
Ga0182159_133076013300015355Miscanthus PhyllosphereGVYLNLCDGMKAQYLHYPWNTSLDDWYKKWFYIREEPNMITLCDVGFIPEKRTS*
Ga0182159_133934323300015355Miscanthus PhyllosphereLHCPWNTSLDDWYKKWFYIHEEPSTITLCDVGFFPEKKNSWSEKPEHLEQIQELLGMI
Ga0182145_110001713300015361Miscanthus PhyllosphereVYLNLRDGMKPQYLHCPWNTSLDDWYKKWFYIHEEPNTITLCDVGFIPEKRTS*
Ga0182145_113784613300015361Miscanthus PhyllosphereLHDGMKAQYLHCPWNTSLDDWYKKWFYIREEPNTITLCDVGLIPEKRTS*
Ga0182203_107806613300017404Miscanthus PhyllosphereMKAQYLHCPWNTSLDEWYKKWFYIREEPNTITLCDVGLIPEKKNSWSEKPEHLE
Ga0182204_107269213300017409Miscanthus PhyllosphereGVYLNLCDSLKAQYLHCPWNTLLDDWYKKWFYIREELNTITLCDAGYILEKKTI
Ga0182207_116436223300017410Miscanthus PhyllosphereAKGVYLNLRDGMKAQYLHYPWNTSLDDWYKKWFYIREEPNTITLCDVGYILEKRTSWLEKPEHLK
Ga0182208_102449533300017411Miscanthus PhyllosphereMKAQYLHCPWNTSLEDWYKKWFYIREEPNTITLCDVGFILEKKNS
Ga0182230_106455423300017417Miscanthus PhyllosphereVYLNLYDGMKAQYLHCPWNTSLDDWYKKWFYIRKEPNTIMLCDVGYIPEKRTNWSEKSEHLE
Ga0182219_112249513300017424Miscanthus PhyllosphereVYLNLHDGMKAQYLHYPWNTSLDDWYKKWFYIHEEPNTIMMCNVGYIPEKKTSWSEKPEHLEQIPEIFGM
Ga0182224_113704023300017425Miscanthus PhyllosphereVYLNLHDDMKAQYLHCPWNTSLDDWYKKWFYIHEEPNTITLCDVGYIPEKRT
Ga0182190_108943723300017427Miscanthus PhyllosphereVYLNLHDGMKAQYLHCPWNMSLDDWYKKWFYIRKEPNTITLCDVGFIPKKRTSWLEKPEHLE
Ga0182209_108550013300017436Miscanthus PhyllosphereMKAQYLHCPWNTSLDEWYKKWFYIHEEPNTITLCDMGYIPEKRTSWLEKPEHLEQ
Ga0182218_112360613300017683Miscanthus PhyllosphereMKDQYLHCPWNTSLDDWYKKWFYIREEPNTITLCDAGYIPEKKTS
Ga0182218_114706213300017683Miscanthus PhyllosphereCDGMKAQYLHYPWNTSLDEWYKKWFYIHEEPNTITLCDVGLIPKKKNS
Ga0182205_110848823300017686Miscanthus PhyllosphereVYLNLHDGMKAQYLHCPWNTSLDDWYKKWFYIREEPNTITLCDVGFIPEKKNSWSEKPEHLE
Ga0182205_115716023300017686Miscanthus PhyllosphereAPYLHCPWNTSLEDWYKKWFYIREEPNTITLCDVGFIPEKKNS
Ga0182231_110035013300017689Miscanthus PhyllosphereMKAQYLHYPWNTSLEDWYKKWFYIREEPNMITLCDVGYIPKKRTSWSEKPKHLEQIPEIFGMIPW
Ga0182223_107988713300017690Miscanthus PhyllosphereYLHCPWNTSLDDWYKKWFYIREEPNTITLCDAGYILGKKTSWSEKPEHLGQIPEIFGMIPWKNWMVRA
Ga0182223_112204523300017690Miscanthus PhyllosphereMKAQYQHCPWNTSLDEWYKKWFYIREEPNMITLCDVGLIPEKKNSWSEKP
Ga0207686_1169787813300025934Miscanthus RhizosphereGGVYLNLRDGMKAQYLHCPWNTSLDDWYKKWFYIREEPNTITLCDVGLIPEKKNS


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.